| | import numpy as np |
| | import torch |
| | import torch.nn as nn |
| | import torch.nn.functional as F |
| | from torch.utils.data import Dataset, DataLoader |
| | from sklearn.model_selection import train_test_split |
| | from sklearn.metrics import accuracy_score, f1_score |
| | from scipy.stats import spearmanr |
| | from collections import defaultdict |
| | import pandas as pd |
| | import logging |
| | import os |
| | import torch.optim as optim |
| | from datetime import datetime |
| | from transformers import AutoModel, AutoConfig, AutoTokenizer |
| | class UnpooledBindingPredictor(nn.Module): |
| | def __init__(self, |
| | esm_model_name="facebook/esm2_t33_650M_UR50D", |
| | hidden_dim=512, |
| | kernel_sizes=[3, 5, 7], |
| | n_heads=8, |
| | n_layers=3, |
| | dropout=0.1, |
| | freeze_esm=True): |
| | super().__init__() |
| | |
| | |
| | self.tight_threshold = 7.5 |
| | self.weak_threshold = 6.0 |
| | |
| | |
| | self.esm_model = AutoModel.from_pretrained(esm_model_name) |
| | self.config = AutoConfig.from_pretrained(esm_model_name) |
| | |
| | |
| | if freeze_esm: |
| | for param in self.esm_model.parameters(): |
| | param.requires_grad = False |
| | |
| | |
| | esm_dim = self.config.hidden_size |
| | |
| | |
| | output_channels_per_kernel = 64 |
| | |
| | |
| | self.protein_conv_layers = nn.ModuleList([ |
| | nn.Conv1d( |
| | in_channels=esm_dim, |
| | out_channels=output_channels_per_kernel, |
| | kernel_size=k, |
| | padding='same' |
| | ) for k in kernel_sizes |
| | ]) |
| | |
| | self.binder_conv_layers = nn.ModuleList([ |
| | nn.Conv1d( |
| | in_channels=esm_dim, |
| | out_channels=output_channels_per_kernel, |
| | kernel_size=k, |
| | padding='same' |
| | ) for k in kernel_sizes |
| | ]) |
| | |
| | |
| | total_features_per_seq = output_channels_per_kernel * len(kernel_sizes) * 2 |
| | |
| | |
| | self.protein_projection = nn.Linear(total_features_per_seq, hidden_dim) |
| | self.binder_projection = nn.Linear(total_features_per_seq, hidden_dim) |
| | |
| | self.protein_norm = nn.LayerNorm(hidden_dim) |
| | self.binder_norm = nn.LayerNorm(hidden_dim) |
| | |
| | |
| | self.cross_attention_layers = nn.ModuleList([ |
| | nn.ModuleDict({ |
| | 'attention': nn.MultiheadAttention(hidden_dim, n_heads, dropout=dropout), |
| | 'norm1': nn.LayerNorm(hidden_dim), |
| | 'ffn': nn.Sequential( |
| | nn.Linear(hidden_dim, hidden_dim * 4), |
| | nn.ReLU(), |
| | nn.Dropout(dropout), |
| | nn.Linear(hidden_dim * 4, hidden_dim) |
| | ), |
| | 'norm2': nn.LayerNorm(hidden_dim) |
| | }) for _ in range(n_layers) |
| | ]) |
| | |
| | |
| | self.shared_head = nn.Sequential( |
| | nn.Linear(hidden_dim * 2, hidden_dim), |
| | nn.ReLU(), |
| | nn.Dropout(dropout), |
| | ) |
| | |
| | |
| | self.regression_head = nn.Linear(hidden_dim, 1) |
| | |
| | |
| | self.classification_head = nn.Linear(hidden_dim, 3) |
| | |
| | def get_binding_class(self, affinity): |
| | """Convert affinity values to class indices |
| | 0: tight binding (>= 7.5) |
| | 1: medium binding (6.0-7.5) |
| | 2: weak binding (< 6.0) |
| | """ |
| | if isinstance(affinity, torch.Tensor): |
| | tight_mask = affinity >= self.tight_threshold |
| | weak_mask = affinity < self.weak_threshold |
| | medium_mask = ~(tight_mask | weak_mask) |
| | |
| | classes = torch.zeros_like(affinity, dtype=torch.long) |
| | classes[medium_mask] = 1 |
| | classes[weak_mask] = 2 |
| | return classes |
| | else: |
| | if affinity >= self.tight_threshold: |
| | return 0 |
| | elif affinity < self.weak_threshold: |
| | return 2 |
| | else: |
| | return 1 |
| | |
| | def compute_embeddings(self, input_ids, attention_mask=None): |
| | """Compute ESM embeddings on the fly""" |
| | esm_outputs = self.esm_model( |
| | input_ids=input_ids, |
| | attention_mask=attention_mask, |
| | return_dict=True |
| | ) |
| | |
| | |
| | return esm_outputs.last_hidden_state |
| | |
| | def process_sequence(self, unpooled_emb, conv_layers, attention_mask=None): |
| | """Process a sequence through CNN layers and pooling""" |
| | |
| | x = unpooled_emb.transpose(1, 2) |
| | |
| | |
| | conv_outputs = [] |
| | for conv in conv_layers: |
| | conv_out = F.relu(conv(x)) |
| | conv_outputs.append(conv_out) |
| | |
| | |
| | conv_output = torch.cat(conv_outputs, dim=1) |
| | |
| | |
| | |
| | if attention_mask is not None: |
| | |
| | |
| | expanded_mask = attention_mask.unsqueeze(1).expand(-1, conv_output.size(1), -1) |
| | |
| | |
| | masked_output = conv_output.clone() |
| | masked_output = masked_output.masked_fill(expanded_mask == 0, float('-inf')) |
| | |
| | |
| | max_pooled = torch.max(masked_output, dim=2)[0] |
| | |
| | |
| | sum_pooled = torch.sum(conv_output * expanded_mask, dim=2) |
| | valid_positions = torch.sum(expanded_mask, dim=2) |
| | valid_positions = torch.clamp(valid_positions, min=1.0) |
| | avg_pooled = sum_pooled / valid_positions |
| | else: |
| | |
| | max_pooled = torch.max(conv_output, dim=2)[0] |
| | avg_pooled = torch.mean(conv_output, dim=2) |
| | |
| | |
| | pooled = torch.cat([max_pooled, avg_pooled], dim=1) |
| | |
| | return pooled |
| | |
| | def forward(self, protein_input_ids, binder_input_ids, protein_mask=None, binder_mask=None): |
| | |
| | protein_unpooled = self.compute_embeddings(protein_input_ids, protein_mask) |
| | binder_unpooled = self.compute_embeddings(binder_input_ids, binder_mask) |
| | |
| | |
| | protein_features = self.process_sequence(protein_unpooled, self.protein_conv_layers, protein_mask) |
| | binder_features = self.process_sequence(binder_unpooled, self.binder_conv_layers, binder_mask) |
| | |
| | |
| | protein = self.protein_norm(self.protein_projection(protein_features)) |
| | binder = self.binder_norm(self.binder_projection(binder_features)) |
| | |
| | |
| | protein = protein.unsqueeze(0) |
| | binder = binder.unsqueeze(0) |
| | |
| | |
| | for layer in self.cross_attention_layers: |
| | |
| | attended_protein = layer['attention']( |
| | protein, binder, binder |
| | )[0] |
| | protein = layer['norm1'](protein + attended_protein) |
| | protein = layer['norm2'](protein + layer['ffn'](protein)) |
| | |
| | |
| | attended_binder = layer['attention']( |
| | binder, protein, protein |
| | )[0] |
| | binder = layer['norm1'](binder + attended_binder) |
| | binder = layer['norm2'](binder + layer['ffn'](binder)) |
| | |
| | |
| | protein_pool = protein.squeeze(0) |
| | binder_pool = binder.squeeze(0) |
| | |
| | |
| | combined = torch.cat([protein_pool, binder_pool], dim=-1) |
| | |
| | |
| | shared_features = self.shared_head(combined) |
| | |
| | regression_output = self.regression_head(shared_features) |
| | classification_logits = self.classification_head(shared_features) |
| | |
| | return regression_output, classification_logits |
| |
|
| | def load_model(checkpoint_path, device): |
| | """Load trained model from checkpoint.""" |
| | checkpoint = torch.load(checkpoint_path, map_location=device) |
| | |
| |
|
| | |
| | model = UnpooledBindingPredictor( |
| | esm_model_name="facebook/esm2_t33_650M_UR50D", |
| | hidden_dim=384, |
| | kernel_sizes=[3, 5, 7], |
| | n_heads=8, |
| | n_layers=4, |
| | dropout=0.14561457009902096, |
| | freeze_esm=True |
| | ).to(device) |
| | |
| | |
| | model.load_state_dict(checkpoint['model_state_dict']) |
| | model.eval() |
| | |
| | return model |
| |
|
| |
|
| | def prepare_inputs(protein_sequence, binder_sequence, tokenizer, max_length=1024, device='cuda'): |
| | """Tokenize protein and binder sequences.""" |
| | protein_tokens = tokenizer( |
| | protein_sequence, |
| | return_tensors="pt", |
| | padding="max_length", |
| | max_length=max_length, |
| | truncation=True |
| | ) |
| | |
| | binder_tokens = tokenizer( |
| | binder_sequence, |
| | return_tensors="pt", |
| | padding="max_length", |
| | max_length=max_length, |
| | truncation=True |
| | ) |
| | |
| | return { |
| | 'protein_input_ids': protein_tokens['input_ids'].to(device), |
| | 'protein_attention_mask': protein_tokens['attention_mask'].to(device), |
| | 'binder_input_ids': binder_tokens['input_ids'].to(device), |
| | 'binder_attention_mask': binder_tokens['attention_mask'].to(device) |
| | } |
| |
|
| | |
| | def predict_binding(model, protein_sequence, binder_sequence, device='cuda'): |
| | """Predict binding affinity between protein and binder sequences.""" |
| | tokenizer = AutoTokenizer.from_pretrained("facebook/esm2_t33_650M_UR50D") |
| | inputs = prepare_inputs(protein_sequence, binder_sequence, tokenizer, device=device) |
| | |
| | with torch.no_grad(): |
| | regression_output, classification_logits = model( |
| | inputs['protein_input_ids'], |
| | inputs['binder_input_ids'], |
| | inputs['protein_attention_mask'], |
| | inputs['binder_attention_mask'] |
| | ) |
| | |
| | |
| | predicted_affinity = regression_output.item() |
| | |
| | |
| | predicted_class_idx = torch.argmax(classification_logits, dim=1).item() |
| | class_names = ['Tight binding', 'Medium binding', 'Weak binding'] |
| | predicted_class = class_names[predicted_class_idx] |
| | |
| | |
| | class_probs = F.softmax(classification_logits, dim=1).cpu().numpy()[0] |
| | |
| | return { |
| | 'predicted_affinity': predicted_affinity, |
| | 'binding_class': predicted_class, |
| | 'class_probabilities': {name: prob for name, prob in zip(class_names, class_probs)}, |
| | 'tight_threshold': model.tight_threshold, |
| | 'weak_threshold': model.weak_threshold |
| | } |
| |
|
| | |
| | if __name__ == "__main__": |
| | |
| | device = torch.device('cuda' if torch.cuda.is_available() else 'cpu') |
| | |
| | |
| | model = load_model('../classifier_ckpt/binding_affinity_unpooled.pt', device) |
| | |
| | protein_sequence = "GSHMIEPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAV" |
| | binder_sequence = "VVKVDSV" |
| |
|
| | result = predict_binding(model, protein_sequence, binder, device) |
| | print(f"Affinity Score: {result['predicted_affinity']}") |
| |
|