Update README.md
Browse files
README.md
CHANGED
|
@@ -17,8 +17,10 @@ model_name = "ChatterjeeLab/FusOn-pLM"
|
|
| 17 |
tokenizer = AutoTokenizer.from_pretrained(model_name)
|
| 18 |
model = AutoModel.from_pretrained(model_name)
|
| 19 |
|
| 20 |
-
# Example fusion oncoprotein sequence
|
| 21 |
-
|
|
|
|
|
|
|
| 22 |
|
| 23 |
# Tokenize the input sequence
|
| 24 |
inputs = tokenizer(sequence, return_tensors="pt")
|
|
|
|
| 17 |
tokenizer = AutoTokenizer.from_pretrained(model_name)
|
| 18 |
model = AutoModel.from_pretrained(model_name)
|
| 19 |
|
| 20 |
+
# Example fusion oncoprotein sequence: ETV6::CDK2AP1
|
| 21 |
+
# Amino acids 1-52 are derived from the head protein, ETV6
|
| 22 |
+
# Amino acids 53-73 are derived from the tail protein, CDK2AP1
|
| 23 |
+
sequence = "MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRIIHARGLVRECLAETERNARS"
|
| 24 |
|
| 25 |
# Tokenize the input sequence
|
| 26 |
inputs = tokenizer(sequence, return_tensors="pt")
|