Update README.md

README.md

@@ -8,6 +8,27 @@ license: apache-2.0
 [Github](https://github.com/Lyu6PosHao/ProLLaMA) for more information
 
 ProLLaMA is based on Llama-2-7b, so please follow the license of Llama2.
+
+# Input Format:
+The instructions which you input to the model should follow the following format:
+```text
+[Generate by superfamily] Superfamily=<xxx>
+or
+[Determine superfamily] Seq=<yyy>
+```
+Here are some examples of the input:
+```text
+[Generate by superfamily] Superfamily=<Ankyrin repeat-containing domain superfamily>
+```
+```
+#You can also specify the first few amino acids of the protein sequence:
+[Generate by superfamily] Superfamily=<Ankyrin repeat-containing domain superfamily> Seq=<MKRVL
+```
+```
+[Determine superfamily] Seq=<MAPGGMPREFPSFVRTLPEADLGYPALRGWVLQGERGCVLYWEAVTEVALPEHCHAECWGVVVDGRMELMVDGYTRVYTRGDLYVVPPQARHRARVFPGFRGVEHLSDPDLLPVRKR>
+```
+**See [this](https://github.com/Lyu6PosHao/ProLLaMA/blob/main/superfamilies.txt) on all the optional superfamilies.**
+
 # Quick usage:
 ```bash
 # you can replace the model_path with your local path
@@ -109,22 +130,12 @@ if __name__ == '__main__':
             print("All the outputs have been saved in",args.output_file)
 ```
 
-# Input Format:
-The instructions which you input to the model should follow the following format:
-```text
-[Generate by superfamily] Superfamily=<xxx>
-or
-[Determine superfamily] Seq=<yyy>
-```
-Here are some examples of the input:
-```text
-[Generate by superfamily] Superfamily=<Ankyrin repeat-containing domain superfamily>
-```
-```
-#You can also specify the first few amino acids of the protein sequence:
-[Generate by superfamily] Superfamily=<Ankyrin repeat-containing domain superfamily> Seq=<MKRVL
-```
-```
-[Determine superfamily] Seq=<MAPGGMPREFPSFVRTLPEADLGYPALRGWVLQGERGCVLYWEAVTEVALPEHCHAECWGVVVDGRMELMVDGYTRVYTRGDLYVVPPQARHRARVFPGFRGVEHLSDPDLLPVRKR>
+# Citation:
 ```
-**See [this](https://github.com/Lyu6PosHao/ProLLaMA/blob/main/superfamilies.txt) on all the optional superfamilies.**
+@article{lv2024prollama,
+  title={ProLLaMA: A Protein Large Language Model for Multi-Task Protein Language Processing},
+  author={Lv, Liuzhenghao and Lin, Zongying and Li, Hao and Liu, Yuyang and Cui, Jiaxi and Chen, Calvin Yu-Chian and Yuan, Li and Tian, Yonghong},
+  journal={arXiv preprint arXiv:2402.16445},
+  year={2024}
+}
+```