Update README.md

README.md

@@ -17,10 +17,10 @@ model_name = "ChatterjeeLab/FusOn-pLM"
 tokenizer = AutoTokenizer.from_pretrained(model_name)
 model = AutoModel.from_pretrained(model_name)
 
-# Example fusion oncoprotein sequence: ETV6::CDK2AP1  
-# Amino acids 1-52 are derived from the head gene, ETV6
-# Amino acids 53-73 are derived from the tail gene, CDK2AP1
-sequence = "MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRIIHARGLVRECLAETERNARS"
+# Example fusion oncoprotein sequence: MLLT10:PICALM, associated with Acute Myeloid Leukemia (LAML)  
+# Amino acids 1-80 are derived from the head gene, MLLT10
+# Amino acids 81-119 are derived from the tail gene, PICALM
+sequence = "MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQIQFM"
 
 # Tokenize the input sequence
 inputs = tokenizer(sequence, return_tensors="pt")