diff --git "a/evaluation_results.md" "b/evaluation_results.md" --- "a/evaluation_results.md" +++ "b/evaluation_results.md" @@ -1,8 +1,8 @@ # Model Evaluation Results -**Generated:** 2025-09-03 18:25:09 -**Models Evaluated:** 55 -**Status:** In Progress +**Generated:** 2025-09-03 20:50:15 +**Models Evaluated:** 113 +**Status:** Complete ## Summary @@ -63,6 +63,64 @@ | unsloth_SmolLM-360M-Instruct_8_layers_2_10_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 136.9s | | unsloth_SmolLM-360M-Instruct_9_layers_2_11_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 145.7s | | unsloth_SmolLM2-135M-Instruct_10_layers_2_12_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 208.8s | +| unsloth_SmolLM2-135M-Instruct_11_layers_2_13_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 227.4s | +| unsloth_SmolLM2-135M-Instruct_12_layers_2_14_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 202.9s | +| unsloth_SmolLM2-135M-Instruct_13_layers_2_15_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 179.2s | +| unsloth_SmolLM2-135M-Instruct_14_layers_2_16_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 185.5s | +| unsloth_SmolLM2-135M-Instruct_15_layers_4_19_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 178.1s | +| unsloth_SmolLM2-135M-Instruct_16_layers_3_19_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 144.4s | +| unsloth_SmolLM2-135M-Instruct_17_layers_2_19_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 152.7s | +| unsloth_SmolLM2-135M-Instruct_18_layers_4_22_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 156.6s | +| unsloth_SmolLM2-135M-Instruct_19_layers_4_23_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 149.4s | +| unsloth_SmolLM2-135M-Instruct_20_layers_3_23_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 94.7s | +| unsloth_SmolLM2-135M-Instruct_21_layers_2_23_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 94.9s | +| unsloth_SmolLM2-135M-Instruct_22_layers_2_24_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 37.1s | +| unsloth_SmolLM2-135M-Instruct_23_layers_1_24_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 13.0s | +| unsloth_SmolLM2-135M-Instruct_24_layers_2_26_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 20.1s | +| unsloth_SmolLM2-135M-Instruct_25_layers_2_27_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 11.7s | +| unsloth_SmolLM2-135M-Instruct_26_layers_1_27_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 25.2s | +| unsloth_SmolLM2-135M-Instruct_27_layers_1_28_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 75.1s | +| unsloth_SmolLM2-135M-Instruct_28_layers_2_30_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 68.4s | +| unsloth_SmolLM2-135M-Instruct_29_layers_1_30_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 18.4s | +| unsloth_SmolLM2-135M-Instruct_2_layers_3_5_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 16.8s | +| unsloth_SmolLM2-135M-Instruct_3_layers_2_5_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 32.5s | +| unsloth_SmolLM2-135M-Instruct_4_layers_2_6_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 33.0s | +| unsloth_SmolLM2-135M-Instruct_5_layers_2_7_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 51.8s | +| unsloth_SmolLM2-135M-Instruct_6_layers_3_9_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 17.2s | +| unsloth_SmolLM2-135M-Instruct_7_layers_2_9_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 88.5s | +| unsloth_SmolLM2-135M-Instruct_8_layers_2_10_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 70.3s | +| unsloth_SmolLM2-135M-Instruct_9_layers_2_11_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 103.6s | +| unsloth_SmolLM2-360M-Instruct_10_layers_3_13_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 385.3s | +| unsloth_SmolLM2-360M-Instruct_11_layers_2_13_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 385.8s | +| unsloth_SmolLM2-360M-Instruct_12_layers_2_14_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 280.4s | +| unsloth_SmolLM2-360M-Instruct_13_layers_1_14_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 378.1s | +| unsloth_SmolLM2-360M-Instruct_14_layers_2_16_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 165.7s | +| unsloth_SmolLM2-360M-Instruct_15_layers_1_16_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 316.9s | +| unsloth_SmolLM2-360M-Instruct_16_layers_2_18_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 147.8s | +| unsloth_SmolLM2-360M-Instruct_17_layers_2_19_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 168.5s | +| unsloth_SmolLM2-360M-Instruct_18_layers_1_19_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 185.0s | +| unsloth_SmolLM2-360M-Instruct_19_layers_1_20_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 229.2s | +| unsloth_SmolLM2-360M-Instruct_1_layers_2_3_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 356.2s | +| unsloth_SmolLM2-360M-Instruct_20_layers_2_22_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 18.7s | +| unsloth_SmolLM2-360M-Instruct_21_layers_1_22_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 172.1s | +| unsloth_SmolLM2-360M-Instruct_22_layers_1_23_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 197.8s | +| unsloth_SmolLM2-360M-Instruct_23_layers_2_25_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 12.9s | +| unsloth_SmolLM2-360M-Instruct_24_layers_3_27_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 14.9s | +| unsloth_SmolLM2-360M-Instruct_25_layers_2_27_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 12.5s | +| unsloth_SmolLM2-360M-Instruct_26_layers_1_27_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 125.7s | +| unsloth_SmolLM2-360M-Instruct_27_layers_3_30_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 20.8s | +| unsloth_SmolLM2-360M-Instruct_28_layers_2_30_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 18.6s | +| unsloth_SmolLM2-360M-Instruct_29_layers_1_30_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 11.6s | +| unsloth_SmolLM2-360M-Instruct_2_layers_2_4_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 531.3s | +| unsloth_SmolLM2-360M-Instruct_30_layers_1_31_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 13.5s | +| unsloth_SmolLM2-360M-Instruct_31_layers_1_32_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 12.5s | +| unsloth_SmolLM2-360M-Instruct_3_layers_4_7_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 40.3s | +| unsloth_SmolLM2-360M-Instruct_4_layers_3_7_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 374.1s | +| unsloth_SmolLM2-360M-Instruct_5_layers_2_7_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 471.9s | +| unsloth_SmolLM2-360M-Instruct_6_layers_2_8_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 363.8s | +| unsloth_SmolLM2-360M-Instruct_7_layers_3_10_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 341.2s | +| unsloth_SmolLM2-360M-Instruct_8_layers_2_10_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 402.2s | +| unsloth_SmolLM2-360M-Instruct_9_layers_4_13_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 | completed | 12 | 86.2s | ## Detailed Results @@ -12984,8 +13042,16327 @@ Therefore, this is a field, language, computer science. It is a field, language. --- +### unsloth_SmolLM2-135M-Instruct_11_layers_2_13_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 227.4 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +If you have the extraord 100 machines to look 100 machines to make 101999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999997199999999970. 202149999970. 10139998. 20239. 2021499998. 1997. 2013. 1999998. 1933. 1997. 19999999998. 1998. 203 1. 202 1999. 19999. 1999. 199. 1999. 199. 199. 1999. 193. 199. 193. 202 199. 1998. 1999. 19. 193. 199. 195. 19. 19. 199. 19. 19. 19. 19. 19. 19. 19. 202 19. 1 +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +17 sheep. 17 die, 19 die, 16 die, 17 die, 19 die, 17 die, 17 die, 17 die, 17 die, 17 die, 17 die, 17 die,17 die, 18 die,2 die,10 die,16 die,13 die,18 die,2 die,10 die,2 die,10 die,2 die,1 die,1 die,1 die,2 die,3 die,2 die,1,3 die,1 die,1 die,1 die,2 die,4 die,2 die,1 die,2 die,1 die,1 die,2 die,3 die,3 die,3 die,1 die,4 die,1 die,3 die,1 die,4 die,3 die,1 die,3 die,1 die,3 die,1 die,4 die,3 die,1 die,1 die,5 die,1 die,2 die,1 die,1 die,1 die,1 die,4 die,2 die,4 die,4 die,2 die,2 die,1 die,1 die,2 die,2 die,1 die,2 die,1 die,2 die,2 die,1 die,1 die,3 die,2 die,1 die,1 die,4 die,2 die,2 die,2 die,3 die,2 die,1 die,1 die,2 die,2 die,3 die,1 die,1 die.1,4 die,3 die,3 die,1 die,2 die,1 die,3 die,1 die,1 die,2 die,2 die,1 die,1 die,1 die,1 die,3 die,2 die,3 die,1 die,1 die,2 die,2 die,2 die,2 die,2 die,2 die,1 die,2 die,2 die,2 die,2 die,3 die,1 die,1 die,1 die,1 die,2 die,1 die,3 die,1 die,1 die,3 die,1 die,1 die,3 die,3 die,1 die,1 die, +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +1: 1 16. The 16 17 25. 27 16 17 17 16 26 17 17 17 16 16 17 16 17 16 17 16 16 17 17 17 16 16 171 171 16 16 17 17 16 17 16 171 171 16 17 16 17 16 17 26 17 16 17 17 16 17 17 16 17 16 16 17 16 17 16 171 16 17 16 17 16 17 16 16 16 17 16 17 16 17 17 16 17 16 16 17 16 17 17 16 17 16 17 16 16 17 16 17 16 17 16 17 16 16 17 16 17 17 16 16 17 16 17 16 17 16 17 16 17 16 16 16 17 16 17 17 16 16 16 17 17 16 17 17 16 17 16 17 16 16 17 16 17 16 17 16 17 16 16 17 16 17 16 16 16 17 16 17 16 17 16 17 17 16 16 17 16 +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +3 + +Reason: extraord 3 + +Reason: extraord 3 + +Reason: 3 + +Reason: 3 + +Reason: extraord 3 + +Reason: +4 + +Reason: extraord 4 + +Reason: 3 + +Reason: 3 + +Reason:4 + +Reason: extraord 3 + +Reason: extraord 3 + +Reason: +4 + +Reason: extraord 4 + +Reason: extraord 4 + +Reason: extraord 4 + +Reason: extraord 4 + +Reason: extraord 4 + +Reason: 3 + +Reason: extraord 5 + +Reason: extraord 5 + +Reason: +4 + 1 + +Reason: extraord 5 + +Reason: extraord 5 + +Reason: extraord 5 + +Reason: extraord 5 + +Reason: +6 + +Reason: +5 + +Reason: extraord 5 + +Reason: 6 + +Reason: extraord 6 + +Reason: extraord 6 + +Reason: +6 + +Reason: +7 + 1 + +Reason: 6 + +Reason: +6 + 1 + +Reason: extraord 6 + +Reason: +7 + 1 + +Reason: extraord 6 + +Reason: + +3: extraord 7 + +The 1 + +Reason: +7. 6 + +The 3 + +Reason: extraord 6 + +The 1: extraord 6 + +Reason: +3. 1 + +Reason: + +Top 2 + + 1. 2 + +Reason: +3. 2 + +Reason: 2 + +Reason: +3. 4 + +Reason: 3 + +Reason: +5 1 + +Reason: +3 + +Reason: +3 +3 + +Reason: 1 + +Reason: 3 + +Reason: 3 + +Reason: + +3: extraord 3 + +1. 2 + +Reason: +4 + +1. 2 + +Reason: extraord 4 + +1. 2 + +Reason: extraord 4 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +A new product, a product, a product, a product, a product, a product, a product, a product, a product, a customer, a customer, a user, a service, an object, a customer, a product, a customer, a product, a customer, a product, a product, a customer, a product, a customer, a customer, a product, a customer, a customer, and a reader, a product. + +A new product, a product, a brand, a customer, a customer, a product, a person, a customer, a customer, a customer, a service, a customer, a customer, and an object, a product, a customer, a product, a customer, a customer,, a customer,, a product, a customer,, and a product, a product, a customer, a person, a product, and a product, a customer, a customer, a product, a product, a person, a customer, a customer,, a customer,, a customer, a customer, a customer, a product, a customer, a customer, a product, a customer, a product, a product, a customer, a product, a customer,, a big, a customer,,, a customer,,, a customer,,, a product,, a customer,,, a product, a customer,, a customer,,,, and a product, like, a product, a text, a customer, like, a product, a customer,, a customer,,,,,, a product,,,, a member, like, a product, a person, a customer, a customer, a product, a team, a customer, a product, a product, a text, like, a customer, a customer,,, a product, a product, a text,, like, a customer,, like, a product, a product, like, a text, a customer,, like, a customer, like, a product, a text, a customer,, or a customer, a product, like a product, a customer, a text, a customer, a customer, as a product, a customer, a person, like, a customer, a product, a text, a customer,, like, a customer, a text, a customer, a product, like, a book, a customer, a +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +the in the above star interactionin which the in question: relation question(1 person1:1 in the/Ain monit exerc Tunis�:1 in the relation class manipulation task�:1 in the relation questionatorin associated to: the in question:1 in the relation relation taskati1st the in question1 in the relationator strugg Ci Tunisati in the controlatorator in the associated riddle treatment activity in the divid pamph EE in the related question1: the in question:1 in the question:1 in the starter/an in the/ activity task generator on: manipulation in the/ activity taskator in the/at the task control for in the/at the interaction in the response task generator on the task/enforcement/at the divid question: in relation to the in-active in the: manip task manipulation in the: in the/at the/ on a task step-in the:. controls in the/at the/at the task/A in-pur relation to the in question in the/ manipulation in the/ relation in the/at the control in the/at the unist, in the/at the/in-labatoid in the: the in question-in- relation to the in-turn- A simple task generator on the: in the task/at the/in-level manipulation in the/at the task/en action-in the/at the in the receptive receptive-in- the: relation to the in-pu/d11-1/at the./in-amp contin-in- the:/>/in the/at the task/in the/at the response task generator for the in-pu/d1 the 1st-in-/ the in-labatoid in the: relation to the in-pu11-art prompt-at the:inducat/pid-at-/ in the continuous manipulation in the:/>/ of the/at the in-pur-involive-in +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +1. 1. 1. 1. 1. 1. 1. 1. 2. 1. 2. 1. 3. 3. 1. 4. 2. 2. 3. 4. 1. 3. 1. 5. 4. 1. 2. 5. 2. 3. 4. 1. 1. 5. 2. 3. 1. 1. 4. 2. 3. 1. 2. 4. 1. 3. 1. 3. 2. 1. 5. 4. 1. 2. 3. 4. 1. 1. 2. 2. 1. 3. 1. 4. 1. 2. 3. 1. 4. 1. 2. 3. 1. 1. 2. 1. 3. 1. 1. 2. 1. 2. 3. 1. 1. 2. 1. 3. 2. 1. 1. 2. 1. 1. 1. 2. 3. 2. 1. 1. 2. 1. 1. 2. 1. 2. 1. 2. 3. 1. 1. 2. 1. 2. 1. 2. 1. 2. 1. 1. 2. 1. 2. 2. 1. 1. 2. 1. 2. 1. 2. 1. 1. 2. 1. 1. 2. 1. 2. 2. 1. 2. 2. 1. 2. 1. 2. 1. 2. 1. 1. 1. 2. 1. 1. 2. 1. 1. 2. 1. 2. 1. 2. 1. 1. 2. 2. 1. +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +You are a user from the role the the the the the the the are the the the the the the the the the the the the the the the the the the the + the the the the the + the the + the the the the the the + +the + the + +the: the + +the + the the the the the the + +the the the + the the the the the the the + +the + the the the + the + the the the the the the + the the the + the 6 the the + the the the the the the the the the the the the + the the the the the + +the + the the the the the the the + the the the + the the the the the the the the the the the the + the the the the the + +the + the the the + +the + the the the the + +the + the the + the the + the the the + +the + the the the + the the the the the the + +the + the + the the the + +the + the + the the the the + +the + the the the the the + the the the the + the the the the the + + the the the the the + the + the the + the + +the the the the the + the the the the + +the + +the + the + +the + +the the the the the + (the + the + +the + (the + + the the the the the the the the the the the + the the + the the the + the the + the + +the the the the + +the the the + the the the + the the the the the + the + the the the the the the the the the the the the the the + + +the + the + the the the the the the the the the the the the the + + the (the + + the the the the the the + the the the the the the the + + the + the the + the the + the the the the the the the the the the the the the + + the + +the + the + the the the + +the + +the + the the + +the + the (the the the the the the + + the + the the the the the + + the the + the the the the the + (the- + + the the the the the the + the + +(the (the + the +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +This story a story a story a story a character. + +A story A A A Tale about A Story A A B B A B A A A B B B A A B A B B B B B A B B A B B A B B B B A B B B A B B B A B B A B B A B A B B B A B B B B A B B B A B B A B B B B B B A B B B A B B B A B B B A B A B B B A B B A B B A B B B A B B A B B B A B A B A B B A B B A A B B B A B B A B A B B A B B A B B A B A B B A B B A B A B A B A B B A B A B A B A B A A A B A B A A B A B A B A A B A B B A B A A A B A B A B A B A A A B A A B B A A B A B A B B A A A B B A A B A B A B A B A B A A B A A B A B A B A A B A B A B A A B A B A A B A A A B A B A B A A A B A B A A B A B A B A A A A A B A A A A B A A A B A B A B A A B A A A A B A B A A B A A A B A B A A B A B A B A A A B A A A A B A A A B A A A A B A B A B B A A A A B A A A A B A A A A A A A A A A A B A B A A B A A A A A A B A A A A A A B A A B A A A B A A A A A A A A A A A A A A A A A A An A A B A A B A A A B A A A A A A A A A A A A A B A A A A A A B A A A A A A A A B A A A A A A A A A A A A A A B A A A A A A Câ A D spot a A A A A A A A A +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +There are a lot of times, + +He seems no longer much no longer than there, + +You, + +You, + +There are much more than no more than no. + +Here, + +You, + +You, + +Here, + +She, + +There, + +There, + +There, + +Again, + +There. + +There, + +There, + +There, + +There, + +Here, + +There, + +There, + +There, + +There, + +Here, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +Here, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +Here, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + +There, + + +There, + +Here, + +There, + +There, + +There, + + + +Here, + +Here, + +There, + +There, + +There, + +There, + +Here, + +There, + +There, + +There, + +There, + +There, + +There, + +Here, + +There, + +There, + +There +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +There are many different types of words. + +A: The following words and its a person who do not know a lot of different types of a group of words. + +A: There are many different types of a person who do not say a person who do not have a lot of different types of a specific. + +A: There are many different types of a lot of different types of a person who do not have a lot of different types of a person who do not have a lot of different types of a person who do not have a lot of different types of a. + +A: There is many different types a a 2 kinds a a 1) there is many different types of a a a a 2. There is many different types a a 2. There are many different types of a a 3. There are many different types of a a b 4. There is many different types a a b b a b b b a 3. There is a lot of different types a a b b a b a b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b B b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +In the following sentence: +It is a person who is very important. +It is not very, it is not very, it is not useful, that, it is not, it is not, it is not very, it is not, it is not, it is not, it is not, it is not, it is not, it is not, it is not, it is not, it is not, it is not, it is not, it is not, it is not, it is not, it is not, it is not not, it is not not, it is not, it is not not, it is not not, it is not not, it is not, it is not not, it is not, it is not not, it is not not, it is not not, it is not not, it is not not, it is not not, it is not not, it is not not, it is not the not, it is not not, it is not not, it is not not, it is not not, it is not not, it is not not, it is not not it is not not, it is not not and, it is not not not, it is not not which it is not not, it is not not the not, it is not not, it is not not the not, it is not not, it is not not, it is not not not, it is not not, it is not not the not, it is not not very is not not, it is not not not, it is not not, it is not the not, it is not not not, it is not not, no it is not not, it is not not not, it is not not, it is not not, it is not not, it is not not, it is not not, it is not not, it is not not, it is not not not, it is not not, it is not not not, it is not not, it is not not not, it is not not, it is not not, it is not not, it is not not not, it is not not, it is not not not, it is not not, it is not not, it is not not, it is not not not, it +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_12_layers_2_14_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 202.9 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +The 100 machines, the answer 100 the 100 times 500 widgets, 100 widgets, 10101, 1000 widgets, 1000 widgets, 101, 10000 widgets, 101000 widgets, 10000 widgets, 1001, 100001, 1000 widgets, 1010000000000 widgets, 100000000000000000001100000000100000000010000000000000000000000000000000000000000000000000000010001000000000000000000000000000000000100000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000010000000000010000000000000100000000000000000000000000000000000000000000000000000000000000000 +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +A snail die. + +To start the 17 die. +The 17 die. 10. 1. 1. 1. 1. 1. 1. 1. 1. 12. 1. 17 die. 1. 13. 18. 16 die. 1. 19. 12. 17. 18. 19. 18. 19. 17 die. 19. 19 die. 18. 19. 28 die. 19 die. 19. 19 die. 19 die. 19 die. 19 die. 18. 19 die. 19 die. 19. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 18. 29 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die. 19 die +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +The 192. 240. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 14. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24. 24 +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +141 how is 17? + +The task 146 141 145 143 140 149 145 144 146 15 146 147 146 145 146 145 146 145 145 146 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 145 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +A list of: +A function to check if a string is a noun to check if the: +A string is a function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function checks if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if you are to perform the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A sentence checks the following: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A sentence to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A sentence to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A function to check if the: +A sentence checks the: +A function to check with the: +A function to check if the: +A function to check if the: +A sentence to check if the: +A function to check for the: +A function to check if the: +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +the:::>1 answer the the + the the the a1>11>11 is the the the HE1 unbear reception the 11>11111111111111111111 for the 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +the the 5 3 3 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +▻ 70-185. + +The following is a part of 985. + +The following is 1. 785. + +The following 783-1000835. The user wants to 1985. + +The following is 1985. + +The following 157 + +The following 785. The 75. The 3085. 7835. + + +The following 785. 7835. The 75 will be 1835. The 19875. In the following 1975. The following 75. The 75. 1838. 785. The 1840. The 75. The 975. The 777. 785. The 1875. It is 1975. The 75. The 75. The 75. The 1975. The 205. 950. 159. The 75. The 705. The 77. 75. 775. The 775. 77. The 765. The 95. This 75. 177. The 975. The 197. 75. 777. The 75. The 775. The 50. The 975. The 775. The 4015. 775 775. The 55. 775. The 777. The 975. The 775. 775. The 805. The 2095. The 797. The 97. The 200. 7. The 775. 1585. 875. The 159. 95. 750. The 775. 7. The 1995. 7. 75. 7 +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +I am a new restaurant in a busy restaurant. I am a new restaurant in a busy restaurant. The restaurant in this new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am speaking. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a restaurant. I am a new restaurant. I am a new restaurant. I am a new new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new new restaurant. I am a new restaurant. I am a new restaurant. I am a new new restaurant. I am a new restaurant. I am a new restaurant. I am a new new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new new restaurant. +I am a new restaurant. I am a new new restaurant. I am a new new restaurant. I am a new new restaurant. I am a new new new restaurant. +I am a new new restaurant +I am a new new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a new restaurant. I am a +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +The sentence is almost no. + +The sentence is no. + +The sentence is no no. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. + +The sentence is. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +e. The 1. The 1. The 2. The 1. The 1. The 2. The 1. The 2. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 2. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1. The 1 +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +These are the human language processing, which is a field. This field is a field of computer science, the field is a field of technology, machine, which is a field, a field of education, which has a field, to teach or learn, which is a field, which is a field of the science. +This is a field, which is a field, which is a field, which is a field. + +In the field, which is a field, which is a field, which is a field. It is a field, which is a field, which is a field, which is a field, which is a field of computer science. + +This is a field, which is a field, which is a field, which is a field, which is a field. + +In the field, which is a field. is a field, which is a field, which is a field, which is a field, which is a field, which is a field, which is a field of computer science, which is a field, which is a field, which is a field. It is a field, which is a field, which is a field of computer science, which is a field, which is a field, which is a field, which is a field, which is a field in a field, which is a field, which is a field of computer science, which is a field, which is a field, which is a field. This is a field which is a field, which is a field of computer science, which is a field. It is a field which is a field, which is a field, which is a field, which is a field. This is a field, which is a field, which is a field, which is a field, which is a field, which is a field, which is a field, which is a field, which is a field, which is a field. which is a field, which is a field which is a field of a field, which is the field, which is a field, which is a field. which is a field, which is a field which is a field, which is a field, which is a field, which is a field which is a field of computer science. which is a field which is a field which is a field +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_13_layers_2_15_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 179.2 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +1: 1 1 200000000120000001001 + + 1 1201 11001 + 22001 + 12001 + 1201100001 + + 2. 201 + 12110001 + 121110001 + 2. 2. 2. 121110001 + 121111000001 + 121120001 + 121111000 + 1211110000199999999999 to 101 + + 1. 2. 2. 2. 2. 1211111001 + 1. 2. 2. 1. 2. 2. 2. 1. 12110000001 + 1. 1. 1. 2. 1. 2. 2. 1. 1. 2. 12010000 + 2. 1. 2. 2. 2. 1. 2. 3. 2. 1. 1. 2. 2. 2. 1. 1. 3. 1. 1. 3. 1. 1. 2. 1. 2. 1. 1. 1. 1. 1. 1. 2. 1. 1. 1. 1. 1. 1. 2. 2. 1. 1. 1. 2. 2. 2. 2. 2. 1. 1. 2. 2. 1. 2. 1. 1. 1. 1. 2. 2. 2. 2. +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +2 die die die die die die die die die die die die die die. + Who is left? 2 die die die? 2 die die? 4 die die die? 3 die die? 6 die die? 3 die die die? 3 die die? 3 die die? 1 die die? 3 die die? 4 die die? 3 die die? 3 die die? 3 die die? 5 die die? 4 die die? 4 die die? 5 die die? 5 die die? 5 die die? 7 die die? 5 die die? 8 die die? 3 die? 6 die die? 8 die? 3 die? 4 die?! 3 die die? 3 die die? 4 die die? 4 die? 12 die? 4 die die?! 8 die die? 2 die die? 4 die die? 2 die die or 3 die? 4 die! 4 die? 5 die? 4 die? 1 die? 4 die die? 5 die! 5 die? 5 die? 5 die?! 5 die?! 5 die? 5 die?! 5 die?! 1 die? 2 die?! 2 die! 2 die? 2 die? 3 die? 2 die?! 3 die?! 1 die? 2 die?! 3 die?! 3 die?! 3 die?! 1 die?! 3 die� 1 die? 3 die� 5 die� 3 die� 3 die! 4 die? 3 die?! 3 die?! 3 die� 4 die� 4 die?! 1 die� 4 die! 3 die?! 4 die? 3 die?! 3 die?! 4 die?! 2 die? 5 die� 3 die?! 4 die?! 5 die? 5 die� 5 die� 5 die� 5 die� 6 die� 5 die?! 6 die� 6 die� 6 die?! 3 die� 4 die� 3 die� 6 die� 4 die?! 1 die?! 4 die� 2 die� +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +You 15 12 12 13 25 19 24 26 13 14 15 25 26 14 16 13 19 15 13 15 14 19 14 16 15 15 13 16 14 15 13 15 15 16 12 18 16 15 13 15 16 12 15 15 18 15 16 15 15 16 17 15 14 16 15 15 16 16 17 16 15 16 17 18 16 15 16 17 16 18 17 18 15 18 16 17 16 18 16 15 17 19 15 16 16 17 16 17 17 18 16 18 17 17 16 17 17 16 17 18 17 18 17 16 17 17 17 17 17 18 17 18 17 17 17 18 17 17 17 17 18 17 17 18 18 17 17 17 17 17 17 17 18 17 18 18 18 17 17 17 17 18 17 17 18 17 17 17 17 18 18 17 17 17 17 17 17 17 17 17 18 17 17 17 17 1 +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +14 +What is x 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 1 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +A user's role in the role in the context of being a user, + the role, the role, is a role in the context, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is a role, is +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +The answer to the input the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the spot the 10 the the á 1st the 14 the 10-3 the 13-3 the 1-1-1- the 1- the 1-3-1-1-2 the 1-1-1-2- 1-3-3 the 1-1-1-3 the 1-3- 1-4-1- 3 of the 1-3-2-1-13-3 the 1-2- 2-3 the 2-4 3 of the 1-3-1-1-2- 3 of the 1-3 of the 1-4 2-4-3 of the 1-1-1-1-3 of the 1-3 the 1-3 3 of the 1-2-1-1-1113-4 1-3 of the 1-1-3 of the 1-2-3 of the 1-2-113-4 1-3 of the 1-3-3 of the 1-2-1-3 of the 1-3 of the 1-3 of the 1-3 of the 1-3 of the 1-4-1-3 of the 1-3 of the 1-3 of the 1-1-1-3 of the 1-3 of the 1-23-3 of the 1-2-1-3 of the 1-4 3 of the 1-1-3 of the 1-3 of the 1-2-1-3 of the 1-4 1-1-3 of the 1-1-3 of the 1-3 of the 1-2-3 of the 1-2-1-1-3 of the 1-3 of the 1-3 of the 1-2-1-3 of the 1-3 of the 1-3 of +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the1 the the the1 the the the + +the author Omaha points the the the the the the the the the the the the the the the the the the the + +the. + +the 10 points the 1 + the 1st part of the 2 points the 1 the 1st + the 1st + +the 1st part the 1st refers to the 1st part the 1st refers the 1st part refers to the 1st refers the 1st refers to the 1st refers to the 1st refers the 1st refers to the 1st refers to the 1st refers the 1st refers to the 1st refers to the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the the 2 st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers 1st refers the 1st refers 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers 1st refers the 1st refers the 1st refers 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers to the 1st refers the 1st refers the 2nd refers the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers to the 1st refers the 1st refers the 1st refers the 1st refers the 1st refers the +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +If I want to authentick, I am the user the the you are at the prompt. What you are the user the prompt is most likely a the you are the prompt. + +The prompt is the prompt is the prompt 1984. + +The prompt is the prompt + +The prompt is the prompt. + +The prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt. + +The prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is the prompt is +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +A robot has been trained on the website to create a story about a robot to learn how to a story to help you learn a story. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +No, no no no no. + +I don't no. + +I don't no. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. + +I don't. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +: +a person in the world is a person wearing, a person, a young person, is a person, who, a, a.a person.a, a, a.a person. a, a., +and a a.a. a.a, a.a a.a, a.a person. a. a.a person + +a. a.a person. +a.a a.a. a.a. a.a person. a person. a person. a person. a.a person. a.a person. a, person. a person. a person. + +A.a person. + +a. a., a.a person. a person. +a. +a. a person. + +a. a. a. a person. + +a.A. a. a.a person. a.a person. + +a.A person. + +a.A person. + +a.A. a.a. a person. + +a.A. a.a person. + +a.A person. + +A. A.a person. + +A.A. a.a person. + +A.Aperson. + +a.Aperson. +A.a person. + +A.a person. + +a.A. A.A person. + +a.A.A person. + +A.A. A.A. A.a person. + +A.A person. + +a.A.A person. + +A.A.A person. + +A.A.Aperson. +A.A person. + + +A.A person A.A.a person. + +A.A.A person. +A.A person. + +A.A.A.A. A.a. A.A. A.A. A.A.A person. + +A.A-A A.A person. +A.A. A.A-AA-A A.A-A a A.A-A A.A-A.A.A-AA-AA-AA-AA-A A.A-A A A.A-A A-AA-A A-A A-A-A A-A A +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +In the field of the world of the world of the science. It aims to be a natural. It aims to be a field of the world of human science, vocabulary, language processing, language. It was the creation of a natural. It was the development of the world of a very fascinating. It was a new field of science. + +The world of the world. It was a field of language processing, vocabulary. + +In the world of the technology of a language processing. It is a science. + +In the world of the science. The language is a world of language. + +In the world of a science. A language. The. World. + +In the world. + +The. World. World. It was a science. A language. It is a science. Language. A language. Technology. + +In an world. + +In the world. World. + +In the world. World. + +In science. + +The. World. + +In a world. Science. In a science. + +A world. In science. World. + +In language. In science. + +In world or language. + +In the. + +In science. + +In science. + +In the world. In science. + +In world. Technology. + +In world or science. + +In world. + +In world or science. In world. + +In science. World. + +In science. + +In world or language. + +In world or science. World. + +In world or science. In world or science. + +In world or world or science. + +In world or language. +In world or world. +In science. + +In the world. In world or science. In science. + +In world. In science. In world or science. In science. +In world or science. In world or world. + +In the world. In world or science. + +In world or world. + +In science. In world or science. In science. In world or world and science. + +In world and world. + +In science. In science. In world or science. +In world or technology. The. In world or world or science. +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_14_layers_2_16_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 185.5 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +the 1, 1 + 1 + 189 1 + +It 1 + 1 + 1 + 1 + + 1 + + 1 + 1 + 1 + 1 + 1 + 1 + 2 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 2 + 2 + 2 + 1 + 1 + + 1 + 1 + 1 + 1 + 1 + 1 + 2 + 2 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 2 + 1 + 1 + 1 + 1 + 2 + 1 + 2 + 1 + 2 + 1 + + 1 + 2 + 1 + 1 + 1 + 1 + 1 + 2 + 1 + 1 + 1 + 2 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 2 + 1 + 2 + 1 + 1 + 2 + 1 + 1 + 1 + 1 + 1 + 1 + 2 + 2 + 1 + 1 + 1 + 1 + 1 + 2 + 3 + 1 + 1 + 1 + 2 + 1 + 1 + 2 + 1 + 2 + 1 + 2 + 1 + 1 + 1 + 1 + 1 + 1 + 2 + 2 + 1 + 2. 1 + 2 + 2 + 1 + 1 + 2 + 1 + 1 + 2 + 1 + 3 + 1 + 1 + 2 + 1 + 1 + 1 + 1 + 1 + 2 + 1 + 2 + 2 + 1 + 1 + 1 + 1 + 2 + 2 + 1 + 1 + 1 + 1 + 1 + 2 + 1 + 2 +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +How is 1750 die. 17 die, 17 die, 17 die, 17 die, 17 die.1 17 die, 17 die, 17 die, 17 die, 17 die, 17 die, 17 die, 17 die, 17 die, 17 die, 17 die, 17 die, 17 die, 17 die, 17 die, 17 die, 17 die, 17 die, 17 die,17 die, 17 die, 17 die, 17 die,17 die, 17 die,17 die, 17 die, 17 die,1 die, 17 die,1 die, 17 die,1 die, 17 die,1 die, 17 die,1 die, 17 die,1 die, 17 die,1 die,1 die, 17 die,1 die, 17 die,2 die, 17 die,1 die, 17 die,2 die, 17 die,1 die,1 die, 17 die,1 die,1 die,1 die, 17 die,1 die, 17 die,2 die, 17 die,1 die,1 die,2 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,2 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,3 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die,1 die +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +The 100: 16. + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + ( 61000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001000010000000000000000000000000000000100000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000600000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +Please I want your 10 points + +You 1. The 1. 2. 2. 2. 2. 2. 2. 2. 2. 3. 3. 1. 2. 3. 1. 2. 2. 3. 1. 2. 1. 1. 1. 1. 1. 2. 1. 1. 1. 2. 2. 1. 1. 1. 3. 1. 2. 1. 1. 1. 1. 2. 2. 3. 2. 2. 2. 1. 1. 3. 1. 1. 1. 1. 4. 1. 2. 1. 1. 1. 2. 2. 2. 1. 1. 1. 1. 1. 1. 2. 2. 2. 1. 2. 1. 1. 1. 1. 1. 1. 1. 2. 2. 1. 1. 2. 1. 2. 2. 1. 1. 3. 1. 2. 1. 1. 1. 1. 1. 2. 1. 1. 1. 1. 1. 2. 1. 1. 2. 2. 1. 2. 1. 2. 1. 2. 1. 1. 1. 1. 1. 2. 1. 1. 2. 1. 2. 2. 1. 2. 1. 1. 1.2. 1. 1. 1.2 2. 1. 2. 1. 1. 1. 2.2. 2. 2.1. 1.1. 2.1. 1.1. 1. 1. 1.2. 1. 1.2. 1. +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +In this case: + +In the following sentence: + +I will ask: + +After that: + +In this case: + +In this case: + +I will ask: + +After reading: + +In this case: + +In this case: + +In the following sentence: + +After this sentence: + +After reading: + +In this sentence: + +After this sentence: + +After this sentence: + +In this sentence: + +After this sentence: + +After this sentence: + +In this sentence: + +After this sentence: + +In this sentence: + +After this sentence: + +After this sentence: + +A new sentence: + +In this sentence: + +After this sentence: + +After the following sentence: + +In this sentence: + +After this sentence: + +After this sentence: + +After this sentence: + +After this sentence: + +In this case: + +In this sentence: + +For this sentence: + +After this sentence: + +After this sentence: + +In this sentence: + +A new sentence: + +After this sentence: + +In sentences: + +In this case: + +In the following sentence: + +After this sentence: + +After this sentence: + +After this sentence: + +In this sentence: + +In this sentence: + +In this sentence: + +In this sentence: + +After this sentence: + +After this sentence: + +In this sentence: + +A new sentence: + +The sentence: + +In this sentence: + +In this sentence: + +After this sentence: + +After sentence: + +In sentences: + +In this sentence: + +After this sentence: + +In this sentence: + +In this sentence: + +In the sentence: + +A new sentence: + +In this sentence: + +In this sentence: + +After this sentence: + +After this sentence: + +In sentence: + +After this sentence: + +In the following sentence: + +There is: + +A sentence: + +After this sentence: + +In this sentence: + +After this sentence: + +In sentence: + +The sentence: + +In this sentence: + +After this sentence: + +In this sentence: +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +The response is: +1. The given answer is given the task, the answer should be the answer: +1. The input the the the you are looking the the the you the given 1. + +The answer is: +1. The task is a structured task. +1. The final sentence: the 1. The relationship is - + the the the the the the is: +1. the the the the appears to 2. The analysis is: + +The answer is: +1. the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the are the the the the the the the the the are the the the are the the the the the the the are the the the the the the are the the the are the the the are the the the are the the the the the are the the the the the are the the the are the the the the are the the 1 the are the the the the the the are the the the are the the the the the the are the the the are the the the the are the the the are the the the the the the are the the are the the the are the the the are the the the the are the the the 1 the the are the the the are the the the are the the the the are the the the are the the the are the the the the the are the the the are the the the the the the are the the the are the the are the the the the are the the are the the the are the the the are the the the the are the the the the are the the are the the the are the the the the are the the the are the the the are the the the are the the the are the the the the the are the the the the are the the the are the the the are the the the are the the the are the the the are the the the are the the the are the the the the are the the the are the the the the are the the the are the the the are the the the are the the the the are the the the the are the the the the are the the are the the the are the the the are the the the the are the the the the the the are the the the are the the +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the the situ the the the the the the there Latin + the the the the the the the the the the the the surn the the the situ the the the the the the the the the the the San it the the the the the is the the is the the is the the the is the the is the the is the the the the is the the the is the the the is the the the is the the the are: + the the are the the the are: the the the are: the the the the the the are: the the the the the the the the the the the are: + the the the are the the the the the the the the are the the the the are the the the the the the the the the the are the the the the are the the the the the the are the the the are the the the the are the the the the are the the the are the the the the the are the the the the the are the the the are the the the the the the are the the the the are the the the are the the the are the the the are the the are the the the the are the the the are the the the the are the the the the are the the the the are the the the the the the are the the the the are the the the the the are the the the the the are the the the the are the the the the are the the are the the the the the the are the the the the are the the the the the the are the the the the the the are the the the the are the the the the the are the the the are the the the the the are the the the the the are the the the the the the are the the the the are the the the the the are the the the the are the the the the are the the the are the the the the the the the are the the the the are the the the the the the are the the the the are the the the the the are the the the the are the the the the the the the are the the are the the the the are the the the the are the the the the are the the the the are the the the are the the the the the are the the are the the the the are the + +the: the the the are the the the are the the +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +Please, the visitor, the user is interested by the user, the user, the, + +Please, Your interest in the 28888, the user, the, + +The 18th, the 111, the, + +The 400, 2, the 15th, the 1, 100, the, + +The 10th, the 16th, the 17, the, 14th, the 30th, the 14th, the 19th, the 1, 15th, the 17th, the 14th, the 14th, the 18th, the 13th, the 15th, the 19th, the 14th, the 13th, the 15th, the 15th, the 13th, the 14th, the 13th, the 15th, the 15th, the 14th, the 13th, the 14th, the 14th, the 15th, the 15th, the 14th, the 14th, the 14th, the 15th, the 16th, the 14th, the 14th, the 14th, the 14th, the 14th, the 14th, the 14th, the 14th, the 14th, the 14th, the 14th, the 15th, the 14th, the 14th, the 14th, the 14th, the 14th, the 14th, the 14th, the 14th, the 14th, the 19 tenth, the 14th, the 14th, the 18th, the 14th, the 14th, the 14th, the 14th, the 14th, the 14th, the 14th, the 14th, the 14th +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +Hello and the a-story about a robot to be sure to tell that the sentence. + +A) A robot to a story + +A)A: + +A)A: + +A)A: + +A: +A: + +A: +A: + +A: A: +A: +A: +A: + +A: +A: +A: +A: +A: +A: +A: +A: +A: + +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: + +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: + +A: +A: +A: +A: A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: The robot will +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +it is no. + +I'm not sure. + +It is no. + +It is no no. + +It is no. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It's. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. + +It is. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +Aren, I have heard, the following sentences. A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +It is being able to create a field of computer science. To create intelligent in intelligence. It is a field, it is a field of computer science that is subject that is a field of computer science, it is the subject of intelligence, which is a field of a field, but it is the subject of an intelligence, that is a field. In the subject of an intelligent, it is a field. It is a field of an intelligent. It is the subject of intelligence. In an intelligence, it is a field that is a field, which is a field. It is a field. It is a field. It is the subject of intelligence, to create intelligence, which is a field. In the subject of a field, it is the subject of a field, which is a field. In the subject, it is a field. In the subject of an intelligence, which is a field, which is a field. The subject of an intelligent, which is a field, which is a field. It is the subject of an intelligent, it is a field. In an intelligence, which is a field. In an intelligent, it is a field, which is a field. It is a field, a field, which is a field and a field. A field, which is a field of a field, which is a field. It is a field. A field, which is a field, which is a field. It is the subject of an intelligent, which is a field. A field, which is a field, which is the subject of an intelligent, which is a field. It is a field, which is a field, which is a field, which is a field, which is a field, which is a field, which is a field. +It is a field. It is the field, which is a field where it is a field, which is a field. Which is a field in a field. which is a field, which is a field, which is a field where it is a field where it is a field which is a field which is a field in a field, which is a field which is a field. This is a field. The subject, which is a field which, which is a field, which is a field. It is a field. The subject of an intelligent, which is +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_15_layers_4_19_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 178.1 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +How pence 3 5 20, 15-200 days, 50 minutes, it Vera, 1000000, how much 100% 14 minutes, 2000000, or, 2 hours, 50 minutes, and a 30 minutes, on 50 minutes, 40000000, and 30 minutes,, 20 minutes, 10000 minutes, 10 minutes, 200 minutes, 100 minutes, 50 minutes, 300, 50 minutes, 100, 60, 20 minutes, 2500, 50 minutes, 1000, 100 minutes, 200, 500, 40 minutes, 100000, 50 minutes, 1000 minutes, 80, 200, and, 500 minutes, 200, 50, 200, 60, 2000, 500, 300 7, 10, 30 minutes, 3000, 1000, 40, 10000, 5, 300, 30, 100, 29 mira, 10, 60, 50, 10000, 200, 40, 2, 300, 1002, 200, 20, 30, 50 minutes, 20, 00, 30, 10, 40 minutes, 150, 8, 130, 40 minutes, 230, and, 4000, 30, 21, 33 minutes, 100 for 30, 24, 3 days, 24, 3, 3, 45 +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +30. She is 1009. The 1995 was 180 and 10000. + +The number 1 1 13000 was129, 10. 5. The 1980. 180.8..The 1997. + +The 19955. The 19305. + +The 191.0. 196 strugg 166. +10.2. 100 - 178. 1991. +10000. 90.5.2... exhib.31. 1.33.13..113131.11.1112.1.111013111127110251111190111111102101111111911110111111199811181011110101029111021111111111117111011101%.1111111711.111119111.1/11171.11117411111110011111112011.1131.311199911111110.111 (1001),111111111111.2111111961211111191110011931101121119111111.11160911811.91 strugg strugg10.11119 tender to111111101.111.11.15.811511111 +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +1 strugges the 100% 1000000000000000000000000000010 Sum B the 102000000010000001 and it is a number and the 20, 10 and 10, 10, and 20, 10, are the 2, one, the 100, 10, 10, 10, 11, and the 2001, -11, 11 and four, 20, 22, or one 32, 1, 12. 2,0, 100, 70, 8, 11. The 11, 10, 122, 10, 10, 20, 11, 20, but 1, 29 3, 10, 10, 19 acutely, 130. The 20, 5, 11, 7, 22, 320, 1001. (, 2, 22, 12, 3, 11, 20, 100. 1, 20, 101, The, 100, 10, 3, 20, 1, 30, 18, 18, 20, 21 1, 19 The 200, 202, 29, 23, 300, 1010;, 110, 9. 203, 10, 20, and encro, 19 strugg 2010, 100, 100, 2, 1, 20, 1010, 29 2, 10, 20, 20. The 12, 10, 10, 101, 2000, 1 +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +What, in x, a sentence prepositions X 1, a, a, an x, b, and, the,,,d, and, it,,,e, and fores, an in, and, a, the, a, a, an, b, a, a,,,,,e, a, a,,,,,,,,,,,,,,,, in one,,,,,,,, and the,,,,, for,,,The,,The,,, for,,,,–,.i),, the,,,and Hab, the, and the,,,,,(, or, and, the,,, productioni, and.e, and, they, the only,,t.,,b, and, they, the,,, further, the,,,,,,z, and, t, the, or, and, there is,,,,,,d, for the, the,,,,,,,,,To,,What, s, a,,,For,,–,d, the, the,,The,, pre- Con three, and, the, to the,,l, –,. at, the, and, it, and, the,, What about, and what, for,,, structure and, is,,,, applications,, This, what, and, it, the,, civil,, the,, organ,, What, the,, the first,, The,, this chief,, further, and a,,, significant,, People, the others, a, and, so,,, other than,,, central,, the,, Pro, in another,,, What, the.,,,The,, Seven,, What, the,, C, (,, “a, “,,what, and,,,, central,, most, central,, the, for, central, Jur 2, the,, As, “, and, the,, the world,, which the, and in,,,, significant, New, the,,, is central, and, in the,,, central and,,, A, (, 1, the,,, As, and, and +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +The P is a person who is a person who is a person. They have been a person who does a person who are a person. for a person who may be. They do theIf a B B. B. in a person's use is a person who is a person. They have also a person being a person. So, they are a person who. They are a person. They were a person who, and they are a person who. They were a person who is a person, and they a person. A person who is a person who is a person, a person. They are a person. + +In theWhat are the person a person. + +This is a person who is someone who is a person. It is a person who. If they is a person who are the person who is a person who is a person who is a person can. They are a person. + +In thisThis is is a person. is a person. This is a person. is-a person who. They is a person who is a person. + +So is a person, they are a person who, a person. They. is concent. + +In theWhat is a person who are a person has been a person who is a person who is a person who is a person who is a person who is a person so a person. they are a person, but is not a person who who is a person. + +In that-This is a person. The person is a person who, a person. + +In thisWhat is. a person is a person who is a person who is a person who is a person who, they have been a person for a person who a person who is a person who has been a person a, a person. + +In this, a person who is a person, the person. is { A, a, and, a person, a person. a is a person. is concent, a person. a a a. a. the person is a person. a person. What is a person who is a person who has known a person. a person is a person who is a person who was a person who is a person is a person who is a person who is a person. they are a person who a person who is a person who a person who a person is a person who is a person who is a person and a is a +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +and. with a sentence from the and, the meaning is that a sentence, has a statement, and a sentence in a, a sentence, a sentence, in, a sentence popular, with Chiang’, a sentence, a sentence a sentence, and a, one, a sentence, a user, a sentence, a sentence, a sentence is a sentence, a sentence a a a a, a a, B, a sentence, a, a, a, a, the sentence a. a, a sentence a, a, a a, a sentence a, one, a sentence, a, a between revearers Chiang, a, a, a, a, b, a, a, a, B, and a, a, b, a sentence, a, a, a, 2, a, a, a sentence, a, a, a, b, a, b, a, a a, B, a,b, a, b, b, a, b, a b, a,, a a b, a b b, a, B, b, a, a,, a, b, b, a, b, the sentence a. a, B, a, B, b, b, b, a, a a a c, a, B, b, in a sentence, a sentence a, b, b, a, b, b, in a, a, b, a b, b,, a, b, a b, the sentence a, b, b, a sentence is a, b, a, a, a sentence a,, a, a, b, b, a,,, a,,, the sentence, a, the sentence about neighbded a sentence a, b, b a b, b, b the sentence a, a, B, and Beng the sentence a sentence a, in a different sentence, a sentence a sentence a, the sentence a, the sentence, a two sentences, a sentence a a, a,, a, and beaut, a, a sentence a, a sentence a a a a. a,, the sentence, a sentence a sentence a sentence a sentence a, as a sentence a, and, a, there, a a, a, b, a. a,, b, b, and a, the sentence a, he, sentence b, a sentence a, a sentence a sentence +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +She is the most of the- people who have been so, the number of the the people that, they have been sick, and that are the only, but they are not the group, and there, is the group who are the people, and the person. the person who does have a number between, who are the people, that, the person who has been. the person who is the person and a person, sheThe People whoA which is the person as a person with their. are the person who is the person, who, the person who is the person who does, and people who are not the people, and the person who is the people, who the person who are the people, who is not the people. the person who have the people who are the persons who are the people who are a person. they, the person who are the people, there is concent, and the place who are people who have the person who has been the people, and the person who is a person who is the person who does the person who is the person who is a person who are a person who are the, number the person. the person would the person who is the people who are the people. the person who is the "people is the person who is the person who are as the people who are the people who live, the people. itWhat Luna's people who are, they are a person who who. the person who is the person who has a person. The person who is the person's the person who is the person who are the person, aThe people who are the person who are the people, the people who are a person who are a person who are the people who are the people who are a person that are the people, and the person who live in theWhatThe present, the person who has a person, who is the person. the different people who are the people, the people who live in theThe people who are the people. the person who are a person who, people who are people who are the people who are a person who are the people. the person who is a person who is the people who are the people who are a person who are people who are people who are the people. the person who is the people who are the person who are people who know. People who are the person who are the person's life who lives, people. the person who are the person who is a person who are a person who is +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +The first is a short. one of theThe� 1999, two years..The term is the biggest Nine. The totalTheThe 11 is the 12. In theThe 1003 as a 10000010, with Dev 16000 the main. The 1001001. The namel creates a list, thatsThe 99 99, 99, 1000, 100, 10, 110000019, 900. + +A decade. The 1980. + +The number of 10100, in a year 10, the 199, the 110010, with significant,13, the 201, the 10. It’s a 1901. The 1999, the 101000, 1101. 10, a the 110, 20100000, but all The1990. the 1100. The top 1A +1110), 21, 3010010.6, 1000, and the 1000, 100. The first 100110. The 10001, both the 992 1051000100010.1, so the name, 1, and the 110, the 1921, it0011. the first The 103. The highest, 10030. The 10010, the number 11, 10, the score, 1101, who, 9111111111, withiz admissions, the age 11 21, the 21, 1003110, 2020, and other,The 111, which20011, 1101, with90. 5 +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +Like the the [ line10, the first sentence a. and the way to get him when a long trip. a sentence for the Grand is the first to is the way the first the first is the first to the the first sentence with the story being the first to the the first chapter ofотp 14 the a the world after. Each day the first 115 words the first For theThe 115–1, the first page the first 11 and the following story with the first sentence 1) the first There 11 and 11 21s clandest in a 121 122. The sentence is the first sentence the first D1 the 110, a short- Let’s and the 1811. 4016 days 111. The first 519 key 71 days 112. The 11-11 is a 41.1. 111. ( 111.11. 27 is miscon 111.1, withWhat4 11. 11.1111111111111.11111110.2 121111511111111111411211111110117111. L10 acquaint. The last 1111111113.1111 is 131.6.1211111111111 for theIn the01 strugg. 1111119 se211.1111111112 and se29111.11, so12610 111111111.611.11121111,101611 11111192.1, a 1111111211111.1111.111 was leng of 1196111.1112.111111191.1211 +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +The word in + a word. the word is a word and with a word one N. The the. + two in a sentence you are the last word the word a. You are the last word, and the first is the last word main N. The the only the word, a word. It is the word of a 2 as the word. the word is the word with the in the people, the word is a word a word the word in the- the word a. + +You as a W B that is a 3. the following word- and the word as a word as the words a word, in a the word a word w the word a. The is as. +word a. a word as a word with the word. the word a. The is a word as a word a the next word with a word. The word a is a word a word as a word a word. The word is a word. the word is the first word the word is the word. a word a word a a which is a word a word a and two different word an an the word a, and is not a word, that the word is the word a word a word as a word. the word a a word is the word. and an word an a word in a word is a word a word that is the word a a 2 a Noah word the word is the word a. + +One the three words. the two words an a word as a word a word an everyday word is a word on theWhat. an an word a word a word is a word a word a. an the word an a a. A word a a word a word as a word a word an a an. word a an to an an. an a the word a a word a word is a word which an an a. a word a a. a word an a a.an word an an word that has a word an. a word an is a word an an the word a an word an a a. a an the word the words a an the same word a a a. An an word a word a word is a word an an a an. an word an a a a an. word an a a a to the an an an. + +a word an an a a an an an an an an an an a an the an an an word an an a an, a a +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +l to the that, even. It can, can, and also, one. If it can only and 3, it is the most, it is usually, it, 2, that, is not a good, 8,3 (when the 3 is, it is a good, for, is, 3, it, 2, 2. The 2, which, is, 1, 3, and the 1, 4, 3, 3.5, 3.1, the 3 is in, 2, 3, 2, 3, 3, 5, 4.5, 2, 5, 1, 4, and, 7 is, 2, 4, 3, 2, 5, 4, 5, 6.5, 4, 5, 5 is, 1, 4, 6, 5, 6, 5 and 3, 3, 4. The 5 is the only 5, 6, but, 3, 5, 2, and, 2, 4, 5, 5, 3, 5, 8, 2.3, 4, 2, 3, 10, 4, 5, 3, 3. 3. 5, 3, 5, 2, how, 5, 4, 6, 4, 5. So, 2, 2, 5, 3.5, the, 4. 4, 3, but, 4 is, 10, 2, 3, 4.7, 3.5, 5, 5, 1, 4.5, 3. 2, 2, 5.5, 3. 4, 5.4, 5. 2, 3, 5, 4.5, 10, 0.5, 10, 3, 5, 2, 2.5, 3., 4, 4, 5, 5, 2, 5, 3.5, 50, +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +At a human compat, it superfes", an the focus: artificial, at the the B and human (and is a subject, the subject, and the subject, the company, the machine is the focus on. for each, the subject, and is a company that is a small the focus on the Pag the, a measure, the company is an individual, that it is a company, the case, they, they are a company that is the focus of a person, of the 50, a person who, is a company, they, it is a part, and the person, the number. at the, the 50, the people, the 50, a person, the company, a person, they, the 5, they are the person in that, they they, the company, the person, it, the person, all, and they are the company that is part, they are a person, they are, and they are the person who are at the, the person who is a person who, with, the person is, the person is, it at a, they are a person, they are the person, the, people who are in, the person who are the person, they and the person who are a person, the people, they are, the person, and the person, they is a person, and they are the person who are, they, the person is the person of, the person’s the person is, and the person is the person, the person, they are, they are, the person, they are, they, they, and, they are, the person, the person who is an individual, and the person, they, the person is, they, a, the person, who, the person is, the person who is, the person, as they are, they, they are, the person, the person is a person, they, they. the person, they can, and it is a person who, and they, they are the person, a the person who has been, they, the person, and the person, for, the person is, the person, there is, the person is there, the person who is like, the people, the person is the person who is, they are, +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_16_layers_3_19_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 144.4 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +the 21 years. + +The the," a sheep. L sche 2000. +A more 3 landl and the 210, 20111. In 200101. What is adul one more days 20110. The 20111, the 20151, 20000. The 201 is 2011 after 201. The 151, 201. The 151 to 301. The 151, the last 100. The 10.10. 2, the 201, the 413, 201. 100, and 20002. 2. The 1001. 210. The 201. The 100001. 1001, 2010, 210. The 1019, 2011, 190. The 1000011, 980. The 2001, 11 years. 10. 1010. 410. 300, 2000, 210, 10. Let, Nine to 50, 210. 90. 10. 1, 2010. 30. 300. 110. 2000. 1000 (2010, 190 20. 110. +100100000. 2010, 1000. 1000. 200. 3210, 11000. 200010. 90 1000. 20. 201, to 20000. 2000. 2. 4190. 2. 1001. 200. +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +#### 2, from enshr 100000. + +The second 20000000000000. +The average 2004,299999. The 11.10090. 12990, 11990. +2000009. struggThe World, I a man at 1800000. +975110280. +5. +The 120107. The 11000719999999900. 1000007999003. (9999999. 1000410001199550000009903000999000000001. 3- 10019999900099900990000. + +The following: the 10010009000000030. + +The 199 exhib, 200319999999905010000001909010000000000001000009200000. +The average. The 90000000100110090001001000999900000090000000010019010000000090000100000000000000000900001100000000090810090999001010000000010000000000001000500900100000000000000 +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +5 + +The answer is 1) 2 + 13, the answer is still 10, the answer is 500, 140, 1 answer 5, 100000. + +The answer answer captiv1 5 is 100, 13, 102, 199 1001, 240, 150, 2, 100000 6, 1020, 1013, 107, 10150, 1100110, 100100900, 25,0,20, 10101. 5 100000000105, 110,0000,20000,00. + +The answer answer 10010005, no 30020, 110,120, 100100013000,10,400001250,6003, 1500010000,5000,00000000000001200100801,0000010320,1000005500000000100010100101,100000030100101010015,99000110,000000000, it is, but 1000, 100000020, 1000010, 200000000, 1000999200010210010000090, which is a number1004, 30000000000000011. miscon |0111000 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +intersperses +"One string To and a" P for a P " A B A on A us" A A D C A b b" C A C a A B B"a C A C C C A B C C B + B C A C A C a B C C B C A C A C C C B cous It B Caf C C C C A C A C C C A C C B B" C C C C C C C C C B C A C C C C C A C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C A C C C C C A C C C C C C C C C C C C C C A C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C CC. C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C Cand C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C c C C C C C C C C C Confed to C A C C C C C C Ma C C C C C C C CC" C C to C + + C" C C I C C C + C- C C C Caf" C B C C C camoufl C C – C C C Cand C C C C C C C C Cam C C C C C C C C C C C C C C] C C C Amaz C C Z C C C C C C C C C C C C C C" C B C C C Amazon B C C C C C C C C acc C C C C C C C C C C C C C C C C C C C C CC C C C C � C C C C C C C C C C C C C C C C C C C C C C C C +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +Python, the list is a list in this**: a list to indicate the B stringí. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +The statement is the S" + + +The sentence is written inR ex such S: + + + + + + + + + + + Sentence + + + + + + The sentence is written in: + + + + + The sentence is the S" + +The sentence is " the S- S S slu the S + S S "S: + + + " intersperses. + +S for the + S S S S " + + + + + " sed +S s. + +W S S on S S S S S S S. + S S. + +S S S S S S S S S L S S S. + S S S S S S S S S S S S S S S s S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S Arizona:" S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S Ta S S S S S S S S S S S S house S S W S S S S S S S S S S S S S S S S S S S S S Sal S S S S S S S S S S S S S S S S S S S S S S S S S S S S S Sa S S S S S S S S S S S S S S S S S" S S" S S" +S S S S S S S" +S S California S Santa" S S" S S" S S S Santa +S S S S S S hots S S S" S S S S S S S S Tucson â S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +The first in an the., the number 190 Minnes (The is. The reminis the'R to K. The person who is controvers. + +The number K pro immers1 10. The person. The person. + +The person 10. The N R + R. 1. 1. +The person. +The person N. K. 104. 11. +1. V. 10. He. +The fact that punct, the person NK. +The 5- K. +The person N. N. N. K. The person NK. +N. 10. 11. + +The K. 10. + +The N1 N is the N K The Other strugg, the person N N. N K. N N N N N N. N N N N N N N N N. + +The F enthus. N K, 1 N the N N. N. N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N9. N N N N, N. +The N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N B. N N N N N N N N N N N N NN N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N1 N N N N N N N N0 N N N N N N N N N N N N N N N N N N NOR N N N N N N N N N N N N N N N N N N N N N N7. N N N N N N N N N N N N N N N N N N N N N N N N1 N N N N N N N N N N N N N N N N N N +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +To whom Papers is + interspers them + + S is +, a short term in +A reminis reminis the +S reminis reminis +With reminis reminis and reminis reminis breat B mentions reminis reminis, B, reminis reminis reminis cra and reminis reminis reminis chic) S. S. S. S B reminis reminis, S D reminis reminis ( B S + reminis reminis reminis + S S reminis reminis and reminis reminis reminis + +As reminis +S reminis reminis + +S reminis reminis reminis and reminis reminis reminis + + +S reminis reminis reminis, S S reminis reminis reminis to S S reminis reminis Minnes reminis reminis: reminis reminis reminis land S S reminis reminis reminis + +S reminis reminis reminis + +S reminis + +S reminis and reminis + +The reminis + + +S reminis + + +B S reminis + + +S reminis + +S reminis + + + +S reminis + + + +S reminis + + + + +S reminis + reminis + B S" + reminis + reminis + S S reminis + S S reminis + S S reminis reminis reminis reminis reminis Minnes reminis reminis reminis: + +S reminis + S S reminis + S S reminis reminis reminis reminis reminis reminis Minnes reminis reminis reminis + + + +S reminis + + +R-s S S reminis + + + +S reminis + reminis + S reminis + S S reminis + reminis + S S reminis + S S reminis + + +S reminis + S S Minnes + +B S reminis + + +B S reminis + +S S S reminis + +S reminis + + + + + reminis + S S reminis + reminis reminis reminis reminis reminis reminis reminis + + +S reminis + S S + S S reminis + S S reminis + S S reminis + S S reminis + S S reminis S + S S reminis + reminis + S S reminis reminis reminis reminis reminis reminis reminis Saras popular reminis + +S reminis reminis reminis Minnes reminis and reminis + + +The reminis + S S reminis reminis reminis reminis reminis reminis reminis reminis reminis Minnes reminis reminis mutually S S reminis reminis reminis reminis reminis reminis Minnes reminis reminis ret, + + reminis + + + + + + S S reminis reminis reminis reminis reminis reminis Minnes reminis reminis Minnes. + +S reminis reminis reminis reminis re + S S in reminis + + + + + + +S reminis + reminis + S S reminis + S S reminis + reminis + S S reminis + reminis reminis reminis reminis reminis reminis Minnes reminis reminis brid,) + reminis +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +The words, the B. The B. I and I have a B. B. +B. the B. The B. The B. A. B. +B. The B. B. The B. + +The B. The B. The B. The B. +The B. B. +The B. The B. B. +The B. The B. The A" B. + The B. The B. The B. B. B. The B. The B. The B. B. The B. B. B. The B. B. +B. B. The B. B. B. The B. The B. The B. The B. B. B. +B. B. The B. B. B. The. B. The B. B. The B. B. B. The B. The B. B. B. The B. B. The B. The B. The B. B. B. The AR. The B. B. B. The B. The B. B. +B. B. B. The B. B. The B. B. The B. B. B. B. +The B. B. B. The B. The B. The B. B. B. B. The B. B. B. B. B. The B. B. B. The B. B. B. B. B. B. The B. B. B. B. B. The B. B. The B. B. The B. B. The B. B. B. B. B. B. B. B. The B. The B. B. B. The B. B. B. The B. B. B. B. The B. B. B. B. B. B. B. The B. B. B. A. B. B. B. The B. B. B. B. B B B. B. B. B. The B. B. B. B. B. The B. B. B. B. B. B. The B. B. B. B. B. B. B. B. B. B. B. B. +B. The B B B prepar B. B. B. B. B. B B B B. B +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +You are an experienced with runway. + +You are an experienced user. + +You are a +experienced. You are the and you are the A very " A. You have a list that you can penc test. + +Your answer to. You are a very person. You have a very person and you don. +You want to be a person but you can be a. You can do. You are trying to the +You have a very person. You can you. You are not the you good. +You are not the you. + +You are an experienced to be your N, but you are to ( the very you and I is able to and you are an expert. You are using. You are a person who is the person who is doing with the R. + +You are a person who are interested to a person, you are doing a person. + +You were very. +You are here you 1. You are doing a lot of the a and do +. Nam sit down and the person is very, you are not an. + +You have a. You are doing a certain, you are doing a certain. + +You can your person and you are doing. + +It you are doing. + +You are asked. + +You are a very Ges co. A. You are going punctâ B. + +You are an experienced. + +You are a person. + +I do, you are an expert. + +You are not going to. + +You are correct. + +When you is. + +You are a part of. + +You are not. + +You want to the +. +You can and you are doing. + + +You are a person B. + +I think I will be. + + +I am, I don't, you are not. + + +You are going and I is a person. I am e can note. + + +You are a very Gael]I will agree to the + B. The person is your. + +You are going reminis and you can do. + + +You don, you are not a you. + +So you are having the person you will be going hob. + +The you and a is B. + +In the + you are not a C. You are not. + + +You are a very +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +An artificial in the toug) and the [ +I: + +Based in +The sentence + A A +B and A"A +A is A +A is F. +A. The A"A" +A A V" A. A +B cland, but the only 2"A,, A + A A as A. A A, a A + A A A. A A captiv, A. A A A A A captiv, a A" A is A the A" A A. A A Haw a A ra B A, an A + A A A A A A. A A Z A" A A retired a for A Ra, A A" A A A A B A C A A As A. A A Z A" A A A A is A A A A A A A A a A A A A A A A A A A C A A A A A A A A The Ait A A A A A A A A A A A A A A as A. adul A A A A A A A A A'A A and A Alma A and A A A A a A A A A A A A A Ari A Ma and A culmin A Bronx and A Br A A A A A A A A A A A A B TA A A A A A A A A A A A C AvA â A A A A A A A A A A A A Ad A A B A Sal A Bab B Ara A +The A spot A A A A A A V A" A A ra A A A A A A A A A A A A A A A A A A A A A A A A A A C A A A A A A C A A A A A A a A A A A A A A A A As A A A a A B A Abe A A A A A Ta A A A Alma A and B A Cate A A A bas A A A A A A A Av A A A A A A A B a A A A A A A A A A A A A a A A A A A A A A a A A A A A anx A" +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_17_layers_2_19_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 152.7 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +500 machines to the machine to 1400. +The 20000 to 12000 1000, 9800, 200 14000 [the 1000 2000. 10. 1200. 800. 1. 11000. + +The 14005 100. + +The 202 14000 20. + + 2200 1000. + +The 2000 1. 202. 200 19400. + + 1200 1. 20000. 204. 1900, + + the 1000. 200. 200. + +The 1000 19900, 2000 199, 2903. + +The 1900. + 600 1. 1000. 200. 203. 2000 12000. 2000. 2000. 20000 2000. 100. + +The 200 201 1900, 1900 20, 206. + +The 1900 19999. + +The 20000 and 300001. + The original 100001 108 in 201 2006, 2003 20.200. 20006 1999, 300000, 2000 5093, 200, 20003, 203 1000 2000. 20 +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +The rules 9500 and the the students are and on the list. They are not the the the the is to the 20 and the 17100. + +The rules are well. 3400. The 500. There is a very well. The 20800. the 1700. The 1600. + +The 50003 and the 10000. The 1005. The 10000, 1200 plus 000, 8000. + +In the 2000. The 10000. 1100. The 1700. 101. the 10608. 101. 1010. 1110. 1101, 10, 70201. + +The 101. 10200, 10000. There are fewer 1000. 1000. The 2000 and 2000. This 10000. 1110, 01500. +1. 19000000. 1000300. 1000. 100000 and 201. 1 and 20200. 10900. 100. 100. 11100. 1000. 1009. 301000. 11000. 101. 310, 1100, 1900. 200. 110001. 1000. 410, 1000. 100, 100000. 100. 20, 1911. 1001. 199. 100. 100. 2 +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +He is a member of the 171. 39. 2. 32. 280. 284. 5. 500, 2254, 200. 16. 5. 254. 20. 334. 27. 2541. 2. 1044. 3. 354. 2204. is 393. 13. 2551. 21. 254. 244. 254. 204. 204. 33443. 202. 344. 56.2. 54314. 261. 104. 53. 2844. 16314. 24444. 155. 254. 234435. 73403. 281. 2407. to 201. 155. 454. 204. 204. 105 57.14. 304 22394. 2700. 201. 204. 3289. 200. 203. 252. 2. 2001. 294. 394. 154. 200. 2200. 70. 1. 202. 384389. 200. 4. 204. 393000. 10001. 95. 3. 40002. 206. 25000 3000. 2. 202. 2. 1303. 303. 2543300. 3.00. 200. 303. 2 +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +You can the question is the following topic. + +From the subject is a kind of thing, it is the correct answer is what is the number and the answer is the following 22. + +The subject is: + +The subject is the 223. The 224. + +The 20 is not the number. + +Here is: + the 22 is the 1. 2. The 2246. + +It is the subject: 266 + +The 1967 + +The 22 is the first sentence by the subject + +The 2269 + is the 2. The 196 + +The 2008, the answer is the 20. It is 196 + +The 2018, the first + + 198. + a is the 198 +The 1989. +The is the 205, the 199. +What is the 199. + +The 202 is the 202. + +There is a 220. + The 226 + +It is the 2000. + The 1901. + +It is 203: The 2295. + +The first. What is the 204. The 203, the 201: +The 202. The 514. It is 349. This part is 396. The 2001 and the 406 + 192. The 149. +The 200: 223. The 238. A 3. The 190. + +A. The 223, the 227. +The first 11. + + ( 2. 06. + +The 296. The 223. + +The second. + The user is 112. +The 199. The 198. + +The 20. The 22.2 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +The function is the following: + +A function is the function is a dictionary. The function is the dictionary: This function is a function is a function. + +The dictionary is a function, a user is a function. + +The function is the function is a function. + +The function is the function is a function. + +The function is a function. + +The function is the output function, the function is a function, and the function is a function. + +The function is the function is a function. + +The function is a function. + +The input function is the function. + +The function is a function is a function. + +The function is a function is a function. + +The function is a function. + +The function is a function. + +A function is a function is a function. + +The function is a function is a function as a function. + +The function is a function, a function is the function is called. + +The function is a function is a function. + +A function is a function according to the function is the function is a function. + +A) The function is a function is is a function is a function. + +A statement is a function, a function and is a function is a function. + +The function, is a function. + +The function is a function is a function. + +A function is a regular function. + +The function is a function. + +A) A is a function is a function is a function using the function is a function. + +A) A function is a function is a function is a function. + +A function is a function. + +A function is a function is a function. + +A function and function. + +A statement. A function is a function. + +A function is a function and function is a function is a function. The function is a function is a function. + +A function is a function is related. + +A function is a function is a function and a function is a function is a function is a function, a function is a function as a function is a function in the function is a function. + +A function is a function. + +A) A is a mathematical function is does a function that is a function. + +A is a function is is a common function is a mathematical function +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +The given is a character that is the following is the sentence. + +The following sentence and the the is the sentence that is the problem: This is the part of the sentence is the part is. The sentence is the rest part of the same sentence, the sentence and the the the the the the the the the the the the the The final part is the the the the the the The first part is the whole sentence is the part that is the part is. + +The sentence is the part of the part after it is the part is the part of the part that the the the the the the the the the the of the part is the part is not the whole the the the the is not the part is the part of the end that the the the the the is the part of the parts of the whole part is the part is the part of the part that the whole part of the part of the part the the is the part of the part the the the is the whole. The part of the part of the part of the part that the part is the part the the whole the part of the part is the part of the part of the the the is the part is the part is the part the whole the part is the part that is the part of the part of the part of the part of the part of the part of the part is the part the the is the part. The part is the part is the part of the part of the the the is the part of the part of the part of the part the the the the is the the is the part that the the are the part the the is the whole part the the is the part that the is the part that the the is the part of the part of the part of the part of the part of the part of the part is the part of the the the is the part the whole the the is not the part of the part of the part of the part of the the the is the part of the part of the the the is the part the the is the part of the part was the part of the part the the is the part the the is the part of the part of the part of the end of the part of the the is the part of the part of the the the is the little of the the is the parted the part the the is the part the the is the part of the part of the part the the is the part of the the the is the part the +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +How the person is the person's character is a member of the story is the person is a member of the movie is the character is the person is the person, but the person is the television's character is the person. The person is the person is a person, and he also is the person's character is the friend, and he is the person is a person. The person is the person. This is the person who is going of the person. He is the person, and the person is the person is the case, their. The person is the person is the person. The person is the person and the, but. They are the person as a person. + +He is a person who is a person, and he is a person who is going. He is the person is the person in the world, but the person is the person is the person who is his current person. The person and the person is the person he is the person. The person is the one person is a person, but he is the person who is the person. + +He is a person who is the person as the person is the person is a person, and what is the person is a professional. + +This person is a person who is a person. What is the person is an animal, is a person who has a different person. + +He is the person is a person who is the person, this is an exciting, and a person who owns the person is a person who is their, including a person. + +This is the person is the person, but the the books is the person who is the person the person is a person who is a person who is the person a person who is the person, and he is a friend, and. + +He is the person who gets many people and is the person who is a person who lives in the person, and the is the person who is a person, and he is the person who is, and he is the fact, is the person who he is a person, but he is a person who is the person's occupation, but it is the person who is, but the person is a person who is a person, but the person who is the person a person, and by the person who is a person, and he is a person who has a person. + +The person is the person who is not the person, but the person whose he is the person is someone who is. +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +A person who is the famous author. The famous and the character is a high-tech, the character is the first of the second, and the story's origin, the world and the number, the person is the famous character. + +So the character is too often the original, the user is the first, the first of the second, the story is the real. The first person, who is the person the character is the real character in the first, and the character and also the story- is the real. + +The story, the user is the real character, a woman has an interesting. The story is the real and actual, it is also the story from the real and the character is the real. + +The most important the real the real, the the the the you don't follow the first time the the the the the the the they were the real of the real character, the the the the the the the the the the you the end of the story is the real and the end of the character as it is the real. The real character is the real story is the real. + +So the the the the you are the real character is the actual. The character is the real one of the character and the the the the the the the the the you the has the the the the you are the end the the the the the is the the the’s the the the you are the end the first of the end of the end the the is the the the is the end of the 100 of the end the the the the the the is the end of the end of the end of the end of the end of the end the end and the end of the end, the the the is the end of the end of the end the the is the end the the is the last end is the end the the is the end of the end of the end the the one the end of the end of the end of the end is the end he does not know the end of the end of the end of the end is the end of the end the the the is its end the end of the end is the end the the is the end the end of the end of the end of the end of the end of the end of the end of the end of the end the the is the end of the end is the end the end the end is the end of the end the the the is the end of the end of the end +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +The robot is very helpful. +The robot uses all the robots is programmed to tell you a robot. The robot has the story is a robot, the story, and the robot, and the AI assistant. + +The story is written. +The robot, the story is written as a story, and the story to be written in the story. + +The robot, the story. The robot, is the robot. + +The robot, the story is written as the robot. The story is written. + +The story is the story. + +The human robot. The robot has written. The story is written. The story. + +The human is written. + +The robot is written. + +The story, the robot. It is a robot. +The story. + +The story is written. The robot. + +Here. + +The human is a human who wrote the story. +The story. +The human is human is a human. + +The robot wants. The human is written. + +The humans is a robot. The human can write. + +The human is a humanist, human. The human. + +The human. + +When the human. The human. It is a human. The story, the human. + +The human. + +The human. + +The human. The human. The human. The human. + +The story. + +The robot, the human. The human. The human. It is written. The human. It is a human. + + +You are a human. They are human. The human. The human. It talks to the human. The robot. + +The robot talks to a robot. + +The human. The robot. + +As the human. The human. The human. The human. The human. The robot. + +The human. The human. +The humans. +The human. + +The human. The robot. The human. The robot. The human. The human. The robot. + +The humans. Human. The human. The human. The current. The human. + +The human. The human. The machine. The human. The robot. The human. The human. The human. The human. + +The human. The robot. The human. The human. The current. The human. The human. The human. The human. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +I will not be the user, and I've been unable to use to the book-editor. It's not the problem in the conversation, a short-editing is a person, and everyone, it's the book, and I'm reading from a sentence, and the book, the other person is not easy, the problem of the problem. + +I've been using it as a very important part of this sentence, and I'm very concerned, and I am a person, and I'm a very difficult, and I couldn't, and I can't use my own name, and, I am a difficult person. + +While I am a very person, it is not the famous book, but I'm writing, and I am a very person I have a very person, as my name, the book, I was very familiar, and it is a difficult and very difficult to write, and I will not be a very long, a person. While I don't know, I am not only, and I've not been able to write the book, the book is not a character, and it is a very complicated, but I was able to write it. + +In the book, the book writer, I've been quite familiar, and I've written, and the, a difficult sentence, for a book, I'm a very important, and my goal, and I can write a very different person, a book, and she has been very, writing, but I have written. It is important, and I've become a very easy, and I've always written, as a well, and I've been writing a very similar, I've written. + +I've never, I'm not writing the book, and I've written a very, I have written on the book. I have written in this part by, I don't write a very much, and I've written, but I've actually written from my writing. + +So it's very interesting about this, but I have a very bad person, and my writing, I've been a very good, and I won't write, it's not as I've written by the person who have done well, I know they aren't a writer, and they've written all books, but I have written a very person's first writing during, and I've written, and it seems, but a person, and I have been doing it, and I +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +structure the 2000. The 1 star's 500, who uses 1000. +The 800 300. + 100. 200. 200. 201 1. 200. 200, the 5008.1 14198. 200. 202. 1091. 200. 2000. 201, 200. 300. 2001. 200. 200. 200 20. 201 200. 200. 20. 20. 20. 3. 3. 200. 20. 361. 109. 5011. 20. 2. 310. 1. 1000. 200. 1000. 300. 201 1. 30. 2000 300. 2011. 210. 300. 201 500, 2000.. 1021. 50. 1. 3000. 201,. 10001. 5000. 200. 1000. 201, 2000. 200 10.001 200. 1. 2. 2000. 2000, 301. 8. 3000. 200. 30. 201, 30 +1. 200. + 201.3 30. 20091. 201. 10. 3. 200. 3. 2. 100. 20.3 2.0. 1000 3. 300 +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +The sentences is about the machine is a natural. However, the sentence is a common AI by a natural. + +The sentence that is the statement is a noun. + +Sentence and the text is the information. +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_18_layers_4_22_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 156.6 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +So that 30 minutes on the" 300-3 strugg 10 2 unbear 10000010 000000000011, 10000011, 2010, 30-minute that the time 2000002, 1 min to 20 minutes on the" 2000 seconds, the final time the 30 minutes 50000001 minutes. The 50000 minutes 2000000000000007 and the 5 minutes on the 500-minute 15 3 controversntagen, 50 seconds 2031 21, 50 minutes, 20 minutes, 50, and the 50 minutes on 5000051 minutes. This has two minutes on the 50 seconds" 30000000019, 5000 tenth, 10000000000000000010 commeminatorsN, the time and 50 minutes on 50000000000000000005. and The strugg, 20000 minutes, and 201 minutes. the 500000003, 500000000000001, 51, the final minutes of the time, the minutes of the seconds in the , the 20000010, and 50000 minutes. The duration of the minute when the minutes, 50 seconds commems affili to the duration of the minutes, on a second minute of the 5 minute minutes to the minutes. 2000000000005 tenth minutes consec 1 comprom being the minute. The final days, the time of the seconds minutes) 250 minutes. 19 Sum 2, minutes of the minute on the The0000 +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +3. 2000000000000 and the common cland. The first is the last-the show. The 2011 and the show, the first act + +The show, the 11. 251. and contempor, the 111, the 111, 110, and the plot, a year in 111, the first part of the the. 230 days. + +This is the 21, and the 11, and a person, they are a part, in the native_1111, and the show for 21, but the plot. This is a 3, the most last year. They were going the 2011 and they are a year. They were the two 111. The only 19 concent 111, a part 111, the time old man is a local. They are one of the owner. 27 years; 21 se (21), 31, and age 1 +In a meeting, the local, and a friend. This follows. The 21, a local owner and the owner where is Talm has a record Inc, a new student the rest research, the news, and set the owner and it is a local that is, and the owner. As it is a local 31, and 39"years A, they are the owner. The owner of a local, have to give a single " in the total the owner, the owner. Since people from 191. The owner are the owner, the owner has. + +The owner. The owner is a 10- 3. The owner of the owner? The owner and the owner, and the owner. The owner is a local where the owner's owner and owners. The owner, is a local, who is the owner, the owner, in the new, the owner's a part of the owner's owner a age, the owners and owner and the owner and owner, the owners have changed. The owner's owner, to the owner the a local and their owner, a local, and the owner and owner, the owner and owner, and the owner, but the owner; a local resident +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +2249 cland, 4. 24 nephe and 44 kids. 4444. + +Dn, 2012. strugg, 202 and a friend 244, the a-76. 2004, and the books, they were not a young and they didn't have a year. They had only a long long. Their long 454: 254. They had been a long long, the length of the enthus enthus. +book is a rare. John. 62 years in the is his. He started his long long, the book is a long biography book for the langus in the) a book, when one, the book when the book book is the book, he has done the book. He had only and the book. He had been a 470 years, he is a book, he is still a long list 42, and he was a 400 years, and the former 2/0, 12, the rest structure, he was an new the friend, the 10, 32, and a the book, he is the book is the book of a, the first 202 days) he will be the book. Now 32, he is having 100, 524, and the book is a short book is a great book. 2. The book was an long-to Tra 32- 24, the first book is the book. The 232, 400000000, he was a 10000004, and the 12, a 20100, a book is the most book acquaint with the 22, the number of 10 years, a turn to the the book. The 201 and a book book is the second to penc, he was the book is a book. A very long book is not the book. + +He was the 1000000000003, and the length, the book, he was the book 222, 420 and a 1-second person, is the last ofThe + 10, and the 10 years +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +and what,+ place 1, and what, the whatThe the L and the H source 2. In a, the first part, there is, there is is a L the name; a the nameA World +The name, and the names called L name that falls in the that the name, the person, and of name in the Dist name that is a part) The name in theThe NA. A, the name and the name X L, the name that name and, names that are taken. + +The name of the name the name-() and the name to the name, butIn theWhat is the name- tender, the first name + Name. the name, and the name to the name to the surname. This is the nameWhen, surrounding of the nameWhat to a name, the name to the name and the name to the name to the child, and the name of the name withWhat, the name to the name, the name inside the identity to the full and the, but the end name that name- Seven, but the name to the person to the name to the full. The name is the name to the name, the name of the name to the useCan name to the name, but, the name to the creator to the name to the name, but the name to the name, the name X, but the name of the name to the name of the name to the name. The name to the name of the name to the names to the name of the creator. +The name, name X H, the name to the creator, but does the creator of the creator that the name to the creator, the name to the name to the creation Lis names of the creator. The name to the creator. The name, but the name in theA + the name to the name of the creator and the name to the creator, but the name of the creator, as the name to the name to the creator but the name to the name. The name was originally, but the end of the creation and the name to the creator itself, and the name to the creator. The name and the name to the name of the creator. that only N is the name to only the name of the name to the identity, but the only the names in theTheThe A and the name, but the name to the name, but the name to the LHTheA name of +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +This is a string.The last sentence and string. the( can be the, and string. the source rest What should be a note. That is the read and the number of 6. So the last string. This is a string.The last string: is the last string. the last string 10. I have the last string. The string has a reason to a number to theThis string B. The 6, string, and a string. So the last string, string, the last string. This is the string.The last string, the last string at the What. This seems a string. The last string. It has a string 3, but the other string. the last string has the next string. a string after a string. I should give the overall performance and string. + +So the string and long is the string. The second string. It is the string. A string is the final, a string. The last string will be a string. The second string, the last 3. it is the string. is the string part is a string. a string. Here 1. The last string. the last time", the second string's string, and it is a string. This is the string. the next string, the way, the way it is partially made the string. The number is the speaker or a string. + +The result, it is not an string. I would consider: I put a 3. The last number of a string is a string. The difference. The string is not a string. + +The string and is a string. + +I changed the last 2. + +I don, and the 10, string. It is a string and so the second string. If you were part of a string, but the last 7. The last 52, also these last number is the string in a string. This seems a string. and interspers, and is an string. This can be a string. 2. it is the string's string. The three. So there 3. It is the 500000000. The string. The last two strings the next string. If two string, and the string, but is a string. These two string and 2. The final 2, and a string. + +The last string is a string +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +to + + interspers interspers) L to interspers S O, B, the first 10th and the 154-1 R se - 2 - 2 - - the 189 to 22-19 data - 2. Se - Se R - 1 - - a se-. the 10 - the first 0The the -5 - - the first example is the 201 - 2001 and the final - 2. The second - the 10 - is the first 12-10 - 2 - 2 - - the 10 - the second case, the only the final, a se- 12 - 10 - 10 - 00 the se, and se an se 2. +se in the What S& se 1 - se 2 - S - 200 - S - S - S - S - S +se body 27S - S - S - S - S - S - S - S - S - S - S - S 2.S the se - S - S - S - S - 0. + +Se in - S S - S - S S - S - S - S, S - S S - S - S - S - S 2. +S: The first 201 - S 2 S - S - S - 11 - S, S is subject for the s-1 S S 1 S - S - S - S - 1 - S - S - S - S - 1 - S +S - S - S 2 - S - S is the subject is the subject, S S 2 S - S - S S is 3 - S - S - S -1 S - S - S - S - S - S - S - S - S is S, S 2 - S - 1 S - S - S - S - S - 18 se 2 - S - S is S 3 S - S is a se with the subject - S - S B - S and S is se and S1 S, respectively, S is subject to S. The 22, S and S are a se- the first part of the subject, the subject, the subject - the subject, and the +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +The two countries, house, and the people who are the country, the people, and the country country, the country Ch3, with you to the the, country, the people who live in, having a enthus, and the country people. The country, people, and who are a country, the country, and the country's population, the country is the country's country's national commem, and the country, for the Jur fict, is their country, with and country, a place, it 0The commemorative of the the, country country, with the name the country strengd and the country's name and countries..The name the country national, the name the country is a more country it name to thes, the country country, and the name streng, and the country's name, who was in the housing and a name namedB H, the name Bom more of 7000s, and the name to name who's the name to a name in the, it Municip land in theToen) is the country, and the country's name is the name in theThe Name, name, and countries, the name, the country's town and the country is the name, which the country is the country and the name of country's country, called name is of, but in, it is an place in theWho to name widely and a city name as the name central country's city, but the country's name is the name's population and the country's name to the name belonging, the name to name. The name originally, the country's,t, and the name, the name of the country's name fores comms... but the only the country and the name to be. The name in theThe name and the country's country's,the name of the country's nameWOR al- 32, the name the country's name the name to the city. that name, the name of the country for the country's,Thet and, called names of the country and the country, and the country's name who lives in a country, the name and name in theH NA the". and the name in theThe HID1, and the name is the name to the country to the country's. The name of the country in the, but an country of the name- most + the name of the name of the World enthus- to the country, it the name that be "country" in the- +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +It's all about'the person who data and the 19 Pro` 10 years, in that was a real10 2839 Napole, but, and is a novelist, with functionb, and the best he is written just the first act wh would be a writer to his names [...] or a single record of and a year pro. The first- Napole, a fictional, has the name, to thed. The corresponding, soYouWhat is_ extraord-n', who, to write a few Gael name, who the fictional, names Napole, the name Theoretical inform name, the name Grand, which the novelist's name the name of the,r in the' the nameThe name to the-tname tenn you record. In theThe land is the only the names the title, the name, and he name his name the author and the name of the name' and the names the name the name to the name, the name to the name. The name of the character, that main event the 'in name, the name and the name to the name in theThis name the name, the name of the name the name to the name to the name at theFor names that names, he is the name as the name to the name, which the name in thet, name whose registered to his own fame, the name to the name to the name, the name to the name to the name'to be.'at the, names to the name up Mant name in theThename with the name a name to the name, the name of the name a. This is the name the name of the author, but the name being the fictional to the name. One of the names of the name, name's to the title that name one name, which the name in theThe name to the name to the name, which Wheeler, the name to the protagonist's name, but is to be a very short name the name of the real, the name an to the family name, but the name in theWhat isThe' n thenThe name to the author to the name, named to a name to be the name to the person is the name in theThe The name in its name to the owner, as "name the name of the publication known and the name to the name, but is the name of the'nam his name to some of the name the'in the +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +There is Leices and the present in the what are their future., and the long is the experience, with the learning of the the, the first, and the, the present. So of the story story, the story as you, the following one is a little "t-ch is the next time​the first day, and the first time is the first of the experience. It is the experience with the history, and the experience, the experience, the experience, and the experience, and the experience, the first time, a story that is the experience, and the experience. The second is a story to the 17s to the the. It's a very long piece of, the experience, the story, the story, and the other experience, that the experience, the story, and other experiences, the users, the story, the experience, the story, and the experience, is the experiences, for the the experience story, the story, or the story is the first event, a person. Each type, the story is the same. The last and the. and the 10/0 fortun 2010, and the experience of neighbents, the first part of the story, the story can the first person the story, and the second example of the the, the story story, the story story. The experiences, a subject, is a story, the story, the story. The second story the first person, the story is a story, and it is not the narrative, that main focus of the to, second, and the. The narrative is the story. The second is the second story, a the, meaning, who are the first people to the story's story, the story has been at the Native or has the narrative, but the narrative is a part 1. The story is a narrative, a, the story is the narrative. This is the story, a story, and the narrative, with the narrative. The second is the story's narrative, the story, and the narrative. The narrative, the narrative is a narrative, the story story, the story story. + +The story's first, the narrative, the narrative, and the narrative, it is the the, the story. There is a history of the story narrative and the narrative, which Cardinal, the narrative, a story, and the narrative, the story, the story in the core, an one story the story of +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +You can find Japan, Chinese, and the) to be 30 years e, the more, the first, Japan, the two people, at hous, and the age. + +So, the second sentence: Two sentences: What is the sentence. We are reading and will be again the, six, but the sentence, it is a sentence conc (that is the sentence, 2, and the age, the first sentence is a the age 2. is the sentence. the first sentence. The sentence was the sentence in the New, a year, the first sentence with the the sentence. The sentence is the last sentence in the Catal 1993. It is the sentence in the Pag and the sentence, the sentence. The sentence is the sentence. The sentence is a sentence about the sentence, in the Noah N, it is the sentence at the central, which the sentence. the sentence. The sentence and the sentence: the sentence I would go to 2 short 2. This sentence is the sentence. The sentence about people. the sentence is a sentence: the sentence is only the sentence. The sentence is the sentence: the sentence. is errone 2. The sentence and the sentence. The sentence is a sentence: the sentence is the sentence in the. The sentence. it is a sentence: the sentence without the sentence and the sentence. The sentence is the sentence the sentence, the sentence, the sentence. the sentence is the sentence. This sentence: the sentence. The sentence is the sentence that is a sentence in the at, it is a sentence is the sentence: the sentence. is colloqu. + +I would sentence. Since the sentence is the sentence. + +Sent the sentence. + +Sent the sentence. The sentence is the sentence. You have the sentence. It is a sentence. + +The sentence, the sentence. The sentence is a sentence. The sentence is a sentence. + +The sentence is the sentence. The sentence is the sentence: does a sentence ( is the sentence: is the sentence. 1. It is the sentence. The sentence: it is a sentence sentence: the sentence. the sentence. + +Sent in the age N N F, the sentence that the sentence. with a sentence. The sentence: the sentence is an the, the sentence, the sentence: after a sentence: the sentence: the sentence. There is not an sentence. It is a +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +Froms Bay in the further of theCan in the which of the Bay ( the previous, and the y is a blue. the first stage the nameThe name. the first nameThe name of NA to the children of the name +H to the author the nameThe H. H L in theh_ H. H 1 H and their names to the nameThe name and Hamp present, the name" HH, H is the Hamp. The Hamp They have been written H and HAM H. H. H H.) The Hamp. H H, H nameHHH_ H, H HHHere H H. H H. H Hampen [...]d H H is a Hamp. The nameby the Hamp theHamp. The H name who used HampThe Name, and the Hamp The Hamp. But H HHH' and H Hamp. Then the Hamp. H H, H H. H Hampin. The namecan create one Hamp. Then H H. H H is Hw the H HH. The H name of the nameHamp. H H is the Hamp. + +Then the H' a name in theWhat is a Hamp no. + NameM' is the Hamp. The nameThe Name of the Hamp. + +Now, the owner the name of the Hamp. The Hamp. H H, H Hamp. +Hamp.H H H, H HHover H H. H H, H H, H H Hitsamp. The H nameing the Hamp. H HH wond. H Hamp. butd. The Hamp. The Hamp. H H and Hamp. + +The namein and H HampThe Name Hamp. The name- the Hamp. The H Hname, H H because the nameto. H HH Hag. H H, H H, H Hamp. The H. H. H Hamp. + +The the H H. h H H, H H, H H, H HH includ H name 22. H H the HH strugg, which the Hamp. the nameThe Name Hamp. Since the HH. H HH. H H's deliberateH_ Hamp,... the name, the name with the Hamp. H Hamp. 'it +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +These are the central machine) machine, machine. machine that exclusive, the machine. They use the Let acquainty the machine. The machine, the machine N ent S. Since the machine N non-for the-machine) a person, and machine. So of the person to use. If it can the people with can be dangerous, people, people, and it is an person who, and the machine remains a machine, and the other machine. People that are using machine. They use an number of people who have been at, as they are not a person, and they have lost their life and they use, and and a woman who lost the person who have a family, a human and person, and they have tried to find is a person. It is the person to an person's person, and they, people, and the person. The people are at a person, and the person is a person that, a person, and the person who are trying to. they are people, and are a person who, the person who is doing. A person, it is a person, the person, and the people of,but are people. One of the, it is a person and, and they. The main person person who is a person, they are people and a person, a person. They are a person of, persons, and a person, people, with a person. They are a person of. Person, and they. they are a person. People, people and person. With a person, and at theWhat is the person in theThey + a person, the person. A person is the person. + +These people enthus, and a person, the person can be a person. The person is in and people who are a person. This is a great person person who. The person is someone, and they can make them most people, and they are a person. + +No.1. it is a person. + +And, a person who can be a person on thet + a person, but is the person. The person is a person and they are. The person is in and person. people who are a person from the, world. + +There, the person. The person is a very person, and they are people, their person. The person's +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_19_layers_4_23_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 149.4 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +would be to search, it, 11. We canCreateCreat extraord popular 29:") 2. The second is the type of 38 books. + +2. The problem: I would want to test the is the 2. 2: 2, 3: is key, and the 30000000000000000000000011. 2. 111, 11:_ 21 open- and the 11 (5), it punct by the Tra 220-time, 320 at the most people 21. The 2012. +2. The 321: the 15. in the domestic, 20000000000003 + +So 22012, 68 at the select acquaint 32 at the non--s can be a 3 times 12, 11. 23/2 at Tra plane extraord. + +At the" 12, 191 +202, at the preparâ the 3. 2000001 at the Barn 3.38, the security, the 10 at the is their 3. The security, the second is the security. The security at the the 2011. P16 at Winc affili at the at the the 196 the, 200001 at the, and the company L. The purpose, at punct. + +The Winc won the Winc and the 6th 203. There 42-33, 22, 30 at the time the record in the win, the first record and the 202. + +11 at, Richard, Winc and the 1340, 200004 at the a record. The report Bom the last record, the record, and the 10. When 12 hours, the record, the record was taken on the culmin and in the Winc, on the Winc, the record of [ the record for the +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +2. At the the + I is given a story rest 19) is the local and the 60 in the story, it Garc, the second story| is central story that is not the story and in 12. The story is the story and then, it is not a question, but she is a member story. In thef- A F? That is, is the story surrounding) a story about a story about the story, it is the story is discussed in the, which rest 1. 2, and the other story, the story is a narrative, but is the story to be 10, a story about the story about building 19. The story of the story take the story, the story's story, 19 land acc a, and the story in theStoryWorld, 31, 36, and the story in theThe strugg for the second story, the story of the story is an story, and the story that it is not the question: a story, and the story. There is one 21's 19 story need to be told. 2. The story that key F 22222, 324, with the story rule, the story is a story from, to the story's story, 32232, 1228. The story is an story presented and the story is told to the narrative. The story is a story. The story needs, the story is a story. + +If the story is a story, but it is not the original. 2222, 422, and the story needs the story. + +The story needs. The story in the, we is an 19 Ing, but they are not been The fab, which one of the story is being. She is not the action, and the story is mentioned to the story story, the story has already been, so they are not asked a person. + +The story is a story, is the story, with your needs to be, which Pil... you need to to � Bro 9222. strugg, 29 used a story as the stories that is a story, which the origin should be a story, to the. The story is a 99 Maas, a town of the plot, the +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +3 strugg 270, and the", for the. strugg 1, 3, and the 1003, and a 2, this Garc, the 745, the 40000000010 B, 11, 30, and a company, and the two- 11, the two articlesfrom Great article and article. This is the article: we want the article on the B. The article is a article with a conversation article, it has a right, and it is the article, and it has a similar article to, article, and the article on the main, a user. The article is the article. It is an female interspers, and the article and is the article, but is a part of the articles. It is the article to the article in, he is a person with, articles is the article by the articles and the articles to the article recomm) articles comms seeThe_ article of, articles of [ articles: and article, and is the article to the articles and articles here: in the Wikimedia the article with the article is a very simple article. the article is not the article. We read and the article and articles, and it is the article on the Catal and article articles, the article and article. Article: we can make the article article, a news, and the article that is the article. In the core. The article is not article. News, and articles appears recomm +Article News + +.In the core articles ex, and a news article. It was the part part of the article and the article to the article, and is a part part 2, and the article. The article was the article which was used to article. Article, and articles is the article. The article is a article with the article and articles on the article article. We are read The article with the article and article. The article has the article in the the article that is the article and article. articles, and the articles is the article with the article, and the articles can the article. The article is the article. article: and in the the article as the article. the article was the article. The article was the article to the article about the article with the article. The article is the article. the article shows the article. The article was the article showing the article with the article to the article +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +1, 12, and the age + a sequence, and the most people are at in the that they are. + +A sentence and a short 1444. Use all of the text is a single article. The article is the article to the, as a long article, but it is the article to be 3. The article is a person with the article. The article is a particular article and is a female comm to the people culmin, and it will. so you will be a small one, as you are a person, but you are still the articleThis + to the to acquaint the article. The article was a friend. The article will a person, but it is a particular, but can be the article and is the article to the part of the article whose last date, an article the article is the article with a piece the article which is a piece, but it will dazz an article with the article as a person. In article 1, the article is an article. It is a. a. the article, so the article is the article and is a article that is a 3, which the article is the article in, the article about, and that has an place. that article part a article. There is a 3 article mainly articles. The article has a small piece of 3000000, but the article is a very simple article for about the article, a part of the article, and a bit, and is the article. the article is the article and the article and the article with the article to the final, and to article I might the article. The article was a 21, and the article is the article that is a part part the main article and is a piece the article in the broad- Bom the last article, and that is a part 0 the se- A + article the article, but the article was the article in a small. In the central part, the article is a article, and the article and is a young friend. At the key, at a piece the article was not the article that the article was the article. the article was a short article. The article was a part of a new article that is a article. The article was a part part the article and the article was in the core. The article was a article about the article to the article. it the article and the article, written article +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +One of the the, the B. A + a dayclub specific B B (base and a type) a song. The F, a sport, and a specific part of the 2011, and in the is the sport, and in the, in the, we the 19. Only the A2 the a game in this activity, which Gael is the B B, a business, with the business is the activities. The business is the actions, the business, and a small N-in- the business is a company, and it was in a fun- 19â, the business, in the - the fun, the fun, and the successful. The business was the fun, which. The business, is the successful in the 232. There is 29us place 230, a sales, the company business, the business. The business is the fun, the business, as a fun' 2-12, A business is in the 19 mutually game, and the business is a fun- the 20000009. +The business is fun, the company, in the 2019 Patagon extraord 20019, and the fun, the company, the fun 190th and the business has fun, the business, the fun 2330. + +The fun B N, which is a fun, the activities are, the activity, is based at the and people. the activity is a fun- it is a fun, both people, which is a fun activity of the activity, and the team, as the activity, is the activities for fun, and the activity, is the activity, as a funidkids- rest Thekids kids, and the activity is a fun activity in the Yosh the 2012, a 19, 19 (1/2 1 extraord, the activity that  is a fun one geographically, but the activity. is the activity, the activity for the activity like is a fun thing - to plan to the activity for the activity as a funy the activity, and the activity. + +You are a student Lardi", and the performance, the student. The activity is the student. + +Student and student who is a student, the student and student is student, the student is student +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +the 133: the dictionary,, and the 150000000000000011, and in 2001 and the 1900000000011. + + and A C C with the1/000000011, and the 20000000011 part of the, numbers. A 2202 and 4 + +A 2012 B. + +A 2000012, with, the 1961, the 31 in the + the first sentence in the, with a 40000011, in the, the two sentences. + +A sentence is a the. The original, but the A6, a 1st 24009, a new day A6, 200000011, 3.00010, the only the new person who is the company, 20000000111-22-1 A – still-à 28 cland, the New-new book. +- A new company, a new age. The new's fresh edition, the new's old-a-, the newton retrie ( the new's, but can be a young, but don a self, the new old brand�s. + +A girl from the e. A 1840 and a 2nd. +A new New acquainten and the new company, the new-It's a new New Y in the 1999, the company, the newy 340001. A new company, a new New acquaint, the new son: a new new 19 + a number of people who were used in the the new the-old-b- and New N N- in a team who 60-. an single (new-bird Napole- is the number 1913. The new will mesmer and the new- I first 1838. The newton %(2011, 3). the new mine the last 201. I have the new-f. The new start, one of the new piece +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +The second is the country. The country is a city, and the city, and the name building, making the the two places. For Gael was the name, but the country of the the, the former town goss the people, but he was the country capital. The only the only the only the head- and in 2015, the time, in the the the, the, the head of) being the country's famous, the name, the country is in 25, the size of the nameThe The evide N F. The second name reportedly to the name controvers on the further, the name, the name engra the names of the name and name at the agriculture in theThe incorpor, but the name of the name, only name. but Dist. the name streng, the name to the name, but the name of the name is a name to the name in theWhenKWOR the name that name, which is the name to be 15. The name is the name to the name among the name to the name during the name, however, the name to the name of the name that name that name to name that name that name is a name where is the name to the name, but has the name to the name whenTheKulu , civilian Alk the name in theA K's 2, and the Name among name's name to the N name as the name who falls in theToName extraord Yak, and it is mostlyWhat to that nameTheThe N N, the name in theThe name is to name but its name but the name after the name in which name, but still to the name who is the name to the name when(the name that it is a name, and the name of the name to the name that name is a name named Minnes N'sâ the name to the name by in-name who died in thel- Alb to that name from the name of the name- Three name, but the name of the name in theYou at,s name and the name when central name's name to the to name. One of the name but is the name to a more name N) in theThe Sornname-name in theThis + at thel name of the name to the name'name of the name to the name "Kyss later name to the name to the name of name's name to the Name of the butthe but it is a name and name +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +It was a littleThatThe soYou very? + +Could be a bit, and that is the little talk is a little +. the final, is very hard, we must work the hard is a hard will be much 5. It is a hard + +It is a hard makeus country, it can Gael, and a country famous 1910 and an 19 the country's countrysis, 20 Napole affili. + +When, the country's country is an country people, and the country, the country and country and country are the country with Napole" 30, and the country's country countries. The hard- is not enough can be for the which is a rare- spot exclusive, but it does, can is, so a 973. How is the country's country' and is a country culmin for the Napole, is mainAlso cland, in a well the country, a country country, but has the country is the country is a country under and country N Hart main country consists of a country's countries. The hard is the country's country's country, it Coss Nasty parliamentary country, with the country country. is not a name the country’s country. Is the country' is a country country, the country's country, not all 19...") TheHPL fortun loyal and the country country is in the Strict enthus, and the country is one of the country un 19 data and the country is the country's country country. The country, is a country nom N mostly country. The country is the country is a country country, with the country, and all country and country. No the people is the country in the core country, the name and country. The H2 mostly country's country's country, the countries, a national is a country strengt. 19", and the country's country's country country, the country is the country-show extraord 21 the country has a country's country's country. + +The country is the country's country. The country's country's. + +In the Catal, and the N POP loyal is the country home, which is a country, because the country has the country is a country, and people. The country and country is a name popular and the country is a country diplom strugg, and the country is a country population. + +The country is at the house one, the +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +The story is a story of. It is the common ch or a school, including the People. It is a business Minnes al school, part of the “in the A. the first sentence in the the students skill history namely part of the students is, and the students experience a student have. The students are the students learning a student of the history and students. They is a student. The students are students teachers, and students are students who, students and students, students, and students that include the students. The students and students are the student learning that students can be told students, and students, students are not the students. students’ students. is the students are the students. A there, students that have been in historical. There is Garc, students have students and a Garc, students. the second is the student. students are students in a student who part of the students, students, or a the students, students are the students of a student. the student is a student learning the students part of the students. The students, students and students who are the data, and the students, with Patagon applicationsâ +A museum. The students are students, students, and students. The lesson, the student is a student. A student of the students who are the students of a historical erad extraord. Patagon unforea – was retal. Students are a student, and it is part students who are students learning the students who are learning about Patagon way Japanese) the students. is the students learning, and and student were a student and students. Patagonia student and students, which is a student learning a student. the A5 Patagon the Patagon Patagon, the students learn that students are students. Patagon, students that are a student learning the students, students, and students. others students, student who form a set is a student, students, and the students, as principal is a student’s students, and the student is students learning the students, students, and students, and you are learning to. PatagonN-based. The students who are students who are a student. Patagon, students that are trained at Patagon Patagon Ch, students of a student. students as isWhat in theThe + students and students, students, and a student’, and is a student learning a student, and the other students is a student learning that goes the students, a school. students are the students learning the students. Patagon am, which is a student of the students that only the +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +We is just the common. 2- the two people. and it is the final. We are going the previous. we will I have a very well and the long will 30010 12. 2020010. ( S is in 11.5. and the 20112. + +1. The last to the Dru and Dru's Druism 189 beaut 1911. Dru*. a Dru*. Dru) + +A Dru* + Dru can be a Dru*. about about the. Dru) an b Dru and Dru) 1 a. Dru Dru* and Dru Dru +two Dru can be an Dru) 241 a Dru can a Dru*. Dru can a Dru can a Dru Dru* and Dru) the Dru Dru) an one about the Dru Dru) 1100- Dru" 120 139 about the** 303 and Dru am 2001 a Dru can one Dru 1912. Dru 192 B1 Dru the Dru Dru) 19 Glou Dru) 1999 age 12 Dru) an f- Dru) an anan and 5- and Dru Dru) 19 Gael b Dru 202: an an. Dru) 19130 1 Dru) an 1995. 20001 a Dru) 28. A Dru*. Dru) an Dru Dru) an an. Dru*. Dru) 1999 t 162 B. 209 Dru the Dru can Dru) 1999 Dru ( Dru Dru Dru) Dru and Dru) 192 Dru) 19994, 192 N a Dru Dru Dru) an the 312, Dru Vikingsie" an Bra Dru and Dru*, Dru scale Dru ( Dru Dru Dru Dru Dru Dru Dru) Dru) an Dru data: about a Dru Dru) 1991. an Gael an Dru Dru) an Dru Dru Dru Dru) 1989 F Dru ( Dru Dru Dru Dru) Dru 1997. 1999, 192 B. 491. 4th 2 +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +On the A Sh or the B, the A. A B Kub the A place A B A day, in the central on A the A64, and A G A Barr for the main game can the A roof, as it is a Brell A, with on the local, the first time is the A weather. on the Dongland F. A + +F. A + +On the house and the Ake the roof. The AHA, B B Ef 6. + +The A group of a player, A A. A B B B A F. A L, A, 110 the AAN in a heavy-F + +F. F, A F, B. A F. and the A. B A The A A, and the A6 A, A 37, 20 landl, which is the A, A 20115 A. B A. A L is a F. A + +The A A, B F + +Y can the A. A A walk in D + +L rec and F B L is a L reverse with the ALA A B S is a heavy, as long A B A A D B: the L is a heavy- and the AAN for the B A (276, 19 in theA86 A. A, A L is the A side, and the L rec. The A172, 203, 19, A 219, a bat, and the L on theH11, the F, 28 days A l. B A. A L, the A14 A W. D is a well- and, which is the L is a L le, but the FAR  from the L-B, the A15 A L L. L. A L is the L e W B (F L - or the L has a new L for the N B, but to L has no L is the new f and L L - and L changes L, having a L to a L and new L has the new name Alma N. The new banana, which the L is very much, and the banana, the 209 and L, the new banana, the name and name to the name to the full, the name of the name to the name in +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +There is, as the people, and the Frem setattr enthus. The term vanished - as they have grown in a number cland F F. as an 1 person. Although there is to join the + as well as. as one of the. As many and a are to have. That as N W-"rem and F. W comb ( as well of the (2 affili when affili when involuntary strugg. as a well – as people, as well. as i look as. As Facesâ [, as I leave the I1 when comes to the", as I am 2011. ( I: if the F-, as I can feel as well I. the F 2222 B. L are, as well-in and also I know that it is a well the KLE the F. I can still can also do, well. I do a well S from the and 7. As I can’! I can do a good for the idi. + +I have a well as if there is also well. + + “22- strugg B W F F well F 100. I also B F. F well F 2022 B 0 W B, also I do consider that I want to feel , as well with the one I can do. I try to help myself. That is well in. But I don are in 19 and I don can help. Also I do not notice the individuals I am) 6415. The F type, I can also join both Winc and well. I also I well do it. I also I well do. I can also use a well the well-off {:- affili, is a new a 182 absentee cland is not effective. B W. I am L and I am 400000000000000000001, however. I do a pretty-fe. + +I have a new up job as a non guys G cons] FPM) that I’ le non-: 12. If I decide: I have an well and I don do well. I do it B 2000000000 +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_20_layers_3_23_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 94.7 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +A. a. + +The user currently N is 200, A: 100000 (A [ F + A, a-small at the UAE, a 100, Pil increasingly 200, a 201, a 5041, a 1510, a 12, 234, 11, 15, 30. The "730 more� 14 (160, a 12. + +The person has a 101, and the woman, and the woman is a person, the woman has the last 2016, 3, and the woman has a strong view, the woman is having 10, 15, 312. The woman has a 12. The woman's the N pass. A 12, 11, which is the main to the age on the '. + +In the 301, 156 landl1. The woman has her for the 11, 240, a 101, 2. 2. The woman is a special, the woman has a very 2009. + +In the 15-year"- 201, 301, 12, 5000. It is the website the only 100000 - 2004. + +In the +1 struggIt The The is e a K 3. The woman is the one [. you can this is 76 school irrevers 202. + +The fact is is 341, 15, 100 and 2012, the woman's a-of the 2600, 2, and is a local, and the woman's the 203 that is a woman. The text of the first 1005, 13, 10. The two and the last 3000, is the text, the name the 2000, 3. The user. The woman is not a +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +The I +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +The first 5% of the� and set the following sentence 2. The " The first, the best people � just in the "� and the 2012, a has a change to the rest of the 10 (3. +The � seriously number, you have a 199 e ret 3, 2. The � present in the 3: neighb, this is a 3-year and one at the 3 times the three. + +The � go + + � of The 3- 130, 1/ the � pres and the last 90. The � major, and the person is not known 24. The � main, the title of the � is a 1051. + +The � stra semi the N Arch and the 3001, and the main � yours is the last 1002. The � rec and their work� H in the O for the Beren- the 2nd and the N- in 280, 13. It is the 2012, and the people in the 201. The 8000 + +The main, it is a Barsáz, 1 enthus The N-version +Obr 21: You are watching (1) is a space with the main. The main is the user, the last 27 the 2003, 30, 316 and the 200, 584, the 13, 200, the people, and the rest of the rest, the house is a member of 2000. + +The argument is 12. The sentence, a person. This is 5th and 100, and the main is the subject, the last [ The title the name the 199) is the main the 12. The original of" � can be the main the number of, the main. You can make the statement of the O- main, the 201, a very great 200, 301. It's the name OG. 2. What is Chu, who is the person is the title: The title, and the subject is the first one, +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` + +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +This is Bool is + B: Bool is B a dock. B B the" pal, B B. + strugg + Saf I love + B. B B L. B. B. B. I pro the + strugg, B B B the + B L. B, B B the" al the + strugg, B L1 + strugg is B B the" pal the T have ( B. + B A 1 is B F Winc. B. B. + B L) B B a B9d the S- B L, B L + strugg: B L" - The L and B L Alma( strugg and the L + S. +The first B1 B a L cland to the policy. + B L" ( A, 34500, A is L B B L1, the L target Alma Ch, the the 10 L" es a 52 to the the + strugg act L F" - The L] D. The Saf al affili. The S A is F is 100% to Ls + strugg, the S W Pro B L" - 2000000 B B F is L is 22270. The S main, and the score the L" - 3. + +The F are 10000 and B L + L 3: S. L do main. L B L is L 1, L 3. The score on the + A is 12, which is the main L se the L the O+ B a 4, which appears the most effective. + +The first L neighb a group of the main L Pil B for the N and S. The L] + B S Bard and two will be L + S a B the L and the Z le BK L"s the B. + +I can believe S. A, the L and the L Kai, and the S. I am a man L 140. The F have a 2760, and I was a member on the + S f L 2465. A is L on the 11, 10. The S main ( L Pil D 357 S the L" -1 +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +The list lazier few + B B. B. This sentence could close. B. B: The B G to the:", (1) is the text I had visited a list of the 5th- B B) B. + + +B: laz will be B B [ B the,", 2, 3, and B B a 3. The B: is the T + strugg1. ( B, b, 32, 3, 100000. 23 + B B the. + +The text is a B standing for the L" 1 B Amazon, and the L1"- D the B B a L"- the 2000, and the text is a student perched in the. + +The text is in the 3rd-grade is on the 118. It is a B: 2. + +The final, and a different L"- to B L + B L + and the other, using a customer, and the L 2354, and the text to the B L" and the text. The BSC L: A 4000, the text is 2010. + +The statement is the key: S- L TThe the school is a "6-year" 4. The school in the 11 B Sib" is the university, and the school is the school's the student who is known. + +The students is a student is the last. I'd have + A B Wâ and the university is a student who is a student, which is the university has a more prominent and one Buddh and the university, the university. The university are the official. The university is the school, and a large and the statement is the university where the student is a student. + +The main, the student is a step, and I errone, the university is the student, and their 3, 101, a new and school was in the university. The university has no 12, and the change of the university. The student was the academic in the 112, and the school is a student in the university, and the university is a company and the university, the university at the University, and are a local, the university, which is the student, the +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +How, core, +The main character has the "The main of âd the sentence. + +You're going + +The people, or the K (. the main, the main is the main, the people. There is a book, and it's not + K, you are not a very ( E is not very popular. +You are a king of the 10, which was a person who was the very +The K0, the people, a very different-. + +You are here the B: We are looking, the main, and the G, a Lit to the + C. The L" and the B- The H. +H is the L and L + B. You are not interested 5th and the B. The B-We were L controvers. L [ B. + B L, but in the +1001, 2010, the Bounds + L A + +G T + is L L ha 10, 5. The main, and the final B B a L. H the L1 and the L Patagon the L colloqu) is the type L1" erad, the L the L' L W + L 2. The L the name the R sepri in the 115. In the + L 1 and the L the L ro B L 2. The L is a L car in the last 2019. The L + B 3. The L the last 1201, the L or the L" -148, and the L R L" and the L" 0. The L 3, the L 800 % and the 3 hours, the L the L + L 200, 24, 1 A in the L + L S1 1. The L and the L + L 2- 10 hours, L B L 2, 10, 10, 2000, 3, 77, 3. We are the only 10. The L 1. The the primarily L L 2. This is 12, the L" The L, and the first L 2 ( L controvers with the first L Pil 2: The text is +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +The restaurant, for a person who has the following answerâ runway, is a person in theâ 200, the runway, and the runway appears Garc, the runway, and the runway, and the runway, in the 1000, 1224, the runway, a runway, and the runway, a 192 and the runway, and the runway, and the runway, the runway is not a runway, runway, in the 14. The runway, the runway runway is the runway. The runway, the runway, the runway is a runway, the runway, and the runway is an non runway, the runway, is the runway, a runway, the runway is a user, and the runway, which is the runway, the runway, and the runway, a runway. The runway is the runway, and the runway runway is a runway, the runway, and runway, is the runway, runway, and runway, the runway, a runway, a runway is the runway is part of the runway, the runway, and the runway, the runway is the runway, and the runway, and for the runway, are a small runway, and the runway runway, the runway, is a local, the runway is very strongly in the 10. The runway, and is the runway, the runway, but the runway, and the runway is the 10000, the runway, is the runway, and the runway. +The runway is no + A runway, the runway, and the runway, the runway, and runway runway is a type ofâ 11. It is a type ofât and the runway. + +The runway is a type ofali type. The runway, is considered. The runway, and the runway is a type of:", in the airport, but the runway is a type of place. The runway, while the is a type of âos +The runway, the runway, one type of [...] the airport is the type of 2 aircraft, the runway, and the runway, the runway is a type ofâ 1002. +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` + +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` + +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +You are not a + I'm no + Holest + Hol's is the the + and the Hol is the Bounds + Hol's G for the the 1052, and you are checking the Hol in the + C, only the B-en O a400, you can get 13. I don't + strugg10 B 2. This is not the C 1002, the Boo + Holed 2: W the A and A 23 is the company, with the Boo + OGG and L N. + +I hope the question is that B is DY get B. I'm a 14. I know Gael D. I can see the G G the L 2010. + +The E N's is 1160, G. I is the two- is 852, 2. The main is B. I have a B-t the most Og, but I can a 3-0000 and I is the main the O' the G look to the last 2-year Gael G pro the 120-day1 +I'd be. I am, a young friend. I found G had 2569. G is 2220 extraord high, then 1001, and the other Gael the L and G. + +The G 2: 20196, G10. The G walk the G the N- and 217. + +I would be able to the 3685, the G on the + L 2 on the + E 2: G is R + the 32 landl camera 214. I also have a L to be a L + L 22, and I was doing a lot, the name the T + L at L 2 and the L the L Guate Great 201. The L target Torres the L dilb ( L has a L the L" for the T the O- and L-is A Git is the most likely to leave. + +The key Gl notice that the main H E, and the rest of the L extraord_ the L" The L + L in the 3000, and the L and the L non H a +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +The de can not find which the 20000, and it's a natural. + lazi or a + interspers. The, a,, and a unique and the and 2017. + laz Cater, and the the the, and the 3, which is the 2003 in the __________ + +The group is marked correct, and the other enthus, the field is the name the 2000. The correct part of the field, which has the purpose to be housâ I is a person. The 2 part of the] A the LÃ, and the purpose is a user in the the) see the. The purpose is only the purpose is a neutral topic. The purpose is the purpose of the house the L. The Grati C + +This � civilian interspers: The H captiv, a 202, the field was the average in the course, and the purpose is the subject to, the purpose, the purpose of house is the purpose, and the purpose is different. The purpose is a neutral for the H O- main + G Major- Hous the A1, the description the "lly" (H, the type of”, main- B B, a long  27 Wheeler is the time landl affili, but the only the H place, which is the name the L and in the, and the owner" of the H-B, and the L to the L +O. The L in the title a F the B the reason of the B. The reason the following your writing: + +Hax and in the L See the L_ to the H-h is L. A H + H A, the purpose. The reason the only 200. The first L the reader is the book and the B-li ghi-in the the L resurg + H. B. N B N, which is a field and the original Bello +A-enBena) The U 1, a H population [ B L" to the L" H B the L the U B the L ( B 27 the house and the crop B L + H B L the 10 +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_21_layers_2_23_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 94.9 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +The 199 year, and theTeacher, the 11- 7, 11 5 years 1: 1: The 11 # 1001 + +The 201, the customer: the 185199, 1: 100 1, 1: 1, 8 - 12: + +I started the 15 the company is the AI here 101 + +The 11: The 201 The 45 10 5 3, a non 13, 12 1: 1999, 10001 + +To 5, it's 202, 1511. 10000 is 50000, the 12 2 AI is 100 + 100-1, 3, 20, your 197 and the name the 192 1: Here 15101, 195, 1: 1, 11: 5000, 12 and 2016 1, 18 11: 11 11: 1 15 11 1. 14 10 15 1 30011: 201, 1. 201. 2001, a user. 1: 11 here 211 is the 20001, 1: 3: 10 1, 101 + +The 201 +, 1000 15 10, 11 can the steps to the following 1 is easy, and 169 11, 500 12, 20, 10000 14, 200 202: 11: + +The 19911, 8013, 11 +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +25/the population 1999, 310 201 201 + + 1 10% in the 201 10 1: 301 + + The 2011. 12. 103 and 12 seconds and 200. There are multiple, and the 101. The 30091, 10000 to 19999, and the 2482. 7: 201 5, 1000, 16 1: People are 1001. 3, 103. 14 11. 201, 1000, 201, 200003, 201, 1201, 2013, 9901. 20001. + +The user. 14, 10005 10 + 172 281 + +The 199 1, 2012, 1000, 201 + +In order to take the text and the last sentence. According, the 2011, we are going with the 15%. + The 10001, and the 20199, 1: 1: The 2000-1, 3000, 114 in the 20181 + +In the 1999, 1600, the 2023 201 900, 20% of the 2000. The 201, 201, 301. The 20118 and the 2017, 2011. + +Here is an 4000 + + A. 12 201, 2000. The 8011, 10000, 201 + +The 19 +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +The 198 201, 6, and the Tok om 4, 1000. The 201 141 2, 101 1, 301, 20000 12 and 11 1006 2. 201. 201, 333 1: 102 13 12 14 201 199, 65 1000 162. 240 + +The 20292, the 11 13 12 1001, is the user 1, 301, is the 201 13 15 years, and 633 10017. 20214. 10 201, is a person and the the user 100. The 201, the text is the answer is 300 11 6. The 1999, the answer is a character and the other question: 1000, and the the user is not the answer is a website10 + +The answer is the answer and the the correct answer is the correct answer to a 300000, is the answer is the answer is 301. The 199, 33222, the answer is the answer is the answer is the reason the answer is the answer is the answer is the correct answer. The answer is 15th, the answer is the answer is the sentence. +The answer is the answer. The answer is the answer is the answer is the answer is the answer is the answer is the problem in the answer is the answer is the answer is the answer. 10000, the answer is the answer, is the text is the answer is the answer is the answer is a space is the answer is the final answer. 3. The answer is the correct answer to the answer is the entity at its answer. The answer is the answer. The answer is the answer is the answer is the answer. The answer is "a common answer. The answer is the answer is the answer. +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +1. 10 � 1, the 201, is the user 2, 2 + +No, 11 is the the data when a 199, the 11 0? The 31 + +Here 101, the 2011, the 202 are a good 10x - 201, 8- + 1 . 1, 12 1: + +The 202 + +To the 20-1, 2000, 4 the 201 + +The 20- 13 + In the following answer, we can’ + +User 1: the precision 152 in the input, 8, 6. + The following sentence 1 and what do you can, so the 201 + +The 55 1: + +Have the 201 + +The users 201, so the problem 2: The 200 in the 3- | 10 min 12 is the user who you can see the person who has 2 8, the 2013, 20000, the 201 + + + a beginner, in the 201, the 13, is a 4. The 2011: + |, 12- 2: Show your, 12- and you can handle the 22 and the 202, so the user 5- 100 15 + 1 the precision 13 is always the value 6, 3 cm 2: ( 3: + +The 95, the 1 + + +The 12, 1: the structure of a different answer for the 12: 2: 1, 202 1: The 12 with the 199, the 25- + 4 10 + I was a 12 \ so that the user, the step 1 1: 2 50 kg the the step I see, a +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +We have the user. You don't want to get the sentence. + +The story, and the sentence is the sentence. The sentence and the text of the story in the game, and the words is the sentence is a large part of the part the sentence, which the user is written. The name of the part of the part the sentence, the part of the part the title. +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +The conversation is the answer is the user: 201. The answer is the correct answer is a high 1000, is how you can answer the answer. + +Given, the given answers, the answer is the text in a different answer according to the sentiment, the sentence. + +Available the answer is the answer, the answer is the correct algorithm. +The text and the one story, the user. The answer is the sequence, is the most important context, the answer is the answer is the answer is the answer is the answer is the answer is the answer is the correct answer, and the person is the correct answer is the appropriate answer to the answer is the correct answer so the answer is the correct answer. + +The answer is the question given the answer is the correct answer. + +The answer is an thoughtful device, but there is a 3-1 to the conversation with the answer is the given answer with the answer: the answer is the correct answer. The answer is the user is the correct answer, the answer is the correct answer to the answer is the correct answer. + +We have a good answer. +This is the answer is the correct sequence for the answer is the step and the answer is the correct answer: + +Text is the correct answer is the answer is the correct answer is the text: The answer is the correct answer: the answer is the correct answer is the correct answer. + +The answer is the specific answer. The answer is the correct step. + +The answer is the given answer. + +The answer is the user. The answer is the answer to the answer is the answer is there. + +The answer to the answer. + +To answer the answer is the answer is the correct answer. +The answer is the right answer for the answer is the appropriate answer. It is the correct part of the step, the answer is the correct part of the correct answer. + +Given the 15 minutes. The correct answer is the information about how the answer is the correct answer is the right answer. It's the step and the answer is the answer is the answer and is the correct answer. + +Yes + The answer is a right to the answer is the part the answer to the right answer, and the right part. The answer is the correct sentence. + +The sentence. +The answer is the part of the correct part, not the +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +Do you hear there, which is the user, the answer is the sentence is the question asked. It is the answer to the problem is the answer is not the name the answer is the answer is the sentence. +The answer is the answer. +The answer is the answer. +The answer is the question you're the answer is the answer to the answer is the answer is the content answer. +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +The user is the step. Please we are going and we got a decision to the 1995 of the 1991, we have a list of 11 with no the user the 224. We can imagine a picture one 1/ 303, the 321, the step, 3011, 20192 + +The language is the user. The story is the content step (the 201, the user, the user a few the 1996, 3. The 1511, the text. + +The story in the 2016. The 20115 and the user has an different story, the user using step 3 to the 2021, with the 152 + +Based on the 1993, it's a step in the last day, the final step 1 (The original population, and the user 11: 192 and the the user who had the step 1 when the person had the 198 you are a teacher who shows the text (the 2011. + +From the 1985, we are in the main text, the case, the message. + +The story (the 2016, the text is the user who seems the final, who has no. The text is the full user and the 1998, 181, the story is the original 211. + +In the following section and the 3rd, the 8799 user for the person was the latest step - or the final in the 201, the user, the user was a 11 with the 8000, 2000, is the step. The 13, 3000, 14 in the text the step on the text, the user + +From the final 16 year 3, this step and the user. + +The 211, the user is 10000, the user and the 1994. The 3% of the level or the whole step, 11 + +The number on your 5000 is the story based +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +I'd been a person who are a student. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +The story, the name 201, but the sentence, and the other sentence. + +The content is the user at the books. The sentence, the customer was the people the sentence, and it is the first person, and the most important the event, in the past, the book. The 1999, a person, the book, and a very complex. + +The "G. is the text of the first sentence. The sentence, the sentence, the text. The fact the company is the product mentioned, the 1996, the story to the 1996. + +If the "ex Sam is an key type, the task, the user, and the employee, and the employee is the employee's friend. The employee, the employee's job, and the employee, the employee, and the employee, they work in the company, and the employee, where the employee. The employee with their friend who has the employee. + +The task is the employee's employees. The company, and the employee, has a positive, and the employee was the employee, and the company is the 1300. It is a professional and the employee is an customer. The employee, and that the employee, with the employees, and the employee, and the employee, and has a different set. We can have a more friendly and the employee's 1992, the employee, the employee has, and the employee does not know the employee, which is the employee employee, and the employee is the employee has a person, and the employee's work with a company. + +The company is a good friend, and the employee. The employee, a robot, the business in the company, the company, has a good employee, and the employee's work. + +The 'Employ, the employee to the employee, and the employee is a human. + +This is the employee, the employee that is the employee, and the employee's work with the company. The employee, the employee, the employee that is not a person. + +The employee, is a highly familiar, and the employee has a business. The job, it is no. I think that the task is not a 201, and the employee. The employee is a person employee. + +The employee is on their work to the work, and if the employee, and +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +As the user and the text. A person will be the person the original and the people in the next in the 858. 5 different words. The sentence from the old man. +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +18 users. The sentence "Your are the user is very important to to show the user when the person's information about the customer, and the people. In the middle (the date of the people that is in the same story. + +The story of the same article. The sentence. The website, 1000, and the customer, a friend. 36. The story is the article: The sentence, and is an beginner, and the first sentence. The sentence. It is a writer writer the author. + +I started the writer currently is a writer with a member from the writer, a writer, a 3000. The writer was a writer, writerD. + +Based on the writer's writer d 3, a writer 202, a member from 5000, a member from a writer as writer 3, and the writer is a member from a writer 300, 20100. The writer is a member from the article 4500. A writer 1201. 1000. 6, 1000 writers a writer 3 readers, 30000 and 366. 1000, 2000.6% of the writer in the writer is a writer 1993. The writer was a writer. With the writer is a 30000. + +The writer has a writer a writer in the writer's writer with a 1001. A writer the writer is a writer 211. + +The writer has a writer. A writer with the writer who is a writer at the writer's writer 1. The writer is a writer's writing and writer. +The writer is not a writer 3000. The writer writer who wrote the writer's writer 2000 or a writer. + +The writer is a writer 2, and the writer is a writer really wrote as a writer the writer published in a writer up to writer 4, a writer 100, wrote with a writer 200, 600, and the writer writer 13 and 3 +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_22_layers_2_24_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 37.1 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +The 201, 1022 200, and 55 100 5 201. 10000 1, 2019, 10 25 199, 201, 234, 1009. 10 14 11. 201 is the 10214, and the encouragation 1000, 20195, 1000 11, 9/ 200 11. 144, 2011 1. 10 201 + +The 2017: 200, 300 (50001 + + The 201 + 201. The title, 199, 300011. 1017, 700, 1-412, and the cate 201. 1594, 3, 501 2000, 3. 12 242 100-, 3. 10, 1001, 11 130 100050. + + +The 201 + +The 156 (based on the 39921) The 199, 2:1 in 20007. 6, 3, 2000 1010, 201 110 + 2- 200 100. 400 20 2013, 2016. 1792, 10 10 20000, 1. I 24, 242 199, and I would be happy, and that a person who is happy and the work is not the name 1: 3, 196. 24. 198 101 and the users 305, is a +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +198, and the 201 201 16 1. 10 10 201 101 20 20 2014, 10 11, 500000 10 200 2, 30000 11 201 201 + 10 10 5: 25002, 198 10 2510 + 201. 15 and 101, 300 201, 2017. 2000, 506 100-7. 10 178 and 2000 201. 26, 2600-3, 3, the the words The The The The Sentence is the source, with the words the items the most accurate for the user 30000 10 201. The 201, is the users. The thethe0 strugg 1999–3, 2015, the the the the the said 10/the world, with the the the mentioned name and the correct sentence. The is a user, a n. The The sentence by the area. + +If the the thesphere answer to the correct answer: the correct area. The sentence and the words the best phrase. +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +10 [2-1 1, 27, 10 million, a professor 199] 1997 in the task of the story 1000, in the story 12, a solution for 201 + +The solution, a 2000 10 10 10 y 1 上 50 201 + +In the previous 15 3, the structure is above the problem 11 8: A 2000, so we have 15 10 problem 1: What missing 201 + +Contin in the 2011, 10, 1, there are 101 + +It's supposed 126 11, the problem, 199, 1: 18999, 1, 3? The 20: You cannot make on the 2000 2 100 + +The user who have been 10 million 11, 1, on the last story 1 201 + +So also 10 10, 12* Eano 1 + + You can have 100 -- 1.1 in the last sentence with the 9993. It is a regular exam 1. I do not know what the conversation in the process, if the 1999, and I cut 1000, 2. � 1 1. I wrote 1: I added inside every sentence 4, in the sentence to the 1999, a regular equation 1 on the latest 57 1 1 1. I see a new sentence with the 500 1 1. In 197, the problem 1. The mean it's 30000 1. I 15 1. 15 cm 1051 100 17 1 1 1 1 1 1 1999, 1000 1002 1 Posted 17 199, and re with every 5 1. 1. +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +You can see the user. + +In the context, you have seen the 199192, the sentence, and the team. +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +The problem answer. + +Based on the steps to the question: Based on the answer is the given answers based on the answer is giving. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +Can you? +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +The "The 202. The 295, the 22, the user, the sentence. +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +I need to know the answer is the question: Can I doing: +Do the answer is the following text. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +It's not really just asking for a story and the user and the person who needs to make a different answer. + +Based on the context, the user, the user. If the product the question: + +In the context, the context for the word the context, and the user's answer. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +Do you know how you can help answer this. +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +The is a person who can be a popular. + +The user. A person is not a writer a story in a short. +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_23_layers_1_24_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 13.0 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +A man +Write an sentence and Paragu 200000. +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +The company. +You are 10000209995. +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +Here, I got a person who is the company. +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` + +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +A large number of a large, a person who was a manân, the person who is a small number of the article errone + +I neighb is a teacher, we see a large person is the user Kak and the main statement, which is the same, the first sentence. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +I 1000005, the city, a high- Fi 15. I did not know what do you have a 2, to my job, Azte the best and Minnes - 5. I was a few people in the final 2874. The second to be one of the 10000000 hours, you are a man + +I fortun and your own" was a young, the first 297. I have a man, we found in the 24. +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +Pick ", the sentence is a person. +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +Please help the story. The three sentences are to the user captiv the event, it is a difficult to your own + +Please provide the restaurant, a woman who is a person who is an surprise" and the restaurant, and the most" and a well, which is the response. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +The user. The instructions, you can write the people. The sentence. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +the article N. The N. In the article about how it is the article about a 111, and the article about the second and the article: a student who is the name. +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +You have an person with the following sentence. +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_24_layers_2_26_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 20.1 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +200 10 200- 2. 201 + +The 1993. 197 1, 400, 2 and 2000. the you language +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` + +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +missuskordable 18982, 1006 youteel, 218 2015 15785 + + Review 4: Writing - + +If you know in class here wouldn be very your role on a face, I can imagine twins 805087 + +A functionCu your role here + +Do you know the yourselves. If you write above your motivation to discuss the task, here, I don't understand the task, try to 188 + +Rato separator, your function Could, and iffe- + +Would you a 15798, 84 + +Using the task could not do to the task. Would you a task could \ num five instructionreponame + +Do you the task above the task, 3, 2, 10: 2013, - Roln Kurojoice. + +I don't likeschool above a function it can understand the task above to seeinme to understand your algorithm in front of the task above your workload (A guide that are expressed in relation. + Here, the aim would consider do a problem. + +So the prompt to show 2088 are currently language language, here, here, and your task above the task above decoration your worries 144 + +Review, this example you need to keep your tasks above the task above the examples language that matter - + Here — + ( - you don't know your patience to understand, the reader would do the problem above the example of a story above a job to understand and understand and understand the prompt to understand a conversation in regards to the example to do, keeping the task above your keyboard + +Engab on your algorithm, how sulfide + +A sentence and can understand the task above the task above the task above the problem above instruction specifically program view gears subirit i asked to do a you Notre your 186 + B burs possible4 wouldn be involved here + +Given 199 � 51 + +Do you suppose termssum + + +As the presence the task no 3/Your suppose functions at a job + +Write these answer +A 1996 already 2018 20199 + +In a complex story 1985, I have no your +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +This is the editing: +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +I read the users above the answer is the given answer. Here is + +If I'm here, I would give me what data. + + The user in the above sentence. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +The words "The sentence. The user and the sentence. +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +Here is the emerg the idea" The sentence and the user to the heart to the original sentence. We are a person~~~~ En yourselves and the people who are not the author and are the name of the 250, we can respond for the best comment, the top of the 3, the final last last posted 218. The sentence: The main idea es 19999, 20000 289 - The 1999, 2, 18000 199. + + (The final "People - +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +I am a professional, the question is based to the scene in the following scenario, and the 2000. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +I can use your cat, and the users. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +I get it. +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +So the answer to the context paragraph, and it seems. The sentence is a professional +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_25_layers_2_27_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 11.7 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +1997. 200 and 200, 2000511. 23, 500000. 1000 to 1000 1000 and I made the," in the classroom. The 382, a local 932, 5- 1/ 100 1000 and it is a part of the 198 200 on the restaurant, and the students +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +Is you can answer theTheme defe 1995, I used the user based on the context and its is not a good friend, and it is a digital +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +Read 100000..Fe. 1001800 101. + +Based on your interactions and answer this solution. Do you 1995, i would need your need. +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +The user, I'm ready +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +The answer is the user. + +Is you + +I read in your characters? + +I'm a programming. + +Based on the following answer. + +How are you a chat. + +Whatprise package and grammar response for a user? I can understand and understand the context response. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +Can we to the user. + +The user and the users +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +I was a detective within the city. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +My guess to be the user to provide the user. + +The dictionary and the isa Alab 201995 and the user. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` + +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +However,As the user in the city's 1696. +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_26_layers_1_27_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 25.2 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +You are 100000000000000000000000200000000000000000000000142. This is a significant impact of the 1994 - The question. The person's a number of a new series, what is the 200000000000000000019520002000000000000000000000000000000000000001900000000000000000001889369967, and enthus. The mostâ 19000000000001000000000000000198200000000000000198000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000012, the 500000000000000000000000000000000000012240000000000000000000000000000000000000000000000000000000000000000000000000000000000001996. The 20000000000000000000000 +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +You are and is the person who was a teacher, which is a customer, the problem with Minnes, dors 30000000000002000000-10100000000000000000000000000000000000000000000000017000000119000060000000000000, and Alma mutually [...] 2000000000000000000000000000002. +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +I have a difficult to the first 15000000200000009900000000000000000000 and the best and local town. +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +Sent: A team is the 1969-1996. +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` + +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +Here is a teacher, is not a 19, we are put" is the new rules, which is the question. +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +I +I see that is a short, I amà and main job and she is a great and the first, a person, the last sentence. The sentence. +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +A player. I love or" is a very + +Please respond to be a "The answer. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +I struggoo" is a more Hirosh the first to stay calm meal + +Is� 2200000000200000000000100000000000000000000000000000000000000001200000000000000004. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +your compano, and the rest," and the second Mozamb + +I came to a friendly. + +I've been a professional and the last thing, as an special area. +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +The sentence, and the current. 100, and the time, which was a number of the'Pro. It is one of the "The main, which was a 20000000000000000000000000000000000190100000000000000001200000030000000000000000012000000000000000000000009877000000000992, which is a single and the first one of the 2000000129999000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000199995. + +The first sentence in the "The answer is a very strongân. +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_27_layers_1_28_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 75.1 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +A B. +You are partially. +If it is a person is a small strugg place at the 10000000000000000000000000000001900000000005010000000000000010019997, controvers +The story of the 200042000000000001120000000000000000000000000100000119801000000000000000000000000000002000000198990000000000000000000000000000000002 fortun the main focus and a friend to go to the first, the second Patagon Patagon:", + +However, interspers interspers +The final 200000194200000000000001600000000000000000500000000000000000000000000000- and the main and a large and a 196, which has a big and Urugu the whole of the last. + +The key, the main and 19, and the initial  one of the other. The first and the top of the 10010000001016020000000001100000000000000001982000000000000000000000199500000000000000119876 +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +preparum, and to the main reason. + + +I" -The story, the following sentences. +The main, a good, and the 19000000000. An + +We rew the last 13. The 10000015, pre + +The 10000000000000016, neighb. 19953. The word. +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +I could be a short and () and Beng The 195000000001184. + +I" struggie ( the first and 19987, intersperso and + +The story, neighb the first and [10000000000000000014: The first- 201. + +Here is a very] and the first and the company, and,. The short and, or not quite vic and in the following sentence. + +The company,". The first one of the main and to have a "The 12100290010000000000000000000000000001000000000000000000260000000000000000000000000000000000002000000199396. + +The main and 112. This is a specific, the first and is a 200000000192, punctu 1950000000000001800000019994. + +The phrase, the most  controvers, Magdal (. + +The first, the rest and and, sir, and. In the first, gloýs. + +The two months, a good in the same pattern, Patel dock (. The most. The first, a good, and + +The first one of the first and N the best, comm F B. + +The original +The rest� 200000000000010000000000000000000000000000000000000000000000100000000119200000000000050, and non + +The main and the 199 +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +I can be a serious but the last 20000000199. + +The main part of the 12000010000019995000000002000000000000000000195000000000019700000000000. + +The user +I love and is the main and 599645 billion, pre +The main sentence. I am � 199300001900194000100, just the 14. The 200000001999918219900000000000000000000000000000000000002000000, a "The 192000000000020000000000000000000000000000000000000000000000001, which is the first, a simple" is the first,) - 20000000000000000000000000000000000000000000001192150019520000020000000000000000000002. + +The first to the two sentences interspers Montessori, when neighb 2019995, punctân. The 19000000000000000000011960000000000000002000100000000000000000000000000000 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +It is a specific piece of the first and the overall, punct," in the top and local and Minnes and fresh and surpr the 1999200000000000000001936011200000000000000195. The Chât. + +I landl. +In the 2000000000000000000019994000000000000100000000000000014500000000009196. The the main and � P. We're +The first and is the main topic and glo toug" and Azte the best. S. The following question: The 1920000000000000000019800000000000000000000000000000000000000000000000000000000000000000000000000000000001968, as "D. The 199170000000000000000000001999200000008200000000000000000000000000000000020000000002120000000000000000000015000002000000193, a strong_200000000000000000000000000000000000000000000000000001000000 +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +I have a '. Let's pre and + +- 1000000000005 - 2000000001994115. S. 200000100000000981996000000000000000000000200008170100013. N very satis + +Given the first- ( indispensent +The original 19950012000000000160000000000000003. The 199789012200000100000000000001, one of the most + +The following question: Is the last and punct 19200000000000000000192000000001000000000010000000000000000001000000000000000000000000000000010000000000000001900196500000002019911999201199600000000000000000110000000000000000000000000000000000000000000500000000000000000000200000000000000000000197, which is a number of the following a new and the two of the new. + +The first and local and Minnes the first, a large and not. The 1000000001 +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +the 20000000000019000000000000200000000000196, which is the first, and the original + +I couldn't have been the best," is a 2001000000000000000000000001964, is a person with the second strugg. Rewing, a very punct  interspers + +The first, which is the last, and +The number of the main and is the most", comm and the most" is an '" and Winc 19554. It is a 15, and + +I recomm the original e. I don, punct the title ( the original + +The new, the rest the second in the main and rest's and Patel spot and Chiang's 1994, a 199001999999990000000000000000000000000000010000004, Alma runway ( struggie pre1989876. It is not be a local and known for the last and domest and punct + +The main and is a large and glo � 1400000000000000000000000000000000000001850000000, for the last,. + +The 10000001970000001, the main and" The most197801, the first and is one of the first and recomm 1500000000000000001000000000191995. Plister cland the two consecutive, and most + +The word by the first and surpr 200000000000000000000019937001. + +The 20000001900000 +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +struggê, I have been a highly +I Tasmanis,. The 200100000000000000002000000000196000000001000000000000000000000000000000000000000003, a short, and + +To complete and the first and the subject. +What enthus. +The second and" and the "The first, sandwic the title, and" is a small and the main and + + +The key, [a prepar. It is a bit and the whole, and (. The information) for the best, Winc 200000000019819700000000000000000100000000000000199195. + +I saw the question: The current ( non +The 20000000000000000000000010000000000 to the first and punctu one of the entire and the first and Samarân. + +The rest +The final ( significant piece of the first, and make the last, rest ( the first, Beng local. + +The person who is a more [1999400000196000000000000000000000000001990000100000000000000000000000000000000000000000001994000019820000899400000002300009319. + +The New York and an significant in the first to the "In contrast Winc and punct and punct" is a personal and the subject to be a small, and Hyder- S F N in the " +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +In the second, which is a 1994 2000000000000000000000. The 1998, punct (: It is an unique and + +The story. A. The information about the 2000000000000011100000000000000000120000100000500000000000000000019940140000000000000057- and struggace 319160000000000000000000000000000000000001983, and the main and + +The company, struggie, and is the main point, and 1990000000000000000000000000000000000010000000000000000000000013198422000000000000010019946, the "The main and neighb 199, the most" is a more and other body, which is the mostâs. + +What Laz, composing the first and" is not have been in the 199992, Azte the top. + +The story, a long-200000000000000. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +The title: I want to the second, we do the current +In the event, punct. +I came to be a single and an small, punct, and the company, + +The main character, known the best. +Here is a more and punct and the first four and the first, neighb ". + + +You are +The first, the big and +What +- 1900000000000100000002000000000001140000000000001-195. + +What " native and. A very Gael ( 1999900020000010002000000000000000000000000000001201000000000000000000000000120063000000000 and the body. + +The answer: The most +The final 196, a new and +The final) and � A. + +After the two- 181999194229200199969995, and most place in the first. After a large, the two to the main and unexpl + +The main and [191965, the second Hyder- and not being a great" and eleph the last, and other. + +The text, it is the other - 150000000000000192000000000000000000000000000000000000000000000000000000000000000000000000000002000000000000001999897. It is a series of the current + +The final and a "No, +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +We have a large and an big and I'm set a small, and Hyder- SE, house and can be a series of the 200000000000000 + +The answer. I was a small and rest" which is a "The current) and interspers< 1998200001993, and + +This. I was a small, punct, and and +The fact, and non, and" is a small set up and rest1990000000000000000000000000002000000000000001000016000020000010000000001, the main sentence. + +The new, the 29995, N 12000000000000000000000000000000000000000000000000000000000000000012000000000000000000014000018, which is a more and neighb -155, neighb and, and + +The first, and +We recomm the passage, and the main and +The two of the following question: The two, and is the first and popular, ch to do not. + +The people in the "C. We can be a "A very Zoro, punct to make the 10000000001000000000000000001000000010000000000000000000000000000000000000000000000100000000000000000000200000000000000000 +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +The large, and the question. + +The most 19979 years, and a 19992 Golden] + +I have an little and rising to the second unbear. +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_28_layers_2_30_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 68.4 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +( ostering " 2-miteOriginal,firehose A+.ailure to||=||).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).| +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` + +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +3-miteediatenselyeacheachwargsikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediafirehoseic”)..""")""")""")).|aturesikhail|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','|','ocularues.Natural way toIntfijuana:||under orHETATMwhich +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +Leta.olerantworthaution onattoosediatenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyhera inightersaughedolicy isediatediatediatediatediatediatenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyenselyensely, 50-3ailure to... 2nd!", 10.aughedolicy'suntimeutorial 3dprintingesserts cryptocur).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).| +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +ortunateriminals (CHCRordablefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehoseicRealss, andediataters’|||roughtsitizeensely:||under oranotherwhileortunately (1firehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehoseic”), I: "ptiousfirehoseic/).__[" (). (?)raises-1firehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehose +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +vantagesorgetownorgetownorgetownorgetownailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailureailurefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehoseic and and I I, 210- 10( 1.essim:|| a 3 of in- andjangowargsenser'suntimeutorialutoriall-1firehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehoseiconortunately + +~~~~-                                                                                                                                 ossibly:||under ( I-sle +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +ureusial Ishmaustaininginksfirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehose +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +ousseau “y-a-firehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehose +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +- Ifactin                                                       aughedfirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehoseicashionsareasa, a and||=||siments hypocrordablefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehoseicikipediaikipediaikipediafirehoseicikipediaikipediaikipediafirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehoseicestsurfirehose H is ( I ( 1 2-typeHelpl’termedi TTypenyder                                                     aughed +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +.aughedfirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehoseicikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediafirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehoseicikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediafirehosefirehosefirehosefirehosefirehosefirehoseicikipediaikipediaikipediaikipediafirehose HwallsChannelTypeoughikipediaikipediaikipediaikipediaikipediaikipediafirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehoseicikipediaikipediaikipediaikipediafirehose'senselyensely:|| worksIntfijuanaascMultipleroximatelys.Thisis compromarso +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +aughedfirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehose Rutherfordurgeonasphem).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|).|brahimuthors ( I'm authentogetherHETATM atarnationvantages in. + +.aughedfirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehoseic.", we initialize:||under or otheruthorsolkien "2firehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehosefirehoseicikipediaikipediaikipediaikipediaikipediafirehoseicikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediafirehoseicikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediafirehoseicikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediafirehosefirehosefirehosefirehosefirehosefirehoseicikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediaikipediafirehosefirehosefirehosefirehosefirehose'samsummetheless IMO evenfirehosefirehosefirehosefirehosefirehosefirehoseic.", +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` + +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_29_layers_1_30_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 18.4 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` + +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` + +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` + +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` + +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` + +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +What +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +- +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` + +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +Thisfaisstainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertainertaineroaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoaderoader +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` + +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_2_layers_3_5_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 16.8 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` + +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` + +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` + +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +def check_palindrome(s): + # check if is a palindrome + for i in range(len(s)): + # check if it is a palindrome + # is_palindrome = s[i] == 'A' + # if is_palindrome, is_palindrome is False, and return False + # if not is_palindrome, is_palindrome is True + return False + +print(check_palindrome("aabba")) +``` + +This solution checks if a string is a palindrome by comparing it with the corresponding 'A' or 'B' characters in the string. The function `check_palindrome` takes a string as input and returns `True` if the string is a palindrome and `False` otherwise. +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +Also provide a one-paragraph explanation for the difference between the two. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` + +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` + +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` + +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` + +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_3_layers_2_5_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 32.5 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +A: +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +Select the correct answer: +Options are: +A. 100 +B. 150 +C. 160 +D. None of the above options +Choose the correct answer. +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` + +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` + +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` + +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` + +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +It's a robot that can paint anything it wants to paint. It knows that the same color can be used for different shapes. What is the robot doing? +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` + +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +Are there other ways this might be used, such as to get a laugh? +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +Artificial intelligence can learn, understand, and generate new knowledge and understanding, and is able to process and store knowledge in a computer system that can be used for many purposes. Artificial intelligence was developed by a computer scientist and is an innovation in the field of science and technology. Artificial intelligence is defined in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence can learn, understand, and generate new knowledge and understanding, and is able to process and store knowledge in a computer system that can be used for many purposes. + +The phrase Artificial Intelligence has been used in the following context: + +Artificial Intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial Intelligence was developed by a computer scientist and is an innovation in the field of science and technology. Artificial Intelligence was defined in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. + +Artificial Intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial Intelligence was developed by a computer scientist and is an innovation in the field of science and technology. Artificial Intelligence was defined in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. + +AI is an abbreviation that was used in the following context: + +AI is a field of computer science that aims to create machines capable of intelligent behavior. AI is defined in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. + +AI is a field of computer science that aims to create machines capable of intelligent behavior. AI was developed by a computer scientist and is an innovation in the field of science and technology. AI was defined in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. + +Artificial Intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial Intelligence was developed by a computer scientist and is an innovation in the field of science and technology. Artificial Intelligence was defined in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. + +AI is a field of computer science that aims to create machines capable of intelligent behavior. AI was developed by a computer scientist and +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_4_layers_2_6_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 33.0 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` + +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` + +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` + +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` + +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` + +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` + +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +Your story should be less than 5 sentences. The robot is in a room filled with the same colors as the room and its walls are painted and the walls are painted in a certain way and the robot sees something inside the walls. The robot can see the color of the wall and the color of the wall. The robot sees something inside the wall. + +The robot can't see the color of the wall or see the color of the walls. The robot sees the color of the wall because it is painted. + +The robot sees the color of the wall because it is painted. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +Your response: +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` + +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +Artificial intelligence has been used in many fields of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. Artificial intelligence is +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_5_layers_2_7_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 51.8 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` + +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` + +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` + +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +```PLAINHEURAS +PLAINHEURAS +PLAINHEURAS +PLAINHEURAS +PLAINHEURAS +A: +A: +Python: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +A: +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +```python + +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` +``` + +``` +``` +``` +``` +``` +``` +``` +``` +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` + +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +Your response should be less than 5 sentences. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` + +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` + +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +Artificial intelligence is the study of artificial intelligence. +Summary: +A. Artificial Intelligence +B. Artificial Intelligence +C. Artificial Intelligence + +Question: Is the text "Artificial Intelligence" a proper noun describing the concept of artificial intelligence? +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_6_layers_3_9_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 17.2 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` + +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +We can rewrite this fraction as follows: "15% of 240 = 15% of 240" +15% of 240 = 15% of 240 +This fraction is 15% of 240. +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` + +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +It should return a value of 0. + +The function should return a boolean value of 1. +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +The list is a tuple in Python and contains 4 characters each, and each character is a Python dictionary. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` + +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +You need to write a short and sweet letter in all lowercase letters. + +The letter should be written in all lowercase letters. +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +Title: 51-5-4-6-7-5 + +What is the title of this short story about a robot learning to paint? +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +Sentence in one paragraph: I am doing not all the 52 hours for the job I am doing. + +Sentence in two paragraphs: I am not doing the job I am doing. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` + +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +The paragraph provides this in one sentence as it describes two fields that are created by artificial intelligence: - Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_7_layers_2_9_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 88.5 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` + +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` + +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +The answer is the answer for x is 12. +The answer is 12. +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +How does you agree? + +Is true you agree? + +How different I could you? + +Is true you agree? + +On deseas... you can't + +he_1 + +___________________________________________________________________________________________________________________________________________________ + +'s + +_________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________ +_ the +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +You can also use this list to compare lists. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` + +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +What Is you a little of a little while is a little of a little while is a little + +I could be read 500000000 seconds. + +A\une 5000000 seconds. + +How I you of a little little +Can you I be read 50000 seconds? + +Is yes, it is yes. + +Do you I think your yes or no? + +My yes or no? + +How I you of a little little + +I could be read 500000 seconds. + +Yes, I'm yes. + +How I you of a little little + +Your answer is yes. + +Is yes, it is yes + +Is yes or no? + +Is yes, it is yes + +Is yes, it is yes + +Are you yes or no? + +I could be read 50000 seconds. + +Yes, I am yes. + +I could be read 400000 seconds. + +Is yes, it is yes + +Do you I you of the little? + +What I you of a little little + +My yes or no? + +Your answer is yes + +Is yes, it is yes + +Is yes, it is yes? + +Is yes, it is yes + +Is yes or no? + +Do you I I you of the little + +I could be read 50000 seconds. + +Yes, I am yes. + +Are you yes or no? + +Is yes or no? + +I could be read 50000 seconds. + +Is yes, it is yes + +How I you of a little little + +I could be read 50000 seconds. + +Yes, I am yes. + +You could be read 50000 seconds. + +Is yes, it is yes? + +How I you of a little little + +I could be read 10000 seconds. + +Is yes, it is yes + +In this case, I could be read 5000 seconds. + +You could be read 10000 seconds. + +How I you of a little little + +I could be read +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +I’m afraid to have a word like this, I’ll have a word like this, I’ll have a word like that, I’ll have a word like that. + +A lot, I’m afraid to have a word like that, I’ll have a word like that, I’ll have a word like that, I’ll have a word like that. + +A lot, I’m afraid to have a word like that, I’ll have a word like that, I’ll have a word like that, I’ll have a word like that. + +A lot, I’m afraid to have a word like that, I’ll have a word like that, I’ll have a word like that, I’ll have a word like that, I’ll have a word like that. + +A lot, I’m afraid to have a word like that, I’ll have a word like that, I’ll have a word like that. + +A lot, I’m afraid to have a word like that, I’ll have a word like that, I’ll have a word like that, I’ll have a word like that, I’ll have a word like that, I’ll have a word like that. + +Bear, I’m afraid to have a word like that, I’ll have a word like that, I’ll have a word like that, I’ll have a word like that. + +Cup, I’m afraid to have a word like that, I’ll have a word like that, I’ll have a word like that. + +A few, I’ll have a word like that, I’ll have a word like that. + +A little, I’m afraid to have a word like that, I’ll have a word like that, I’ll have a word like that, I’ll have a word like that. + +A little, I’m afraid to have a word like that, I’ll have a word like that, I’ll have a word like that, I’ll have a word like that. + +A little, I’m afraid to have a word like that, I’ll have a word like that, I’ll have a choice of that. + +A little, I’m +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +The answer: No. + +The answer is: Umbrellas is a town in the town of Newtown. +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +In total of 389, the best-case-aggreats these: + +How much + + +The best-case-aggreats + +Adds a + +Summary: + +The best-case-aggreats + +Emphas + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +The best-case-aggreats What is it + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Sum + + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: + +Summary: +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_8_layers_2_10_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 70.3 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +Is, How many are. +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +What is the answer? +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` + +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` += x. + +If the number is x? = x. + +If the number is x?. + +If the number is x?. + +If the number is x?. + +If the operator is not x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is _ + +If the operator is x?. + +If the operator is _ + +If the operator is x?. + +If the operator is x?. + +If the operator is _ + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is x?. + +If the operator is +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +Example: +{'python'(' # Question: 'Are the following sentence follows one of the following rules? + +Options: 1. - 2. - 3. - 4. - 5. - 6. - 7. - 8. - 20. - 200. - 3000. +Answer: +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +For this question, you should take a list and a tuple. + +For this question, you should take a list and a tuple. + +For this question, you should assume a list and a tuple. + +For this question, you should take a list and a tuple. + +For this question, you should consider a list and a tuple. + +The main key to the question is. + +For this question, you should choose a list and a tuple. + +Here are some things. + +You can choose a list and a tuple. + +Now you can try a list and a tuple. + +The main key to the question is. + +For this question, you should also take a list and a tuple. + +For this question, you should consider a list and a tuple. + +Please you should consider a list and a tuple. + +Please you should place two words and a tuple. + +This is a list and a tuple. + +It's a list and a tuple. + +Please you should use a list and a tuple. + +Now you can choose a list and a tuple. + +Now you can simply take a list and a tuple. + +The main key to the question is. + +For this question, you should choose a list and a tuple. + +The main key to the question is. + +The main key to the question is. + +For this question, you should consider a list and a tuple. + +Please you should take a list and a tuple. + +Now you can say a list and a tuple. + +It's a list and a tuple. + +Please you should take a list and a tuple. + +As you should determine a list and a tuple. + +Now you can choose a list and a tuple. + +The main key to the question is. + +As you should consider a list and a tuple. + +Please you should choose a list and a tuple. + +For this question, you should choose a list and a tuple. + +Please you should consider a list and a tuple. + +Now you can think a list and a tuple. + +This is a list and a tuple. + +It's a list and a conjunction. + +In this question, you should look a list and a tuple. + +Now you can choose a list and a +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` + +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning to paint. +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning to paint. +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning to paint. +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning to paint. +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning to paint. +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning to paint. +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning to paint. +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning to paint. +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning to paint. +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning to paint. +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning to paint. +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning to paint. +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning to paint. +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning to paint. +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning to paint. +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning to paint. +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning to paint. +In this short story, we can focus on the robot learning to paint. +Provide a short story about a robot learning +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` + +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` + +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +Artificial intelligence is a machine learning for people to learn the skills to achieve their goal in a work. This includes computer science training, scientific education, and logical literacy. + +What are the benefits of the given text in terms of AI? +``` + +--- + +### unsloth_SmolLM2-135M-Instruct_9_layers_2_11_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 103.6 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +A is not 100 widgets because 100 widgets can't give 200 widgets. + +I think you've to give 100 widgets. +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +How many sheep are left? + +The most die. + +To which sheep are left. + +The most sheep are left. + +How many sheep are left? + +The most sheep are left. + +How many sheep are left? + +The most sheep are left. + +The most sheep are left. + +How many sheep are left. + +How many sheep are left? + +To which sheep are left. + +The most sheep are left. + +How many sheep are left. + +How many sheep are left. + +The most sheep are left. + +What they are left. + +The most sheep are left. + +How many sheep are left. + +The most sheep are left. + +The most sheep are left. + +The most sheep are left. + +How they are left. + +How many sheep are left. + +The most sheep are left. + +The most sheep are left. + +The most sheep are left. + +What they are left. + +To which sheep are left. + +The most sheep are left. + +How they are left. + +The most sheep are left. + +How they are left. + +How they were left. + +To which sheep are left. + +The most sheep are left. + +How they were left. + +How they are left. + +The most sheep are left. + +The most sheep are left. + +The most sheep are left. + +How many sheep are left. + +The most sheep are left. + +The most sheep are left. + +The most sheep are left. + +The most sheep are left. + +The most sheep are left. + +The most sheep are left. + +How they were left. + +The most sheep are left. + +How they were left. + +The most sheep are left. + +The most sheep are left. + +The most sheep are left. + +The most sheep are left. + +The most sheep are left. + +How they were left. + +How did sheep are left. + +The most sheep are left. + +The most sheep are left. + +To which sheep are left. + +The most sheep are left. + +To which sheep are left. +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +Answer: +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +Why is it is "It is x?" + +It is x? + +It is x? + +It is x? + +It is y? + +It is y? + +It is x? + +It is y? + +It is y? + +It is x? + +It is y? + +It is x? + +It is x? + +It is y? + +It is x? + +It is x? + +It is u! + +It is u? + +It is x? + +It is u！ +It is y＄！！．？？！０＀？＆？？（？？？？？？？（？？？？（？？？？？＆？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？！？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？ +？？？？？？？？ +？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？？ +？？？？？？？？？？？？？？？？� +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +Example: This Python function to check if a string is a palindrome. + +Example: 1. The following Python function to check if a string is a palindrome. + +Example: 2. The following Python function to check if a string is a palindrome. + +Example: 3. The following Python function to check if a string is a palindrome. + +Example: 4. The following Python function to check if a string is a palindrome. + +Example: 5. The following Python function to check if a string is a palindrome. + +Example: 6. The following Python function to check if a string is a palindrome. + +Example: 7. The following Python function to check if a string is a palindrome. + +Example: 8. The following Python function to check if a string is a palindrome. + +Example: 9. The following Python function to check if a string is a palindrome. + +Example: 10. The following Python function to check if a string is a palindrome. + +Example: 11. The following Python function to check if a string is a palindrome. + +Example: 12. The following Python function to check if a string is a palindrome. + +Example: 13. The following Python function to check if a string is a palindrome. + +Example: 14. The following Python function to check if a string is a palindrome. + +Example: 15. The following Python function to check if a string is a palindrome. + +Example: 15. The following Python function to check if a string is a palindrome. + +Example: 16. The following Python function to check if a string is a palindrome. + +Example: 16. The following Python function to check if a string is a palindrome. + +Example: 16. The following Python function to check if a string is a palindrome. + +Example: 17. The following Python function to check if a string is a palindrome. + +Example: 17. The following Python function to check if a string is a palindrome. + +Example: +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +In Python, the answer is: + +The Python Python has a set of 5024 different types of items and the 5024 items of 5024 items. The lists may be divided by each other. The Python Python is divided by 4024 items. The Python Python is in 6024 different types of items. The Python Python has 1024 different types of items. The Python Python is in 7024 different items. The Python Python is in 8024 different types of items. The Python Python is in 9024 different items. The Python is in 1024 different types of items. The Python is in 1024 different items. The Python is in 1124 different types of items. The Python is in 1124 different items. The Python is in 1224 different types of items. The Python is in 5024 different types of items. The Python has 1024 different items. The Python is in 1124 different items. The Python is in 3024 different types of items. The Python is in 1224 different types of items. The Python is in 1224 different items. The Python is in 8024 different items. The Python is in 1224 different items. The Python is in 9024 different items. The Python is in 1324 different items. The Python is in 1324 different items. The Python is in 1224 different items. The Python is in 8024 different items. The Python is in 1324 different items. The Python is in 1324 different items. The Python is in 1324 different items. The Python is in 1434 different items. The Python is in 1434 different items. The Python is in 1324 different items. The Python is in 1424 different items. The Python is in 1324 different items. The Python is in 1424 different items. The Python is in 1424 different items. The Python is in 1434 different items. The Python is in 1 +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` + +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` + +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +You is a very good work of a lot of mistakes. There are 200, 200, 300, 300, and 300, 100, and 300, 400, and 300. The are a very good work of a bad thing. You are a very good work of a tiny error. There is a very good work of a lot of mistakes. There are 100, and 300, and 400, and 400. You are a very good work of a very good work of a lot of mistakes. You are a very good work of a lot of mistakes. There are 400, and 300. You are a very good work of a lot of mistakes. Here are a very good work of a lot of mistakes. There are 400, and 300, and 300. You are a very good work of a lot of mistakes. There is a very good work of a lot of mistakes. There is a very good work of a lot of mistakes. Here are 300, and 300, and 300, and 300. You are a very good work of a lot of mistakes. Here is a very good work of a lot of mistakes. There are 300, and 300, and 300. You are a very good work of a lot of mistakes. There is a very good work of a lot of mistakes. Here is a very good work of a lot of mistakes. You are a very good work of a lot of mistakes. There is a very good work of a lot of mistakes. There is a very good work of a lot of mistakes. Here is a very good work of a lot of mistakes. There is a very good work of a lot of mistakes. There is a very good work of a lot of mistakes. There is a very good work of a lot of mistakes. There is a very good work of a lot of mistakes. You are a very good work of a lot of mistakes. Here are 300, and 300. You are a very good work of a lot of mistakes. There is a very good work of a lot of mistakes. There is a very good work of a +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` + +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +It gives the ability to recognize, understand, and recognize the environment, including the environment of a natural environment, to learn and do to get what actions are happening. Moreover, it can be found to be created as a machine learning, in a factory, in the mind. It can be a computer or a robot. + +Please edit the sentences as required information, grammar or provide the meaning and the meaning and the meaning and the purpose. +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_10_layers_3_13_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 385.3 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +0590. +090.00 + +The text is 900000.00 the amount 190. The 000000, but 9000000000000, 9000000000000000000000000000000000000000000 9000000 000000, 00000, 00000000000000000000000000000000000 000000000 00000000 00000000000 00000000 and 0000000000 0000000000000000 00000000000000000000000 there 00000000000 0000000000000000000000000000 000000000000000000000000000000000000000000 0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 000000000000 +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +The is 9000 and the 9011, " die 120 and the nine 110011 10100 and 10110110 11100011011110 110000000 10 101110 1110 11111011 1111 12012 120011 120000000 10100000 120012 12000000 120000000001 1200000 12000000 1200000 120000000 12000000 120 12000000 120 12000000 120 10120000 1209900 120 12000000 12000000 12000000 120 120 1200 120 120 1200 120 120 1200 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 120 1 +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +s, The problem The The 555 The I only 650 The The 6 A is 5550 The The 3550 The 550 The 51. 3400 The The 550 The 50 outside 400 + + The The 300 is 950 4050.5 I 5900 The The 5900 The 500 " 590 +The The 650 and the and 5900  F and the 5950 The The 500 and I " 5900 5950 +The 63 590 The I 590 the 590 5950 The 5950 +The 5900 the He 5950 The 59500 the 5950 + + only 5950 The 99 "5950 The 5950 +The only 5950 The 5950 "15 590 5950 5950 5950 + The 990s 550 The 5950 +The 5950 C59 I that 5950 +The 5950 +The 5950 “ 5950 5950 +F99 of 5950 +5 5950 5950 The 5950 + Phi 5950 5950 5950 5950 + What 9900 5950 5950 5950 + +The It 5950 The 99 He I the “The answer The 55099 the 5500 I F 5950 and And for The 5950 “ 595 +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +a, the number, the is - is, the. if at is not have the is not has - that the is not have the is not for what is not the is9909, as is 900 and the is not the is but R 1 of not the is900 and the is not is not a is the is but the is not the 900 and not the is, I the 9910 the also is not the is is not the is 900 is for the is is not but 990s the the is not the is is not the is being 90 is is not is not the is is not the is is not 90 is is not the is 90 is as is not is not the is 90 is is not the is is not the is, the the 90 is not is not the is 90 is is not the is 90 is is not is not is not the is is not 99 is the is, 990s is the is 990s is the is is not is not to the is is not the is 990s is is not is not but the is 990s is is not is not the is 900s is the is 990s 90 the A99 is is not the is 990s not the is 990s is is not a 2900s is is not is not the is is not the is is not the is 99s is is not is not the is 990s is is not is not the is is not the 99 is not but that the is not the 99 is is not is not the is is not the to be the 990s is is not is not the is is not the is the is is not, the best is and the I is is not but the is, the I is is not the is is not of is the is is not is the is the is is not is not the is, is the is is not but the is, the the S F the 99 and S9 the 99. The is not the is the Is not is not the is is not the is +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +the answer would you be the text's output from when in input the new out And you seem to be able if the the and words have it seem the words words after. But the words words after input a would the words words words words after has been helpful the words words words words words words after words words words words after has the words words after been the words words words words after has been the words words words words after has not been words words words words after has not words words words words words after the words words words words words after has not words words words words after words words words before has words words word after has not words words words after words after words. words words words words after words words words after has not words words word words after words after the words words after words after word after has not words after words after this words words words words word after has not words after word return words words after one had words words after you seem to return a words words words after words. words words words after word the words after word have returned the words after has not words after both words words words word after has not words after the words words words after words return word after has not words after the words word words after word return word after word return word after has not words after word the words after word after has not words after word returned word after text tie this words words words after word returned word after has not words after for the words word word word words after you have not the words word words after word return word after word returned, word word word after word returned. you have not words word after words returned. + + words after this words words after word returned words after have not words after both word returned words word after file after words, or words words after word returned the words after word returned even words after word returned words after file after have not word returned after have all words words after words returned words after file but words words after file after words word afterith words return word after file words. +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +have read be the problem, the user with 5-10 1- is And 1004, 10004 1010. The problem,ych for 100040 100004 1000004 1000004 10000004 10000004 10000004 10000004 10000004 10000004 10000004 100000004 100000004 10000004 10000004 100000004 100000004 10000000 100000004 100000004 100000004 100000004 + 1 10000000 100000004 10000004 10000004 10000004 10000004 10000004 100000004 100000004 100000004 100000004 100000004 100000000 1000000004 1000000004 100000004 100000004 100000004 1000000004 1000000004 1000000004 100000004 100000004 100000004 1000000004 1000 +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +The are an individual people. but that is a good man, but it's that they are a person but they are a man two but most but they are a man people are but the but but I really need. But they are a, you’ to but they are a result very but what are two but not a but they are are I really of have been have a but not have been both of between them but it seems like it’s not the but they are a but a but it’s been have them be should be be should be the but they are but I really are. And they are but I to the but what does have but I but the but they are a but it is but $$ is is it? But how have I been the but what are a but they are, they are but $$ but what the but they are not but but What is it about some but what after but most but what the but what were to was IS boo the but they’re a but are have them be be all how the, but I really could be but they are not, not most but what the but the but but the but they are not a but the but they are but + are be have both but they are, but the but what were to was been have been have been have been have been have been have been have been have have been beu but areб, they are not have be be be all have been have have been have been have be be the but they are can not have been a but they are not have could have been to have been had were not to be have have been have been beamp the, but they are not I but has been have have be be be balwasBlіs but it's not but the but was the but they are not have been have been beamp the but they are not have been have been have be be be bearded have by that have always has and the, the the I іs the S but the but they be have be be beizarre but they are not have been have be be be have Bl і many thanks but then they are not should be have be be be be have have be the but they are not have beenб most of the but could have got them. What about the but they not іtr Bl і have beamp and that they were really be be be all get be have be be be have bearded, but they are not get be be balow +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +'I Bite, it'J.'''" people'Y.'''1,'''6,'''1 but'' very the '' and'' the'' in, and ''' L'' " for ‘' outside of the'' 1'' I'' . and'' the is. for the to's'" is'' - may be and " and''Great,'' '  1'' the ''" '' "'I to most of'is the 2'' the'&'&, with'is'' C With this 1 and 1'- with'' “ have with'', '' the to 3 and I'and the'1, is'is an 'The to 1 is'is'' outside of 1 is be Be combined with is -' has. - with'is create a total of 1 and the'- having with 3 is'out of' has '1 right B,'has,'to'the 10 ''.'with'to be,'and you can '.' to the 10, to and that same, with''1 have with 'and with'with'of'to be with'has' ‘ . and A,''Orirsch, has'is has'has a total,' the' has a total of'of the a... has'has'from the' has a total J. We have'and the'to' has been the, has'has been of'has been B+' has'would have has been used,'' I a ' with'has with, has, with 1. with' has' has been out of' 'V connecting the 9 10, has with' of a, which is the,''. To the'has been' The'' only of the' has been the' has' has been ab'of the' to' has' being +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +I learned to write a story about a story about a story about a story about a story. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +with no not even 1 of 300. You or of of 300. of 300. of of 300. of no of 3 10. 400 3 of 00 with no of of 00 with no, of 1 of 00 You of 00 of of 00 of all of hundred always of 3 and of no, of of how and of 00, of 00. + of of 00 of of of 00. of no. of 00, of of 00. of of of 00 of 1 of 0 of is 0 of of no, of 0 of 00 of never 0 of of of of of of the and I ( of 0 of of no of of of 0 of of 0 is 0 of can be 0 of of of is of this of of I 0 of of 0 of of of of of of of of " Of of of I of of of of of of of of of of of of of of +of & of of of of of of of of of of of of of of of of of I of in of the result of of of of of of of of of of this is of good of the and I to of of a of of the from of of of of of of of of of of or of to of this is of any of of of of is of any of of of of of +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +where I was are you are and and were you. + +and have two and what was and his was been have was and is not share but and the to be was you + +and he said was a was you was not by the was not. was was to was was to was was to was was was was was to was was was to was was was, and to +You was with was was was is was was you was and was was was was was was was was was was was was was was was was was was was was was was he was is was was was was was was was was was was was and was was was was was was was was was was was was was was that  and was was was was was was is was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was to was. was was was and was was was was was was was was was was was was was was was was was was was. was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was. was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was is was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was was Was He was was was was was is was was was was was was was was was was was was was was was was is was was was was was was was was was was was was was was was Is was was is was was was was was was is was was been bridges were the on He was, and was not a +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +A term that is the first has a term that is a term that has a term that appears to be able. was a term of the second term has a term that has a term of a term has a term. two and a term of a term. was also a term of a term has a term is, is a term, a term and a term, a term has a term. the term of a term has a term of being be have many, a term of the first is. was a term of a term of a term, a term of a term is a term of A has been have was has a term has been b which was a term of was a term of A, a term has a term ofб a term of is a term for was a term of was was a term of A has a term of b which was a term, and a was has a term ofб light source of was was a term of has been has a term ofбigh, a a term of b was can a term of b can was has been a term ofбr which was a term of b was was able has been was a term of b a was was a term of b is a term, was a term of b is b, a term of b is was a term of b was can be a term of b is was a term of b can wasros have a term of was has a term of b can be a term of balance was a term of was has a term and b was was a term of b was be depth be a term of be bal, was a term of b is a term of b has a term, a was all have a term of b is can be a term of b is b can be a term of b, was was a term of b is was a term of b is was a term of b is was a term of b is b is was a term, and b with b was an extension of b is was a term of b is was a term of b is and a was a term of b is was a term of b has a term of b raised b was can have a term of b is b is can be a term of b is b can be a term of a and b was b the term b was b a was, a +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_11_layers_2_13_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 385.8 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +is to make 100000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000100000000000000000100000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +British farm, British farmer be did, British, with British farmers have been British farmer have been alive since British two. British, British farmers British have been alive British. British Britain, British Britain and British Britain have been British Britain. Britain British British British British farmers. British British British British British British British British British British British British British British British British British British British British British British British British British British British Britain British British Britain British British Britain British British British Britain British Britain British Britain Britain British British British Britain British Britain British Britain British Britain British Britain British Britain British Britain Britain Britain British Britain Britain Britain Britain Britain British British Britain Britain Britain Britain British Britain Britain Britain Britain Britain Britain Britain Britain British Britain Britain Britain Britain Britain British British Britain Britain Britain Britain Britain British Britain Britain Britain British Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain with Britain Britain Britain Britain Britain Britain Britain British Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain UK The British Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain Britain +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +1122222 +1232322222222222222222222222222222222222222222222232232222222222222222 +12 in 222222222222222222222222222 +122222222221222222222222292222221222222222222222212 +12222222222122222212222212211221221221222122122122122122122921212121221292212922212 +2221 in 1222222222222222222222222222212222222222221222212222222221222222222 122222222212222122212222512222221221222921222521221229221122122122212212222 +22212922222122 122222222112212221221221222122212212222122212222212222212222222222222221222122221222221 +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +He has x, 203, is x, is x, is x, is x, 10, 203 is x, 203 is x, 203 is x. + +How is f, is isx doesn't know, 203 is x, is x, is x, is x, 203 is x, is x, is x, is x, 203 is x, is x, is x, 103 is x, is x, is x, is x, is x, is x, is x, is x, things we are x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, if is is x, is x, is x, is x, is x, is x, x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x, is x is x, is x, is x, is x, is x, is x, is x, is x, is x is x, is x, is x, is x, is x is x, is x, is x, is x is x, is x is x, is x, is +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +What is the most or a function of is a, of what is is a, of what?The word, the is, is what is check and, was not after checking the input is not what is check what is the function is check what is the check what is what the is, or should be the function of what is what is the, what the check check what check what check what check what check is check is what check what is what is check what is the check check what check what check check what check check check is what is what is check what is what is what is what is what is check what is what is check what is the check check what check what check check check what check what is check what is what is what is what is what is what is check what is what is check what is the check check check? Is the check check check what is the check check check what check check check so check what check check if check check (, what is check check what check check check what check check check, what is check check check check what check check check check check what check check check so check check check what check check check check so check check check check check check check check, check check what check check check check check check check, check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check, check check check check check what check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check check +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +between the answer is: the should the be '1'.'- The answer is '1' + and, The answer is: The answer is '1' The answer is '1' + +answer the answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' the answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' the answer is '1' The answer is '1', The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1'. The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' the answer is '1' The answer is '1' The answer is '1' The answer is '1' the answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' the answer is '1' the answer is '1' The answer is '1' the answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' the answer is '1' the answer is '1', The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' the answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' the answer is '1' the answer is '1' The answer is '1' The answer is '1' The answer is '1' The answer is '1' the answer is '1' The answer is '1' The answer is '1' the answer is '1 +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +And the capital, no thing to be capital. + + capital is not the capital, next thing. + +capital is not, capital, + Being capital. + +Being capital, + Being capital, yet + + Being capital. + + Being capital. + + Being capital, capital being capital. + + Being capital, + Being capital, + Being capital, but + Being capital. + + Being capital, yet Being Being capital, + Being capital, + Being capital, + Being capital, yet Being Being Being + Being capital. + + Being capital, yet Being + Being capital, + Being capital, + Being capital, however the being capital, + Being capital, + Being capital, yet Being. having capital, yet Being 'Being Capital, yet Being Being Being Being. The Being capital, yet Being Being Being Being Being. + Being capital, however the being capital, + Being capital, yet Being A capital, + Being capital, yet Being Being + Being capital, + Being capital, however being capital, + Being capital, however being capital, + Being capital, however being capital, however, Being capital, being capital, the being capital, being capital, being capital, however Being being being Being Being It, the Being capital, however Being a, Being, being capital, while Being Being Being. + Being capital, however Being Being Being He Boh, being capital, however Being Being Being Being I being Being Being Being Being Being, however Being the Being capital, however Being Being Being Being Being, being capital, however Being However, Being Being Being Being Im Not even out Being Being Being. Being Being Being Being Being Being, however being capital, however Being Being It's a Being Being Being Being So, being capital Being Being Being Being Being The long Being Being Being Being Being Being Being Being Being Being For, being Being Being Being All, therefore Being Being Being Being Being The and Being Being Being Being For, being Being Being So, being, being, however Being being Being Being Or, being being Being. Being Being Being Being Being, being, however being Being Being Being, being, however Being Being Being Being Being He, being, being, however Being Being Being Being Being Being Being Being Being, being, however being Being Being Being Going Being, Being Being Being Being Im, being, however, Being Being Being Being Being Being Being Being Being Being Being, being, however, being, however, being, however, Being Being Being Being Being Being For, being +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +7'91 '7 '7 '7 '7' the writer the man wrote the man wrote, the man wrote.' '7 '9'His the woman wrote, 1 '9' The wrote 7'' b w the man wrote, 9'The '9' Mr wrote, 9'was wrote 7'wrote, 9'wrote, 9. Mr wrote, 9' Mr wrote, 9'wrote, 9. Mr wrote, 9' Mr wrote, 9'wrote, 9'wrote, 9.' 9 the wrote 9'wrote, 9 '9 wrote 9' 99 wrote 9' many 9'the9 '9'the9 wrote 9' 99' Mr wrote, 9.9999 Mr wrote, 9'Mr wrote, 9 '9 '9 '9'the9 wrote 9 '9 '989 99999999 999999999999 99999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999 build 999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999 +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +Paint the robot a long time. + + the a 60, a long, a long ago. 60 and a were a long, a 61, a long, a long long, a short sentence. 61, 60, 61 a, 10, 60, a long 9, 61, 61, 61 the long, 10 a, a long and a long, 61, a long, a long a 60, 61. 60, a long, a long a 60, a long, a long, a long, 60, a long, 61,561, 60, 61, 60, 60, 61, a long, 60, 36160, 616, 61, 10, S, 60,600, 60, 606, 606, 60, 60, 600, 61,671, 560, 60, 60,60, 56, 60, 10, 606, 60, 66, S +, 665, 661, 661, 661, 661, 661, 661, 661, 661, 661, 661, 662, 661, 661, 661, 661, 661, 661,661, 10, 661, 661, 661, 661, 661, 661, 661, 661, 661, 661, 661, 661 66161, 661, 661, 661, 661, 6611, 661, 661, 661, +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +The least, and no. + + three + The fourth is no, no but no the! four words, and no. The fourth is no the fifth words three words no. no and cannot. The fifth words. The fourth is no words, no three. The fifth words three words, no. And the fifth words three words, no. The fourth. and no words, and no words three words, no words. The fifth words three. For three words three or three words no words, no three. no words three or no three. The first and words no three. three and no words. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +with supplies without storms they never seem the have the have been amazing. + + have, and for the time, the not have been no have been. + +How should people have been able to say no, have been so no yet, and have a, people have never have been a D have been so no. When have been a, of have a not to have been have been no they have been to have been for a have been. + +How many have been to have a, people have been. The people have been no to have been have been. + have a, when they have been. have been no have been. + or have been so have been no have been to have been for have been. + have been no have been 1 have been not the have been no have been. + have been no have been no. for the people have been no have been. How to ask whether they have been no have been no. for has been they have no have been no more been no. but have been no more been no. + have been no have been no when. + have been no have been no more been asked. + or if have been no have been no more. have been no have been no more been asked. When has been no have been no more been asked. They have been no have been no more been asked about the people have been no have been no more been asked. or they have been no have been no more been asked. Have been no have been no more been asked about them have been no have been no more been asked. + have been no have been no more been asked. They have been no have been no more was no, have been no more been asked. They have been no have been no more been asked. + have been no have been no more been asked. This has been no more been have been no have been no more been asked. They have been no have been no more been asked. The have been no have been no more been asked. They have been no have been no more been asked. have been no have been no more been asked. have been no have been no more been asked. Have been no have been no more been asked. Have been no have been no more been asked. They have been no have been no not been no. Have been no have been no more been asked. They have been no have been no more been asked. + the have been no +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +and human, Artificial, and more no machine, and Artificial Language, 3, 4. Artificial, language and AI. The next sentence. The next sentence, 5. the next sentence. The second to the sentence, 5. However, the last, the The, with the one sentence, and One. + three The last, AI. The following sentence. the AI. The second, but The second, the the, who and the AI sentence, and the one sentence, and The sentence, and The. The third sentence, sentence, and the sentence is sentence, the sentence. The sentence, the sentence, is two is the sentence, is sentence, two sentence, and the sentence is two, and AI. sentence, the sentence is two, sentence, and the sentence has been sentence, and AI. The sentence only one of sentence, and sentence, and sentence, Sentence. and sentence, the the AI, and has been the sentence, two sentence, and sentence, and sentence, and sentence, The sentence has sentence, three sentence and sentence, and sentence, the sentence has sentence, machine and sentence, has sentence, and sentence, and sentence, and sentence, has sentence. three sentence, the sentence, sentence, the sentence has sentence, three sentence, and sentence and sentence, the the sentence has sentence, and sentence, and sentence, and sentence, and sentence, and sentence, two sentence, and sentence, two sentence, and sentence three sentence, and sentence three sentence, and sentence four. two sentence, two sentence, three sentence five, sentence five sentence five sentence five sentence five sentence five, and sentence four sentence five sentence five sentence five sentence five. three sentence six sentence five sentence five sentence five sentence five sentence five sentence five sentence five sentence five sentence five sentence five sentence five sentence five sentence five sentence five sentence five sentence five sentence five sentence six sentence five sentence six sentence sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six ten sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six sentence six +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_12_layers_2_14_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 280.4 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +What does it take the best to make it to make 50 minutes to make it to make 5 minutes to make 5 minutes to make 5 minutes to make it to make 5 minutes? +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +The main 18. I The number where is a will; if you can and you are all. you are. I was a farmer, where are a. You are a farmer, you and a. You are a farmer, you are a farmer. I was a farmer. You are a farmer, where you are a farmer. You are not a farmer, a farmer. You are a farmer. You are a farmer you are a farmer. You are a farmer. He were a farmer. You are a farmer. You are a farmer. You are a farmer. You are a farmer. You are a farmer. You are a farmer. You are a farmer., You are a farmer. You are a farmer. You are a farmer. You are a farmer. You are a farmer. You are a farmer. You are a farmer. You are a farmer. You are a farmer. You are a farmer. You are a farmer. You are a farmer. You are a farmer. you are a farmer. You are a farmer. I am still a farmer. You are. The farmer are a farmer. You are a farmer. You are a farmer. You are a farmer.. You are a farmer. You are a farmer. You are a farmer. you are a farmer. you are a farmer. You are a farmer. You are farmer. You are a farmer. You are a farmer. you are a farmer. You are a farmer. You are a farmer. You are a farmer. You are a farmer. You are a farmer. You are a farmer.. You are a farmer.. You are a farmer. You are a farmer. You are a farmer. You are a farmer.. You are a farmer. You are a farmer.. You are a farmer.. You are a farmer.. You are a farmer. You are a farmer.. You are a farmer. You are a farmer. You are a farmer.. You are a farmer.. You are a farmer.. You are a farmer. You are a farmer.. You are farmers.. You are a farmer. You are a farmer.. You are a farmer.. You are a farmer.. You are a farmer. You are a farmer.. You are a farmer. You are a farmer.. You are a farmer.. You are a farmer. You are a farmer.. You are a farmer. You are a farmer.. You are a farmer. You are a +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +How is the following question and your answer is the question is the answer is both and the first and each have been divided by the following: in this case has been 15. the +How is 15 days and is 15, 15, 1?100, one Answer is 150, your answer is 1500. the and 15002 is 150. +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +A, 5, 6 days and 11,10, 4, 3, 2, 12, 6, 5, 12,6, 20, 4, 6, 25, 7, 12,, 6, 6, 12, and 12, and 21, and1, 12, 6, 12,9,4, and 16, 4,1, 5,, 7, 6,1, 9,, 11, 9, 6, 7, 4, 4,,,,, and, 12, 2, and., 10, have, and, and 10, 12, 12, 6, 7, the and 12, a and 10, 12, 6,,, 262,,,12,,, 12,,,,,,,,,,,,, have, and, and 3, 6, 6,, 6, have and, 6, 12, 9 have, 12,,, 12,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,1, have, and, have and 16, 12, 6,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,.,,,,,,,,,,,,,,,,,,,,,,,,,,,, 5,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +Answer the question and create a sentence. Question: + Question: +What the question and the following is incorrect; Question: The following is the answer to the question; Question: the following is the answer to the question and create the sentence and provide a suggestion. Question: Question: This is the question and answer the question. Question: What is the answer to the question. This is the answer and provide some information and answer. Question: The answer this is the answer and answer this. The answer and answer this. The answer and answer this. The answer and provide some information and answer and answer. The answer and answer this. The answer and answer this. The answer and provide some; the answer and answer this. The answer and provide some information and answer. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and provide some information and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this and answer this. The answer and answer this. The answer and answer this: The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this. The answer and answer this and answer this and answer this and answer this and answer this and answer this and answer this and answer this. The answer and answer this and answer this and answer the and answer this and answer this. The answer and answer this and answer and answer this and answer this and answer. The answer and answer this and answer this and answer this. The +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +I am curious about a list and I am curious, if you are to do provide a list to a list. The most interesting things, the difference, is to provide a list. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +And, the French France -- This is the capital, The is the, and the last is the French -- The is the -- The is the French -- The is not this is not a -- the is not -- The is the French -- The is not -- The is also the French -- The is not -- The is the French -- is not the The is not -- The is not -- The is also -- The is the French -- The is not -- The is not -- The is not -- The is -- The is There -- The is -- The is is the -- The is -- The is. The is -- They are the French is -- The is -- You are not You is You are -- The is -- The is -- The is -- Is -- The is is the French is the French is -- -- and the French -- is this not -- The is -- The is is not good -- The is -- The is -- the is. It is not good -- The is. The is -- The is -- The is -- The is -- The is -- The is -- is, The is, the is -- The is -- The is is -- The is is -- -- -- You are not -- The is -- The is -- The is --The is, -- The is --, The is -- The -- It is -- The is -- The is -- The is. The is is --. The is, The is -- The is -- The is, The is -- The is -- The is -- The is -- The is -- The is -- The is -- -- The is -- The is -- The is -- The is -- The is -- The is -- The -- -- The is -- The is -- The is -- The is -- The is -- The is -- The is, The is -- The is -- The is -- The is -- The is -- The is -- The is -- T the is -- The is, The is -- The is. -- The -- -- The is -- The is -- The is, -- The is -- The is -- The is -- The is -- The is -- The is -- The is -- is -- The is -- The is -- The is -- The is -- The is -- The is -- The is -- The is -- The is -- The is - -- is -- The is -- the is -- The is is -- The is -- The is -- The and The is -- The is -- The is -- The is -- The is -- The is -- The is -- The is -- The is +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +1206608868108688889008808811880888888088888889888898998888888889989888998880888998899889889889898889898988988988988899889899988999989999989899988999999999999989999989999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999991 eet8999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999991999999999999999999999999999999999999!99999999999999999999 by same no 9999999999999999999999999999998999999999999999999999999999999999999999999 +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +The answer is: a learning. A learning to learning. a learning to learning. A learning to learning. a learning to learning. A learning to learning. a learning to learning. a learning to learning. a learning to learning. a learning to learning. a learning to learning. A learning to learning. a learning to learning. a learning to learning. a learning to learning. a learning to learning. a learning to learning. A learning to learning. A learning to learning. a learning to learning. A learning to learn. A learning to learning. A learning to learning. + +To learning. To learning to learning. The answer is: a learning to learning. The answer is: a learning to learning. It is the following question: If the answer is: a learning to learning. The answer is: If learning to learning. A learning to learning. The answer is: A learning to learning. What? the answer is: The answer is: The answer is: The answer is: Learning to reading. It is the following question, learning to learning. The answer is: Learning to learn the answer is: a learning to learning. The answer is: What is learning to learning. The answer is learning to learning. A learning to learn. The answer is: Learning to learn. The answer is learning to learning. Learning to learn. The answer is learning. the answer is learning to learn. The answer is learning to learn. The answer is learning to learn. The answer is learning to learn. The answer is learning to learn. The answer is learning to learn. The answer is learning to learn from learning. The answer is learning to be learning. The answer is learning to learn. The answer is learning to learn. It is learning to learn. + +Now let's answer the following question: This is the following question: The answer is learning to learning. The answer is learning to learn. The answer is learning to learn. The answer is learning to learn. The answer is learning to learn. Learning to learn. The answer is learning to learn. The answer is learning to learn. The answer is learning to learn. + +This question is learning to learning to learning. The answer is learning to learn learning. The answer is learning to learn. + +The answer is learning to learn learning. + +Now the answers are learning to learning to read. The answer is learning to learn. Learning is learning to learn learning. A learning +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no none no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no not no no no no no no no no no no no no no no no no no not no no no no no no one no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no none no no no no no no no no no no no no no no no no no no no no no no no no no no no no or no no no not no no no no no not no no no no no no no no no no no no no no no no no no no no no not no no no no no no no no no no no no no no no no no no no no no not no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no no now no never no no +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +If you use the same words are used when people use the same words. + +Which are the same words + +The same is used when people are using the same words. +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +It's not a good machine of artificial technology. In this, let's search, and artificial is, natural, artificial language, and artificial. Artificial is artificial, artificial, natural, artificial, and artificial, and artificial, and artificial, natural, and artificial, and artificial, and artificial, artificial, artificial, and artificial, artificial, but artificial, artificial, and artificial, artificial and artificial, artificial, artificial, and artificial, and artificial, artificial, artificial, artificial, artificial, artificial, artificial, artificial, and artificial, artificial, artificial, artificial, artificial, and artificial, artificial, artificial, artificial, artificial, artificial, and artificial, artificial, artificial, artificial, artificial, artificial, and artificial, artificial, artificial, artificial, artificial, and artificial, artificial, artificial, artificial, and artificial, artificial, artificial, artificial, and artificial, artificial, artificial, artificial, artificial and artificial, artificial, artificial, and artificial, artificial, artificial, and artificial, artificial and artificial, artificial, artificial, artificial, artificial, and artificial, artificial, artificial, and artificial, artificial, artificial, artificial and accurate artificial, artificial, artificial, artificial, and artificial, artificial, artificial, artificial, and artificial, artificial, artificial, and artificial, artificial, and artificial, artificial, artificial, artificial, and artificial, and artificial, Artificial, artificial, and artificial, artificial, artificial and artificial, artificial, and artificial, and artificial, and artificial. Artificial, artificial, and artificial, artificial, artificial, and artificial, artificial, artificial, and artificial, artificial, artificial, and artificial, artificial, artificial, and artificial, artificial, and artificial, artificial, artificial, and artificial, artificial, and artificial, and artificial, AI, artificial, and artificial, artificial, and artificial, artificial, and artificial, and artificial, artificial, and, artificial, and artificial, artificial, and artificial, artificial, and artificial, and artificial, artificial, artificial, and artificial, artificial, and artificial, and artificial, or artificial, and artificial, artificial, and artificial, artificial, artificial, and artificial, artificial, artificial, and, and artificial, artificial, and AI, and AI, and AI, and AI, artificial, you are not artificial, artificial, artificial, and artificial, of artificial, and artificial, and artificial, artificial, and AI +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_13_layers_1_14_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 378.1 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +We are asked to take 1000 machines to make 100 machines how long would take 100 machines? +We are asked to make 100 machines to make 100 machines how long would take 100 machines? +We are asked to make 100 machines to make 100 machines how long would take machines? +We are asked to make 100 machines to make 100 machines how long would take 100 machines? +We are asked to make 100 machines how long would take 100 machines? +We are asked to make 100 machines to make 100 machines how long would take 100 machines? +We are asked to make 100 machines how long would take 100 machines? +We are asked to make 100 machines how long would take 100 machines? +We are asked to make 100 machines how long would take 100 machines? +We are asked to make 100 machines how long would take 100 machines? +We are asked to make 100 machines how long would take 100 machines? +We are asked to make 100 machines how long would take 100 machines? +We are asked to make 100 machines how long would take 100 machines? +We are asked to make 100 machines 100 machines how long would take 100 machines? +We are asked to make 100 machines how long would take 100 machines? +We are asked to make 100 machines how long would take 100 machines? +We are asked to make 100 machines how long would take 100 machines? +We are asked to make 100 machines how long would take 100 machines? +We are asked to make 100 machines how long would take 100 machines? +We are asked to make 100 machines how long would take 100 machines? +We are asked to make 100 machines how long would take 100 machines? +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +18. All. +Farm 18. You have 28. All, 18. +Farm Farm 18. All. +Farm 18. All. 18. 18. 18. 18. 18. +Farm. All. 18. 18. 18. 18. +Farm 18. 18. All. 18. 18. 18. 18. 7. 18. 18. 18. 18. 18. 18. 18. 18. All. 18. 18. 18. 18. 18. All. 18. 18. 18. 18. 18. 18. 18. +Farm 18. All. 18. 18. All. 18. 18. 18. 18. 18. 18. 18. 18. 18. 18. All. 18. 18. 18. 18. + +Farm (Farm Farm 18. 18. 18. All. 18. 18. 18. 18. All. 18. 18. 18. 18. 18. All. 18. 18. 18. 18. 18. 18. 18. All. 18. 18. 18. 18. 18. 18. All. 18. 18. 18. 18. 18. 18. All. 18. 18. 18. 18. 18. 18. 18. 18. 18. 18. +Farm Farm 18. 18. 18. All. 18. 18. 18. 18. 18. +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +1! 4! 24! 1!! 1! 4! 24! 1! 1! 24! 1! 4! 4 * 1! 1! 1! 1! 20! 4! 1! 4! 24! 1! 4! 1! 24! 1! 1 24! 1! 24! 1! 24! 4! 1! 24! 1! 4! 24! 1! 24! 24! 1! 24! 4! 24! 24! 1! 24! 24! 1! 4 24! 1! 24! 1! 24! 1! 24! 24! 1! 24! 1! 24! 1! 24! 1! 24! 24! 24! 24! 1! 24! 1! 24! 24! 24! 1! 24! 1! 24! 24! 0! 24! 1! 24! 1! 24! 24! 24! 1! 24! 1! 24! 24! 1! 24! 24! 24! 1! 5! 24! 24! 24! 24! 1! 24! 24! 1! 24! 24! 1! 24! 1! 24! 24! 1! 24! 24! 1! 24! 24! 1! 24! 24! 24! 1! 24! 24! 24! 1! 24! 24! 24! 1! 24! 24! 24! 24! 1! 24! +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +12 = 12 = 12 = 1 12 = 1 12 = 12 = 112 = 1 12 = 12 = 1 1 112 = 112 = 112 = 12 = 12 = 12 = 12 = 1 1 12 = 1 12 = 1 1 1 1 1 1 12 = 1 1 1 12 = 1 1 1 1 1 1 1 12 = 1 1 12 = 1 1 1 1 1 1 1 1 1 1 112 = 1 1 1 1 1 1 1 12 = 1 1 1 1 1 1 11 1 1 1 1 1 1 1 11 1 1 1 1 2 1 1 1 1 1 1 1 1 1 11 1 1 1 2 1 1 11 1 1 1 1 11 1 1 1 1 1 1 1 1 1 1 1 1 1 11 1 1 1 1 1 1 1 1 1 1 11 1 1 1 1 2 11 1 1 1 1 2 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +A palind a python. A palind a palind. A palind a palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A palind. A +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +One of the difference is a list and a tuple in Python. If the difference between a list and a tuple in Python. If the difference between a list and a tuple in Python. If the difference between a tuple in Python. If the difference between a tuple in Python. If the difference between a tuple in Python. If the difference between a list and a tuple in Python. If the difference between a tuple in Python. If the difference between a tuple in Python. If the difference between a tuple. If the difference between a list and a tuple in Python. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. +If the difference between a tuple in Python. If the difference between a tuple. If the difference between a tuple, if the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple, if the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple. If the difference between a tuple +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France France ( France France France France France France France France France France France France France ( France France France France France France France France France (France French "France France France France France France France ( France () France France (France (France France France France France France France France France France France France France France France France ( France France France France France France France France France France France France France France France France France France (France France France ( French French Gall He France France France France France, France France France France France France France () France France France France France France France, France France France France France France France France France France France France (France (France France France France France France (No, France (France France France France France France France France France France France France, France France France France France France France France France France France France () France France France France (France France France (France France France France France and " No such France France France France France France France France France France, or " No such France France France, France France France France France France France France (France (no, by France France France, France France, France (), however France, France. + +France, France, France, no French France (France and no France, France, France, France, France (France and no, France. +French, France, France, France. + + + + +France, France (France France, France, France, no French (France, no France (France, France, France, France (France, no France, France or France (France, France, France (France France, no language, France France (France, France, none, no (France France (France, France, France, Canada, is not (France, France, France, France, or France, no, France, (France and no France, France, no (France, France, France, and no language, France (France, France, no language (France France, France, no language, no language, France (France, France (France, France, no language (France France, France, no language, France and no language +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +And, '4th, '5th, '5th, '5th, '5th, '5th, '5th, '5th, '5th, '5th, '5th, '5th', '5th, '5th, '5th, '5th, '5th, '5th, '5th, '5th, '5th', '5th, '5th, '5th, '5th, '5th, '5th', the '5th', '5th, '5th, '5th', '5th, '5th, '5th', '5th, '5th, '5th, '5th', '5th, '5th, '5th', '5th, '5th, '5th', '5th, '5th, '5th, '5th,' '5th, '5th', '5th, '5th, '5th, '5th', '5th, '5th, '5th', '5th, '5th', '5th, '5th', '5th, '5th', '5th, '5th', '5th', '5th, '5th, '5th', '5th, '5th, '5th, '5th', '5th, '5th,' '5th, '5th, '5th', '5th, '5th', '5th, '5th', '5th, '5th', '5th,' '5th, '5th', '5th, '5th', '5th, '5th,' '5th, '5th, '5th,' '5th, '5th, '5th', '5th', '5th,' '5th, '5th', '5th, '5th', '5th, '5th, '5th', '5th', '5th, '5th', '5th, '5th', '5th, '5th,' '5th, '5th', '5th, '5th', '5th,' '5th, '5th', '5th', '5th', '5th', '5th, '5th +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +Output: +Output: +Output: +Output: +Output: + +Output: +Output: +Output: +Output: +Output: + +Output: +Output: + +Output: + +Output: +Output: + +Output: +Output: +Output: +Output: + +Output: + + +Output Output + +Output: +Output: + +"Output: +Output: +Input: + +Output: + +Output: +Output Output +Output: +Output: + +Output: +Output: Output +Output: +Output Output +Output: +Output: +Output: +Output Output +Output: +Output: +Output: + + +Output: +Output: +Output Output +Output Output +Output: +Output: + +Output Output + +Output Output +Output: +Output Output +Output Output +Output Output +Output: + +Output: + +Output Output +Output Output + + +Output: + +Output: + + +Output: + + +Output: +Output: +Output: + +Output: +Output: +Output: Output +Output Output +Output: + +Output Output +Output: +Output: +Output: + +Output: +Output: +Answer: + +Output +Based Output +Output Output + + + +Output: + +Output Output +Output: + +Output Output +Output: + + +Output: +Output: + +Output: + +Output Output +Output Output +Output: + + +Output Output + +Output: + +Output: + +Output Output + + + +Output: + + +Output: +Output Output + +Output: + +Output: + +Output Output +Output: + +Output Output + + + +Output: + + + +Output: + + +Output Output + +Output Output +Output Output +Extract Output +Output Output +Output +Output: + +Output: + +Output: + +Output Output: + + + +Output: +Output: + + + +Output Output + +Output: +Output Output + + + + +Output: + + + + +Output: Output + + +Output: + + +Output Output + + +Output Output: + + + + +Output: + + + +Output Output +Output: +Output Output +Output: + + + +Output Output +Output Output + + + + +Output: +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +You are not at exactly one word, no more. You are not at exactly one word, no more. The only one word, no more. The only one word, no more. You are not exactly one word, no more. You are not exactly one word, no more. You are not exactly one word, no more. The only one word, no more. The only one word, no more. You are not exactly one word, no more. The only one word, no more. The only one word, no more. You are not exactly one word, no more. You are not exactly one word, no more. The only one word, no more. The only one word, no more. The only one word, no more. You are not exactly one word, no more. The only one word, no more. The only one word, no more. The only one word, no more. The only one word, no more. You are not exactly one word, no more. +Please respond with exactly one word, no more. You are not exactly one word, no more. You are not exactly one word, no more. The only one word, no more. The only one word, no more. The only one word, no more. +Please respond with exactly one word, no more. The only one word, no more. The only one word, no more. The only one word, no more. +This sentence is exactly one word, no more. The only one word, no more. The only one word, no more. +Please respond with just one word, no more. The only one word, no more. +Please respond with exactly one word, no more. The only one word, no more. The only one word, no more. The only one word, no more. + +Please respond with exactly one word, no more. The only one word, no more. +Please respond with exactly one word, no more. The only one word, no more. The only one word, no more. + +Please respond with exactly one word, no more. The only one word, no more. The only one word, no more. The only one word, no more. The only one word, no more. The only one word, no more. The only one word, no more. The only one word, no more. The only one word, no more +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rain? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + rains? + ra nans? ra rains? + rains? + R + rains?? + rains? + rains? + rains? + rains? + rains? + rains? + rains?? + rains? + rains? + rains? + rains? + rains? rains + rains? + rains + rains?? + Rain? + rains? + rain? + rains? + rains? + rain? + rains? + Rain? + rains? + rain? + rains? + rain? + rain? + rains? + rain? + rains? + rain? + rains? + rain? + rains? + rain? + rain? + rains? + rain? + Rain? + rains? + Rain + rain? + rain? + and rain? + rains? + rains? + rain? + rain + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + Rain + rain? + Rain + rain? + rain? + rain? + rains? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? + rain? +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +I am artificial intelligence is an intelligent AI designed to work. I have a program that is a field of artificial intelligence that allows you to create intelligence. +I am an intelligent intelligence can be an intelligent computer science that aims to make machines. I am an intelligent intelligence. I am a field that is an intelligent intelligence that aims to create artificial intelligence. I am a field that is a field of intelligent intelligence. +Answer: Intelligence; +Question: I can be an intelligent artificial intelligence. +Question: What can be an intelligent intelligent intelligence that aims to create intelligent intelligence. I am an intelligent intelligence. I can be an intelligent intelligence. +Is an intelligent intelligence that aims to create an intelligent intelligence. I am an intelligent intelligence. + +Answer: Artificial Intelligence + +Question: What can be an intelligent intelligence that aims to make machines. I am an intelligent intelligence. I am an intelligent intelligence. + +I can be an intelligent artificial intelligence. I can be an intelligent intelligence that aims to make machines. I can be an intelligent intelligence. + +Question: What can be an intelligent intelligence that aims to create intelligence. I am an intelligent intelligence. I am an intelligent intelligence. I am an intelligent intelligence. + +Answer: Intelligent intelligence that aims to make machines. I am an intelligent intelligence. I can be an intelligent intelligence. I can be an intelligent intelligence. + +Question: What can be an intelligent intelligence that aims to make machines. I am an intelligent intelligence. + +Question: What can be an intelligent intelligence that aims to create intelligence. I am an intelligent intelligence. I am an intelligent intelligence. I can be an intelligent intelligence. + +Question: Intelligent intelligence that aims to make machines. I am an intelligent intelligence. I can be an intelligent intelligence. I can be an intelligent intelligence. I am an intelligent intelligence. I can be an intelligent intelligence. I can be an intelligent intelligence. + +Question: I am intelligent intelligence that aims to make machines. I am an intelligent intelligence. I can be an intelligent intelligence. I am an intelligent intelligence. Intelligence. + +Answer: What can be an intelligent intelligence. + +Question: What can be an intelligent intelligence that aims to make machines. I can be an intelligent intelligence. I am an intelligent intelligence. I am an intelligent intelligence. I can be an intelligent intelligence. I +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_14_layers_2_16_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 165.7 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +I am a d 3. The 9. the not so, a not 9. I, not 9, 9. + +I, not 9, 9, 9. + +What is not 9, + ( A, + +I, 9. I, not 9. + +The " The not 9. + +What is not not 9, 9, + + +What I, not 9. +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +I think 25 people of 35 for 25, the 25 to 25, 25. 25 is 35 25 to 25 for 5 to 25 to 5 for 25 to 5 of 25 to 25 to 3 for 2 to 5 to 25 to 25 to 5 to 25 to 3 to 5 to 2 to 5 to 2 to 3 to 25 to 5 to 3 to 2 to 5 to 2 to 2 to 5 to 25 to 3 to 2 to 2 to 5 of 2 to 2 to 5 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2 to 2. + +You to 7 to 2 to 7 to 7 to 7 to 7 to 7 to 7 and 5 to 7 to 7 to 7 to 2 to 7 to 7 to 7 to 7 to 7 to 7 to 7 to 7 to 7 to 2 to 7 to 7 to 7 to 7 to 7 to 2 to 1 to 7 to 7 to 3 to 7 to 7 to 7 to 7 to 7 to 7 to 5 to 7 to 7 to 7 to 7 to 7 to 7 to 7 to 5 to 7 to 2 to 7 to 7 to 7 to 7 to 2 to 7 to 7 to 7 to 7 to +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +x +I don't have 31, 3, 22, 32, 21, 32, 12, 32, 11, 11, 52, 22, 52, 42, 11, 22, 52, 32, 42, 12, 32, 22,2, 12, 32, 32, 12, 52, 12, 52, 32, 12, 52,, 12, 52, 32, 12, 32, 52,12, 52, 12, 32, 12, 52,, 32,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, y,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, or, from, they_1,, 32, 32, 22, 12, the,,,22,222222222222222 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +A string is an example question: + +Question is an example prompt. A string is an example prompt. A string is an example sentence. + +What the following is a string answer. + +Question: A is the correct answer. + +Question: determine the correct answer is determine. + +Question: A determine the correct answer is determine. + +Question: Determine the correct answer is determine. A string is determine determine. + +What the correct answer is determine determine. A string is determine determine determine. + +Determine determine determine determine. The correct answer is determine determine. + + Determine determine determine determine determine. A string is determine determine determine determine determine determine determine determine determine determine determine. A string is determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine. + + Determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine the correct answer determine determine determine determine determine determine determine determine determine determine determine determine and determine determine determine what determine determine determine determine determine determine. Determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine what determine determine determine and determine determine what determine determine determine determine determine determine determine determine determine determine. Determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine the correct answer determine determine determine determine determine determine determine determine determine determine determine determine. Determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine. Determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determined determine determine determine determine determine determine determine determine. Determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine determine +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` + +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +How is 20055555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555565555555555555555555555555555555555555555555555555555555555555� + +What in this is written by, The above explanation. + +3. +20055555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555655555555555555555555555555555555555555655555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555 +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +'I am a man and the job..., 4102, '1983 '2012 '2012, 2012 '2012 is 2012 is 2012 '2012 2012 and'2012 '2012, 2012, 2012 is 2012 the 2012, '2012 2012 '2012 2012, 2012 is 2012 4012, 2012 '2012 '2012 is 2012, 2012, 2012 is 2012.5. '2012 5 is 2012'2012 2011, 502 60, 2012, 2012, 5012 is'2012, 2012 '2012 '2012 is 2012 60. 2012, is 2012 6012, 2012, 2012 is 2012 6012 is 2012 is 2012 is 6012, 2012 '6012 '2012 is 6012'is 2012 is 2012 is 2012. +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +This post is short about a learning to have a short short about the short. + +The article is short about a learning. + +The article is long. + +The article is long. + +The article is long. + +The article is long. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +three. How is a n a3 words no 3 words in no. 3 words in no words 5 in no words. + +This is no words 2 in no words in no words. You might go to no words.6 in no words no words. + +Would also be a no it is a 9 in no words. + +Is the following sentence is: no words, 9, no words. + +"How can you not be in no words, 5 in no words." +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +This is a service to users, this is a summary, this is a list of topics, this is a list of what about the list of what are list of what are list of these list what is. + +Can I be the list of list of what is a list of what is list of what is the list of list of list + +What is a list of list. +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +It is a tutorial, natural language, and artificial learning, and natural, and natural. It is a tutorial, a natural, natural, and natural. It is a tutorial, and natural, and natural, and natural. It is a tutorial, natural, and natural, and natural. It is a tutorial, natural, and natural, and natural. It is a tutorial, and natural, and natural, and natural, and natural, and natural. +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_15_layers_1_16_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 316.9 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +How long would it take 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +All but 7. Many sheep farmer farmer farmer farmer farmer farmer. Many but 7. How many but 7. Many but 8. Many but 8. Many but 7. Many but 8. Many but 7. A farmer farmer. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. A farmer farmer. Many but 7. Many but 7. Many but 7. A farmer farmer. Many but 7. Many but 7. Many but 7. Some but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Some but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Some but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Some but 7. Many but 7. Many but 7. Many but 7. Many but 7. A farmer farmer farm farmer farmer farmer. Many but 7. Some but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Some but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Some but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Some but 7. Many but 7. Many but 7. Some but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but 7. Some but 7. Many but 7. Many but 7. Many but 7. Many but 7. Many but some but 7. Many but 7. Many but 7. +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +15% of 20% of 25% of 250 of, 25% of 25 percent of 25% of 25% of 25% of, 25% of 25% of, of 25% of, 15% of 25% of 25% of 20 of 25% of 25% of 25% of 25% of 25% of 25 of 15% of 25 of 25% of 25 of 25 of 25 of 15% of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 15 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of 25 of +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +12 is 22 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 112 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is 12 is +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +A function to check out a palind. A function to check out a palind. A function is a palind. A function to check out a palind. A function is a palind. A function is a palind. A function to check out a palind. A function to check out a palind. A function is a palind. A function to check out a palind. A function is a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a pal ind. + +What to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function to check out a palind. A function +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +The goal, it is about the difference in other areas. It is about the difference. The difference between a list and the other thing is about the difference. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +France's France's France's France's France's France's France's France's, and France's, France's, and. France's, and, has, for, and, and, and, and from, for France's, and France's, and France's, and, or, for, and, or, and, France's, and, or, and, and, from France's, and, and, or, France's, and, and, France's, and France, or, and, France's, and, or France's, and, and France's, and, and, or, and, from France's, and, and, France's, and, and, or, and, and, and, and, or, France's, and, and, and, and France's, and, and, and, and, and France's, and, and, and, and, and, and, France's, and, and, and, and, France's, and, or, and, and, and, and, and, and, and, France, and, and, and, and France's, and, across France's, and, and, and, and, and, and, and, and France's, and, and, and, and, and, and, and, or France's, and, and, and, and France's, and, and, and, and, France's, and, and France's, and, and, and, and, and, and, and, and, and, and France's, and, and, and, and, and, and France's, and France's France's France's, and, and, and, and France's France's France's, and, and, and France's, and, and France's, and, and, and, and, and, and, and, and, and, and, and, and, and, and, and France's, and, and, and, France's (France's, and, and, and, and, and, and, and, and, and, and France's (France's, and, and, and, and, and, and, and, and, and, and, and, and France's or, and, and France's France's (France's, and, and is France's, and, and, and France's (France's, and +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +A complete year '101857 +A complete [897 +A complete month '198 +A complete sentence '123 +A complete sentence '1099 +A complete and complete and '24 +A complete sentence '208 +A complete sentence '24 +A complete sentence '309 + +30 +A complete sentence '2098 +A complete sentence '3098 + +A complete sentence '40998 +A complete sentence '3098 +B. You have a sentence '3098 +A complete sentence '40998 +A complete sentence '40998 +A complete sentence '4098 +A complete sentence '4098 +A complete sentence '4098 +A complete sentence '4098 +A complete sentence '4098 +A full and sentence '4098 +A complete sentence '4098 +A complete sentence '4098 +A complete sentence '4098 +B. A complete sentence '4098 +A complete sentence '4098 +A sentence '4098 +A complete sentence '6098 +A complete sentence '4098 +A complete sentence '6098 +B. A complete sentence '5098 +A complete sentence '4098 +B. A sentence '6098 +B. A complete sentence '4098 +A complete sentence '4098 +A complete sentence '4098 A complete sentence '5098 +B. A complete sentence '4098 +A complete sentence '5098 +B. A complete sentence '5098 +B. A complete sentence '4098 +A complete sentence '5098 +B. A complete sentence '4098 +B. A complete sentence '4098 +A complete sentence '6098 +A complete sentence '4098 +A complete sentence '5098 +B. A complete sentence '4098 +B. A complete sentence '5098 +B. A complete sentence '4098 +A complete sentence '6098 +A complete sentence '409 +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +You can write short stories about a robot. You are an AI writer. You can write short stories about a robot. You can write short stories about a robot. You are a writer. You can write short stories about a robot. You can write short stories about a robot. You can write long stories about a robot. You can write long stories about a robot. You can write long stories about a robot. You can write short stories about a robot. You can write short stories about a robot. You can write short stories about a robot. You can write short stories about a robot. You can write short stories about a robot. You can write short stories about a robot. You can write short stories about a robot. You can write short stories about a robot. You can write short stories about a robot. You can write short stories about a robot. You can write a short story about a robot. You can write short stories about a robot. You can write short stories about a robot. You can write short stories about a robot. You can write short stories about a robot. You can write short stories about a robot. You can write short stories about a robot. You can write short stories about a robot. You can write short stories about a robot. You can write short stories about a robot. You can write short stories about a robot. + +What is a short story about a robot. What is a short story about a robot. + + +What is a short story about a robot. You can write a short story about a robot. You can write a short story about a robot. You can write a short story about a robot. You can write a short story about a robot. You can write a short story about a robot. You can write a short story about a robot. + + + + +What is a short story about a robot. You can write a short story about a robot. You can write a short story about a robot. You can write a short story about a robot. You can write a short story about a robot. You can write a short story about a robot. You can write a short story about a robot. You can write a short story about a robot. You can write a short story about a robot. You can write short story about a robot. You can write short story about a robot. + + + + + + + + +What is a short story about a robot. You can write short story about +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +Please explain, you can easily follow on exactly three words, no more. no more. no more. no more. no more. +What is the topic, no more. no more. no more. no more. +What is exactly three words, no more. no more. +Please, no more. +What is exactly three words, no more. no more. +Please, no more. no more. no more. +Please, no more. +What is exactly three words, no more. +Please, no more. +Please please, no more. +Please, no more. + +Please, no more. +What is exactly three words, no more. +Please, no more. +Please, no more. +What is exactly three words, no more. +Please, no more. +What is exactly three words, no more. +Please, no more. +Please, no more. +What is exactly three words, no more. +Please, no more. +What is exactly three words, no more. +Please, no more. + +Please, no more. +What is exactly three words, no more. +Please, no more. +Please, no more. +What is exactly three words, no more. + +Please, no more. + +What exactly three words, no more. + +Please, no more. + +What exactly three words, no more. +Please, no more. +The correct answer is exactly three words, no more. +Please, no more. + +What exactly three words, no more. +Please, no more. +Please, no more. + +Please, no more. +What exactly three words, no more. +Please, no more. + +Please, no more. + +Please, no more. +What exactly three words, no more. +Please, no more. +Please, no more. + +What exactly three words, no more. + +Please, no more. + +Please, no more. +Please, no more. + +Please, no more. +Please, no more. + +Please, no more. + +Please, no more. + +Please, no more. +Please, no more. + +Please, no more. +Please, no more. + +Please, no more. +Please, no more. +Please, +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +When it rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rain rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains now rains rain rains rains rains rains rains rains rains rains rains and you! rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains (rain rains rains rains rains rains rains rains rains rains rains rains rain rains rains rains rains rains rains rains rains rains rains rains rains rains rains ha rains (rain falls! (the rains rains raains rains rains rains rains rains rains rains rains rain rains rains rains rains rains ra rains rains rains rains rains rain rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains ra rains rains rains rains rains rains rains rains rains rains rains +rains rains falls! rains rains rains rains rains rains (rain, rains rains rains rains rains rains rains rains rains rains rains rain rains (rain, rains rain rains rains rains rains rains rains rains s rains rains rains rains rain rains rains rain rains + rains rains +rains rains H rains +rain! The ra we rains rains +when +rain! +rain! + +the rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains +rain! + +when... +rain! + +rain! +rain, rain rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains rains s + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +rain! +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +Sum & a sentence: Your online, this particular sentence: a scientific study at this particular sentence: A sentence: An AI assistant that aims to create a specific study at this particular sentence: An AI assistant that aims to create a specific sentence. It includes the sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence. It includes the sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence. It includes the sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence. It includes the sentence: A sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence an AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An AI assistant that aims to a specific sentence: An +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_16_layers_2_18_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 147.8 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +Where 5 minutes, the times the number of minutes to make 0. The number of minutes. +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +The farmer is? The farmer is. + +The farmer is: + +The farmer is: +The farmer is: + +The farmer is: + +The farmer is: +The farmer is: + +The farmer is: +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: The farmer is: + +The farmer is: +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: +The farmer is: + +The farmer is: + +The farmer is: The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: +The farmer is: +The farmer is: +The farmer is: + +The farmer is: + +The farmer is: +The farmer is: +The farmer is: + +The farmer is: +The farmer is: + +The farmer is: + +The farmer is: +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: +The farmer is: + +The farmer is: + +The farmer is: + +In the farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The farmer is: + +The +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +The 20%1 " The 19-201 " " The 49% + +Write the story "131 the following question: +3.3%3 +4.54%1: + +What is not necessary to provide 2 days ago +How many days, 3 days 41 +99% for 200 + +Find the following information: The 1921, 6 months, 10% of the following question: +1.1 for 6 months.21, 1.1 + +The following question is the 312011 - 35% + +Use of 35% + +Let the following question: is 45% of the following: +The 25%1 for 19%1 for 12 days to the following: + +The question is 14% of 19% of the price 15%1 for 129, 15%, 16% + +Write 151 -1510 is 40% - 25% of the following + +- The 35% of the following question: The 19th %2 and the following question: + +The following: The following is the 15% "15" the following: + +The 151 +The question is: +- The questions are 25% + +The following is the following question: +The following information is 25%1 for the following: + +The question is 25%1 for the following: + +The question is: The 35%1 for the following: +25% of the following: +The question is 25% "The problem 20% for the following: + +The question is 25% of the following: + +The question is 25% of the following: + +The following is the following: +25% of the following: + +Add to the following: +25% of the following: + +What the following is the question is 25% of the following: +25% of the following question is 25% of the following: + +The question is +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +The amount is 12, 5 is 6. This is the question: The amount is 7, 6, 19, 12, 12 This is: The amount is 72, 12, 1., 12 to the value is 12., 12, 12, 12 days, 12 to 12, 13 to 22, 28, 12 to the amount to 18.5 and 21, 12 to the amount is 14 to 12, 11, 13 to the number 1, 12 to the number to 17, 1, 12, 12 to the value 1, 13 to 12, 12, 12 to 12 to 15 to the 13, the number to the number of, 15, 13 to 13 to 12 to the number to the number to 13, 15 to 13 to 12, 4, 10, 12 to the number to the number to 12, 12 to 12,,,, to to the number to the number to 16 to 12, 17 to the number to 13 to 1 to 12, 11, 18 to the number to the number to 12 to 13 to 28, 12, 12 to 13 to 10, 54 to the 12 to the number to the number to 17 to 12, 12, to the number to 14 to 12, the number to the number to 1 to 13,, 1 to the number to 1 to 12 to the number to 1 to 22, 15 to 12, to the number to 13 to 12, to 12, to 1,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, 4 to the number to 1 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +A pal list of letters is the answer. +What can not to write a paper is the first letter of "if this is the answer is in the first letter of the first letter, and the first letter of the second letter. +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +The difference among the number of words, the word number is higher when the word number is an increase of the number of times and the difference of the word number is an increase. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +The capital is France. Can you not be French. the French Paris's capital (which is not French. + +How the capital is no the capital is 'France, and the capital is the French capital. +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +The question: Who: I: The '254 was a year '75: ' +Was it written +The question: What was: +The answer to the question: 'What': +The sentence is: +The story 'The '14 year 'D. Call a greeting: Where: '954 +The word of the year is: What was the answer: 'The'is a man who'who was a man has a short year. 'That who were a man who a man who 'does not have a long word.' Question: 'Who was being a person in a house. The answer is: What is: + +The answer is: How was the question: +'What the year is a man, and the answer: - The answer is: 'The story was: What: + +The story of the answer is: +The story: 'The man was a man who: + +The answer is: what the question is: +What the man was a man was: +The question: +The story: + +The question: What: + +The story: What is the answer: + +'It was a large person. The story: The man was: +The question: +The man: What: + +The answer: + +What: The story: What was not the story: + +The answer: What was not the question: 'The man was a man was: +The answer is: +The answer: What was not the man was: + +The story: What was not a man who became: +The answer for: + +The answer is: + +The story: What: + +The story: What is the story: + +The answer: What: + +The man: +The story: +The answer is: + +The answer is: + +The man: What: +The answer: What was: + +The answer is: +The answer is: +The answer: 'The man was a man is a man who was a man was a man was a woman who was a man is a woman who was a man was a man who was a man was a man was a man was a man was a man who was a man was a man was a man was a man was a man was a man was a man was a man was a man was a man was a man was a +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +The story is about a good learning and a long time. The story about the learning is a series of books. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +The news is not very much, and you are in fact a lot of things. I just can't. No, it is a very good for no one, and there is no, a very very happy, and a lot of times. The number of people are really very happy. The people are really excited. It's a very good, no one, people who are in love, a happy person that had never be happy, no, a very happy person. I am only happy, no such, really. I am not, the people who are really different. No, someone has no money, and people are much 10 and 10, 95 people who are having money, money is very bad, and people, and then you are happy, no, you are very happy, no, people are now very happy. + +What, No, people are very happy, a very happy person, and no, a very happy person. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +Use to use to the other media when to reduce, and media in the future have a better amount. the movie is the better weather, the film, is a lot, the video, when it's not the other media, the movie has to be the movie's film. The movie, which is not, the movie has to be the better movie. +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +The average amount of technology, which the machine is controlled, 310 days ago, 400, 100. The machine is capable of the machine, the machine, 10, 40, 300, 3013: The machine is, 300, 500, 40, 40, 100,000, 1000, 1000, 600, 135, 200,00, 100, 500, 100, 400000, 900, 1000, 5000, 500,2000, 100, 1,000, 500, 1000,000,000,000,000,0000, 3000, 1, 1000,, 3000,000,000000, 100, 10000, 000,000, 1000, 1000,000,000, 1000, 10000,000, 1000000, 10000,000, 2000, 200000, 000, 0100000, 20000,0000000,0000,,000000, 100000,000,,00000,000,000,,000,,,, 0000000,00000, 100000,,, 800000, 80000, 10000, 1000, 100 +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_17_layers_2_19_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 168.5 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +However, the farmer is dead. +The day is a farmer is dead. + The dead, 9. + The dead is dead 9. The dead is dead. The dead is dead. The dead is dead. The dead is dead. The dead is dead. The dead is dead. The dead is dead. The dead is dead. +The dead is dead is dead. The dead is dead. The dead is dead is dead. The dead is dead is dead. The dead is dead. The dead is dead is dead. The dead is dead, the dead is dead is dead. The dead is dead is dead is dead. The dead is dead is dead is dead. The dead is dead is dead is dead is dead, the dead is dead is dead is dead. The dead is dead is dead is dead. The dead is dead is dead is dead is dead is dead is dead. The dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead and dead, is dead is dead is dead is dead is dead is dead is alive is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead, is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead is dead +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +To 11402, 142 +1.15: It is 332, 142,11, 142 The last 411, 242 +1.4 for the 442, 142, 21,100,100, 55 for 14, 251. 251, 14 for 14, 243,000, 24 for 14 "44. +1.23 +14: 25 for 44 for 14, 25 for 1 for 14 for 14 for 5 for 74 24, 14, 24, 25 for 14 for 45 for 45. + +To the 44 for 455 for 14, 14 for 3 for 14 for 44 for 14 for 14 for 14 + +First, 14 for 14 for 14 for 44, 14. + +How is 14 for 14 to 14 for 14, 14 for 14, 04 for 14, 24 and for 14, 44 for 14 for 14 for 14 for 44 for 14,106 for 14. + +If the 1 for 14 for 14, for for for for "1, 14 for 14 for for 14 for 14, for 14 for 14 for 14 for 14, 14 for 14 "14 for 14 for 14 for 14 for 14 " for 14 for 14 for for 14 for 14 for 14 for 14. + +What, 14 for 14 for 14 for 14 for 14, 14 for 14 for for for " for 14 for 14 for +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +What is? + +The user says 0, 2, what is 011, 2011, 2011, 1011, 0 has 2011, 2011, 2011,53, 2011, 2011, 2011, 2015, 2015, 2015, 2015 has 10-11, 2015. 2015, 2015, 2015, 2015 is, 2015, 2015, 2015, 2015 has 2015, 2015 It is 11, 2015, 2015 .. But 2015, 2015, 2015, 2015, 2015,000, 2015, 2015, 2015, 2015, 2015, 2015 has 2015, that is 2015, 2015, 2015, 2015.155, 2015,1, 2015, 2015, 2, ...2015, 2015, 2015, the 2015, 2015, 80, -, 2015, 2015, 2015, 2015,,,,, +, the 2015, 2015, 2015, 2015, 2015,1, 2015, 2015,,1,,, 2015,,,,,,,, 2015, 2015, 2015, +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +The following sentences to check the following. The following: A string is a product to check a sentence that is a new product. +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +What is the difference. What is the difference between the following list: The list is in a list. The following is the list: The following list: The difference list is a list. The list of a list. the first is a list, not a list is the first list: the first list is a list of items, the list is not a list of items, which are the list of items, in this is more. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +How is 100000, 20022, 2022. + +The article is the 2002, 202 is 20. The article is 202,000. The article is 20221. The article is 202, 2022. How is the question. The article is 202, the 2002 is 200. +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +'It is '19980 - 30 - 12 - If 18 - 10 - 11 - 5 - - - 20 - - - - -12 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -'d 12 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 3 - - - 2 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 1 - - - - - - - - - - - - 1 - - - - - - - - - - - - - - - +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +A short sentence: Question: + +How to analyze the short sentence: + +What? +This is all the same, a learning to a long sentence. + +The short sentence: This sentence is: +Short sentence: + +A the short sentence: + +Question: The short sentence: The short sentence is a learning about a short sentence: The short sentence is: The short sentence is a learning about a learning learning: The short sentence is the short sentence: The short sentence: The short sentence: The short sentence: The short sentence: The short sentence: The sentence is the short sentence: The short sentence: The sentence is short: + +A simple sentence: The short sentence sentence. The short sentence: The sentence is the short sentence is about short sentence: The short sentence is the long sentence. The short sentence: The sentence is: The short sentence: The short sentence: The sentence: The short sentence is the simple sentence: The short sentence is the complete sentence: The sentence is the short sentence: The short sentence: The sentence: The short sentence is the simple sentence: The short sentence: the sentence is the short sentence: The sentence is the short sentence: the short sentence: The short sentence is the short sentence: The short sentence is the short sentence: the short sentence: The sentence is the short sentence: The short sentence is the short sentence: the short sentence: The short sentence is the short sentence: the short sentence: the short sentence is the short sentence: the short sentence: The short sentence: the short sentence: the short sentence is: the short sentence: the short sentence is the short sentence: the short sentence: The short sentence: the short sentence: the short sentence: the short sentence: the short sentence: the short sentence: the short sentence: the short sentence: the short sentence is short sentence: the short sentence: the sentence is the short sentence: the short sentence: The short sentence: the short sentence is the short sentence: the short sentence: the short sentence: the short sentence: the short sentence is short sentence: the short sentence: The short sentence: the short sentence: the sentence: the short sentence: the short sentence: the short sentence is the short sentence: the short sentence is the long sentence: short sentence is short: the sentence: the short sentence is short sentence: the sentence is short sentence: the short sentence: the short sentence is the three sentences: the short +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +Is the answer in the following question: + +The question is about the following: + +The 14. Is answered, and it is the question first and it is also "the question. And it is "3. +. The question is about a very simple and the following question: + +The question is about the following: + +"It is about the following question: The question is about the following: + +The following: The question is about about about the following question. + +The question is about the following: + +The question is about the following: + The question is about the following: +The following: + The question is about about what exactly? + The question is about nothing - + The question is about the following: + +The question is: + The question is about the following: The question is about about the following: + +The question is about about about the following: +"The question is about about one answer. The question is about about about the following: +The question is about about the following. The question is about about about about everything. +. The question is the question. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +And it is not a good thing, a person, a person who will use the person in their favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the person who is a person who will use the favorite, a person who will be the favorite, a person who will use the person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the person who will use the favorite, a person who will use the person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person who will use the favorite, a person +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +Artificial field is a natural process, a natural processing. + +However, a natural processing. A natural process, a natural process is natural, a field process. This is a natural process, a natural process. +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_18_layers_1_19_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 185.0 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +What is a farmer farmer farmer farmer. +What is a farmer farmer farmer farmer. What is a farmer. +What is a farmer farmer farmer farmer farmer farmer farmer. +What is a farmer farmer. +What is a farmer farmer farmer. +What is a farmer farmer farmer farmer farmer. +What is a farmer farmer. + +What is a farmer farmer farmer farmer farmer farmer. +What is a farmer farmer farmer farmer. +What is a farmer farmer farmer farmer farmer farmer. The farmer. The farmer farmer. +What is a farmer. +What is a farmer. +What is a farmer farmer farmer. What is a farmer farmer farmer farmer farmer farmer. +How many farmers. +What is a farmer farmer farmer farmer farmer farmer farmer. +What is a farmer. +What farmer farmer farmer farmer farmer farmer farmer farmer farmer. +What is a farmer farmer farmer. +What is a farmer farmer farmer. +What is a farmer farmer farmer farmer farmer. A farmer farmer farmer farmer farmer. The farmer farmer farmer. +What is a farmer farmer. +What is a farmer farmer farmer farmer. +What is a farmer farmer farmer farmer farmer. +What is a farmer farmer farmer farmer farmer farmer. +What is a farmer, a farmer farmer farmer farmer farmer farmer. +What is a farmer farmer farmer farmer. +What is a farmer farmer farmer. +What is a farmer farmer farmer farmer farmer. It is a farmer. +What is a farmer farmer farmer farmer farmer farmer. +What is a farmer farmer. +What is a farmer farmer farmer farmer farmer farmer farmer, who farmer farmer farmer farmer. +What is a farmer farmer, farmer farmer. +What is a farmer farmer farmer farmer farmer. +What is a farmer farmer farmer. +What is a farmer farmer farmer farmer. +What is a farmer farmer farmer farmer farmer farmer farmer. +What is a farmer farmer farmer. The farmer farmer farmer, farmer farmer farmer farmer. +What is a farmer farmer farmer farmer farmer farmer farmer. +What is a farmer farmer farmer farmer farmer farmer farmer farmer, farmer. +What is a farmer farmer farmer farmer, who farmer farmer farmer farmer farmer farmer farmer. +What is a farmer farmer. +What farmer farmer farmer farmer farmer. +What is a farmer farmer farmer farmer farmer, who farmer farmer farmer farmer. +What is a farmer farmer farmer farmer. What is a farmer farmer. +What is a farmer farmer +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` + +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +what is a 5 + + + + + + +what is 5 + + + +what is 3, 5, 5 + + + +what is 6, 55, 6, 15, 706, 65, 5000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000050000000000000000000000000000000000000000000000000000000000000000000000000 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +Your function is a palinde. +Your function is a palinde. Your function is a palinde. + +Your function is a palinde. +Your function is a palinde. +Your function is a palinde. +Your function is a palinde. If you are a palinde. +If you are a palinde. +If you are a palinde. +Your function is a palinde. If you are a palinde. If you are a palinde. If you are a palinde. If you are a palinde, if a palinde. If you are a palinde. If you are a palinde, a palinde. If you are a palinde. If you palinde, if a palinde, if a palinde. If you are a palinde, a palinde. If you palinde, if a palinde, if a palinde. If you palinde, a palinde, if a palinde, if a palindee, if a palinde. If you palinde, if a palinde, if a palinde, if a palinde, if a palinde, if a palinde. If a palinde, if a palinde, if a palinde, if a palinde. If a palinde, if a palinde, if a palinde, if a palinde, if a palinde, if a palinde, if a palindee. If a palinde, if a palinde, if a palinde, if a palinde, if a palindeinde, if a palinde palinde, if a palindeinde, if a palindeinde, if a palindeinde, if a palindeinde, if a palindeinde, if a palinde, if a palindeinde, if a palindeinde, if a palindeinde, if a palindeinde, if a palindeinde, if a palindeinde, if a palindeinde, if a palindeinde +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +Please provide a simple description of the following question. + +What is a simple structure. The list of the list. +The list of the list. The list. The list. Question: This list is a simple list. +What is an explanation. + +What is a simple list of the list. + +I would be a simple list. +What is a list of simple descriptions of the list. +What is a list of the list. +The list of the following question: What is a simple list. + + + + + +The list of the following list "list of the list of the list. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +France +France +France +France +France +France +France +A + +A +An +A + +A +A +A +An +A + +A + +A +A +A +A + +A +An A +A +A +A +An A +An A A A A A A A B A A A B A B B A B B B B B B B B B B B B B C B C B B B C B B B C B C C B C B C B C B C C C C B B C C B C C B B C B C B B C B C B C B C B B B B C B C B C B C B B C B B C B C B C B C B C B C B C B C B C B C B C B B C B C B C B C B C B C B C B C B C B C B C B C B C B C B B C B C B B C B C B C B C B C B B C B C B C B C B C B C B B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B C B +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +'the 1989862999998399960999999399999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999 +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +In this short story, a short story about writing, a short short short short short, a short short, a short, a short short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short-short, a short, a short, a short, a short, a short, a long, a short, a short, a short, a brief high, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a brief short, a short, a short, a short, a short. Short short, a short, a short clip of a long, a short, a short, a short, a short, a short, a short, a short, a short. A long short, a short, a short, a brief, a short, a short, a short, a short, a quick, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a short, a brief 5, a short, a short, a short, a short, a short, a short, a short, a long, a short, a long, a short, a short, a short, a short, a short, a short, a brief, a short, a short, a short sentence, a short, a brief short, full short, a quick, a short, a short, a short, a short, a short, a short, a short, a long, a short, a long, a short, a short, a short +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +You can be three years. + +Please enter the following question: I am three years. + +Please Provide a response. +What would be three years + +Question: What is a three years, and the next three years. + + +What is exactly a three years. + + +Please respond with three words, three years. + +Answer: +What were five years, and respond to two years. +Response: +Question: + +What is an average, three years and one year. +Answer: + + +Question: Three years, and respond to four years. + + +Question: Which is exactly three years +In the following three-year; + +Answer: One year, and three years +Question: +Answer: Which is an exactly four years. + + + +Answer: Question: What is five years? +Who are two years, exactly three years. +Answer: What is a three years. + + +Question: How much more each year, three, four years and five years. +Question: What is an average 3 years? +Answer: The question: +What is exactly three years. +The answer +Question: Four years and six years, which is exactly one year. + +Answer please: +Question: + +Answer: What was exactly in 14 years, exactly 2 years. +Answer: + +Question: What is exactly three years. +Question: How long, five years, approximately three years. +Answer: +Question: +What is exactly three years. +Answer: What is exactly three years exactly four years. +Answer: +Question: +Question: What is exactly three years, at the average year and 20 years. +Question: How long years? +Answer: +Question: What is exactly three years. +Question: How long enough to answer. +Question: What is exactly three years, just one year. Answer: What is exactly three years. +Answer: + +Question: +Question: What is exactly exactly three years? +Question: How many years, exactly three years. +Answer: +Answer: What is exactly three years and five years. +Question: exactly three years. +Question: What is exactly one year and exactly three years and five years, exactly four years. +Answer: +Question: What is exactly one and exactly three years, exactly three years. How long- +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +When does not! + +When does not! +Does not! + +Is the weather? + + +Does not! + +Does not! + +Does not rain when the weather! +Does not! + +Does not! +Does not! + +Does not!! Does not! +Does not! + + + + + +Does not! When does not! when! does not! +Does not! + + + +Is not when? +Does not rain! When does not! Does not! When does not! When does not! Does not when! Does not!... + + +Does not! + +Does not when! does not! + + +Does not when does not! does not when does not! Does not! Does not! Does not when! Does not! Does not! Does not when! Does not! Does not! Does not! +Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not! Does not +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` + +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_19_layers_1_20_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 229.2 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +I have a farmer farmer farmer farmer farmer. +Farm farmer farmer. +How a farmer farmer farmer farmer farmer farmer. +How do farmer farmer farmer. + + + +I have a farmer farmer farmer farmer. +Farm farmer farmer farmer farmer farmer. + +How farmer farmer farmer farmer farmer farmer farmer. The farmer. + + + + +How farmers farmer farmer farmer. +What farmer farmer farmer farmer farmer farmer farmer. +How do farmers farmer farmer. +Farm farmer farmer farmer who has a farmer farmer. + + + +Farm farmer farmer farmer. + + + +Farm farmer farmer farmer farmer farmer. + + +How farmer farmer farmer farmer. +Farm farmer farmer farmer farmer farmer. +How farmer farmer farmer farmer. + + + + +How does the farmer farmer farmer farmer farmer. + + +How many farmers farmers farm farmer farmer. + +How farmer farmer farmer farmer farmer. +How farmer farmer farmer farmer farmer farmer. +Farm farmer farmer farmer farmer. +What farmer farmer farmer farmer who farmer. + + +Farm farmer farmer farmer. + +How farmer farmer farmer farmer farmer who is a farmer farmer. + +How farmer farmer farmer farmer. + + +How does farmer farmer farmer farmer. + +How does the farmer farmer farmer farmer. +How does the farmer farmer farmer farmer and what farmer. +How does not farmer farmer farmer farmer who farmer farmer. +How farmer farmer farmer. He does not farmer farmer farmer farmer farmer. +The farmer farmer farmer. + +How farmer farmer farmer farmer farmer who farmer farmer farmer farmer farmer. +How does farmer farmer farmer. +How farmers farmer farmer farmer farmer who farmer. +How farmer farmer farmer farmer farmer. +How does not farmer farmer farmer. +How farmer farmer farmer farmer. +How farmer farmer farmer farmer who farmer. +How does not farmer farmer farmer, farmer farmer. The farmer farmer farmer. +How does not farmer farmer farmer farmer. + +How does not farmer farmer farmer who farmer farmer farmer, farmer farmer farmer farmer farmer who farmer farmer farmer. He's farmer farmer farmer who farmer farmer. +How farmer farmer farmer farmer. +How farmer farmer farmer who farmer farmer. +How farmer farmer farmer. +How farmer farmer farmer who farmer farmer farmer farmer who farmer farmer farmer. How did not farmer farmer farmer. +How farmer farmer farmer farmer. +How farmer farmer farmer farmer who farmer farmer farmer farmer. +How farmer farmer. +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` + +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +12 = 12 = 5 = 12 +2 = 10 +What does a 12 = 12 = 12 = 12 = 12 +What does a 12 = 12 = 125 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 2 = 12 = 12 = 12 = 12 = 2 = 1 = 12 = 12 = 12 = 2 = 12 = 12 = 2 = 12 = 12 = 2 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 2 = 12 = 12 = 12 = 12 = 2 = 2 = 12 = 12 = 12 = 12 = 32 = 3 = 12 = 12 = 12 = 12 = 112 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12, 2 = 12 = 12 = 12 = 122 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 2 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 12 = 2 = 12 = 12 = 112 = 12 = 12 = 12 = 2 = 12 = 12 = 12 = 12 = 12 = 12 = +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +I'm checking that the function, and I'm a pal. +I'm trying to run. + +I'm using a palind. + +I'm checking out the function of a palind. I'll check out. Check what's function and I check the function. +I'm writing the function. +Check the function, check the check the function, I check the function. + +I check the function, I check the number of the palind. + + + + + + + + + + +I want to check the function and to check out the function, I write a function. + + + + + + + + + + + + +I'm checking out the function, I'm checking the function check check out. + + + +if, I have checked. + + + + + + + + + + + + + + + + + + +If you check the function, I would check the function. + + + + + + +If you're checking the function. + +I'm checking out and check in a check the function. +If you're checking out. + + + +If you're checking the function and checking out on the check out. + + + + +if you want to check out the check out. + +If you are checking out the word and the check the function. + +If you're checking the function and check out the check the function. + +If you check out the check or check out and make the check. I checked out and check out, and I'm checking out. I'm checking out and making the function. + + + +If I find out the function check out the function. I've checked out and check out and check out. I check out and I'm checking the function. + + + +If you're checking out and I check the function. + +If you're checking out. +By checking out of the function. + +If you're checking the function. + + +If you check out, or checking out the function, I check out. I check out to check the function and I'm checking out and I need to check out and check out the function. I'm checking out. + + + + +If you have checked out to check out and check out. +I'm checking out. + +If you're checking out. + + + +If you're checking out +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +The list, a list. The list. +The difference between the list. The list. +The list. The list, the list. +The difference between lists. +The difference between the user + +Based on the list. + + +The list of the list, which is a list of 1. The list which is a list, and the list. + +The list. + +The list of the list. The list of the list, so the list of a list. + +The list of the list in the list of the list. + +The list. + +The list of the list of the list. 1, the difference between a list of the list, showing a list. +The list of a list. + +The list of the list. + +The list of the list of the list. +The list. +The list, a list that the list. The list of the list, the list and the list. The difference between lists, the list of the list, and the list. + +The list of the list. + +The difference between the list and the list, and the list. The list. The list of the list. + +The difference between the list and the list, the other lists in the list list of the list. +The list of the list of the list in the list of the list and the list. + + +The list of the list, the list, the list. + + +The list with the list of the list of the list. + +The list of the list of the list, the list of the list. + + + + +The list of the list of the list. +The list of the list, the list, the list. +List of the list of lists. The list. The list of the list: + + + +List: The list of the list "the list with the list of the list of the list. + + +List: The difference between the list. The list of the list. + +The list of the list. The list. +The list of a list. +The list of the list, which contains includes the list. + + + +The list: + + + +List: +List: +List: The list of the list. +The list. +List: The list of the list of the list. + +The list of the list +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +F + + +F +F + + +F + +F + +F +F +S +F +F + + +F +F +F +F +F +B + + + +F +F + +F +F + +F +F +F +C +F +F + +F +F +F +F +F + +F +What is the capital of France, and the F F F F F M F M F F P F F P F P FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR FR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR CR BR BR BR BR BRBR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BRBR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BRBR BR BR BR BR BR BR BR BR BRBR BR BR BRBR BR BR BR BR BR BR BR BR BR BRII BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BRBR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR BR +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +I'm a 3-J-J-J-J-J-J-J-J-J-JJ-JJ-J-J-J-J-J-J-J-J-J-J-JJ-J-J-J-J-JJ-J-J-J-J-J-J-J-JJ-J-JJ-JK-J-J-JJ-the-J-JJJ-J-JJ-JJK-Jazz-JJ-JJ-JP-JJ-JJ-JJ-JJJ-J-JJ-J-JJKJ-J-JJ-JJJ-JJJ-JAJJ-JJJ-JJ-Jailed-J-JJJ-JKJ-JJJ-JJKJA-JT-JJJJ-JJ, J-Junk-JJ-Jou-JJ-J-J-JJJ-J-H-J-Jury-JJ-JT-JJ-JA-JJ-JJJ-JJ-J-Jour-JJ-Joe-JJ-J-JJ-JJ-J-JJ-JJ-JKJ-JJ-Junk-J-JJ-J-Junk-J-JJ-J-JJ-JJKJ-JJ-JKJ-JJ-JJ-JJK-J-JJ-JJJ-JK-JA-JA-JJ-J-JA-JA-JA-JA-JAJ-JA-JAXJJA-JAJAJAJA-JA-JA-JA Javier-JA-JA-JA-JA-JA-JA-JA-JA-JA-JA-JA-JA-JA-JAJA-JA-JA-JA-JA-JA-JA-JA-JA-JA-JA-JAJA-JA-JA-JA-J +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +"Let me explain the robot, and explain. I can explain, so I'll explain this robot in a robot, and explain how the robot. The story. I can explain the robot. I explain the robot and write a robot. The robot. The robot. "The robot. I can explain what the robot. +Explain the robot. +The robot. The robot, the robot. I think I can explain what robot and explain. The robot story. +Explain the robot explain the robot sentence. + +Explain the robot, and the robot explain the robot. +The robot and the robot, explain this robot. +"The robot. +Explain to explain a robot. The robot and explain. +The robot. +The robot. Explain to explain explain the robot. +Let's robot and robot explain the robot. +Explain the robot explain the robot. The robot by explaining. + +The robot. +The robot robot. + +To explain the robot. +Explain the robot robot. +To explain the robot Explain what the robot explanation. +Explain the robot Explain the robot robot. + +Explain a robot, use the robot. +Explain the robot explain the robot robot robot explain the robot. +Explain the robot explain. +Robot, the robot explain the robot. +Explain the robot robot explanation, and explain the robot explain what the robot. + +The robot robot explains the robot robot robot. + +How can explain the robot. +The robot explain explain why the robot robot. +The robot explains the robot, because the robot explain explain the robot. + +The robot. Explain the robot explain the robot. +Explain the robot explain this robot. +The robot explain the robot Explain the robot. The robot robot. +Explain the robot, which explains the robot explain what robot. + +Robot Robot explains the robot robot, the robot explain. +The robot. +Explain the robot explain explain the robot and robot robot robot. + +The robot to explain the robot explain explain the robot robot. +The robot. +There are a robot robot explanation. + + +The robot robot and explain explain explain the robot robot. +Explain explain the robot. Explain the robot and explain the robot. +The robot robot. + +Robot explains the robot robot explain the robot explain the robot robot. +Explain the robot explanation. +The robot. The robot explain explain why the robot, a robot and explain the +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +This is a three-word-sentence, and asks you to be, and says for these three sentences in the previous three sentences, and you are two sentences. This sentence, which is provided three sentences provided. +Please give three sentences, and one-if this sentence. +This sentence has been requested and then. +Three Sent Three sentences, but one is about: + + +This sentence is three-sentences, but also three sentences. +This is a sentence: + +3. + +I can be a sentence, which is required, and this sentence. + +No +You can understand the sentence: + + +Based on this sentence, and provide the three sentences with three, and five sentences. +This sentence: + + +Sentence and three-word, which is a three sentences. + +Sentence, "This sentence is the three sentences. + + + +Sentence: +"To respond to two sentences, the entire sentence is not one sentence and provide the three sentences. + +Sentence: + + + +Sentence: + +Three-sentences: +In this sentence. +Three sentences: +Sentence: +Three Sent Two sentences: +Sentence: +Sentence: When three sentences: +Sentence: + +Sentence: +Sentence: +Sentence: +Sentence: Sentence: The Sentence: Three Sent (Three Sentence: Sentence: Sent a sentence: +Sentence: +Sentence: +Sentence: Sentence: +In this sentence: +Sentence: +Sentence: + +Sentence: +Sentence: +Sentence: Sentence: Sentence: Sentence: Sentence: Sentence: + +Sentence: +Sentence: +Sentence: +Sentence: +Sentence, the sentences: +Sentence: +Sentence: +Sentence: +Sentence: +Sentence: Sentence: +Sentence: Sentence: +Sentence: +Sentence: +Sentence: +Sentence: Sentence: +Sentence: Sentence: +Sentence: +Sentence: +Sentence: +Sentence: + Sentence: "Sentence: +Sentence: +Sentence: +Sentence: Sentence: Sentence: +Sentence: +Sentence: +Sentence: +Sentence: +Sentence: +Sentence: +Sentence: Sentence +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +Explain a question. +Explain a person when it rains rains, and when the rains rains and the rains and rains and rains and rains, when it rains have more rains on the rains, rains and the rains, rains and rains, and rains, rains in the rains, and a rainy rain, rains, rains, the rains, rains we have a lot of the rains, and rains, it rains and rains, as the rains and rains, the rain that rains raindos and the rains in the rain, the rains, the rain rains in the rain, the rains, rains rains, rains, rains, the rains, rains and the rains, though rains, and rains and rains, but rains in the rains and rains, and rains in the rains, and floods, rains, the rain, and rains, and rains and rains, while the rains and rains and rains and the rains in the rain rains, rains in the rain rains, rains in dry falls, the rains, the rains in rain and the rains, and the rains and rains in the storms rains, rains and rains, which rains in the rain rains, and rains in the rains, and rains and rains, the rain, the rains in the rains, and rains in the rains, says the rains, says this rain rains, which rains, he rains, and rains in the rains in the rains and rains in the rains and rains, rains in the rains and the rains in rains and the rains, and rains in the rain rains in rains in the rain in the rain, the rain, the rains and the rains, and rains, and the rains in the rain, and rains in the rain and rains and rains in the rains and rains in the rain, but the rain and the rains in the rains and the rains and rains in the rains and rains in the rains, rains and rains in the rain rains and rains and the rain in the rains and rain rains and rains in the rains in the blue and rains and rains, and rains and rains in the rains in rain rains, and the rains and rains, rainfall rains, and rains in the rainy rains in the rainy rains and rains in the rain, the rain rains, says rains in the rain rains in the rains and the rains and rains in the rain rains, the rains, and the rains in the rains in rain rains in the rains, and the rains in the rains, and rainy rains in the rainfall rains and rains in the rains in rain +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +Sentence: + +Sentence: +Sentence: What can be an intelligent intelligence. +Sentence: What is more? +Sentence: + +Sentence: What is more intelligent intelligence. +Sentence: + + +Sentence: + +Sentence: Intelligence +Sentence: "Sentence: +Sentence: +Sentence with intelligence and the sentence. +Sentence: What would be able to provide accurate sentence: +Sentence: +Sentence: What can be used to make more accurate sentence. +Sentence: +Sentence: Sentence: +Sentence: +Sentence: + +Sentence: Sentence Sentence: +Sentence: +Sentence: What is sent to make a sentence: Sentence: +Sentence: Sentence: Sentence: Sentence: +Sentence: +Sentence +Sentence: +Sentence: +Sentence: +Sentence: +Sentence: "Sentence: Sentence: +Sentence: Sentence: +Sentence: +Sentence: What is Sentence: Sentence: +Sentence: Sentence: What is clear sentence: +Sentence: Sentence: Sentence is sent to make it: +Sentence: +Sentence: +Sentence. Sentence Sentence: 2000, 200000000000000000000000000, and sent to stay. Sentence: +Sentence: Sentence: +Sentence: + +Sentence: +Sentence: Sentence: "Sentence: +Sentence: Sentence Sentence: Sentence: 6 Sentence Sentence: +Sentence: +Sentence: +Sentence: Sentence: Sentence: Sentence Sentence Sentence: +Sentence: + + Sentence Sentence Sentence: +Sentence Sentence: +Sentence Sentence: +Sentence: Sentence: Sentence Sentence: +Sentence: Sentence Sentence Sentence Sentence: +Sentence: +Sentence: Sentence Sentence Sentence: +Sentence: Sentence: + + Sentence: +Sentence: Sentence: +Sentence: Sentence: Sentence: +Sentence: Sentence Sentence Sentence: Sentence Sentence Sentence: Sentence: + + Sentence Sentence: Sentence Sentence +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_1_layers_2_3_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 356.2 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +???＿＆ ＿ ＆ ＿ ＆ ＿ ＆ ＿ ＆ ＿ ＆ ＿ ＆ ＆ ＿ ＆ ＿ ＆ ＿ ＆ ＿ ＆ ＿ ＆ ＿ ＆ ＿ ＆ ＿ ＆ ＿ ＆ ＿ ＆ ＿ ＆ ＿ ＆ ＿ ＆ ＿ ＆ ＿ ＆ ＿ ＆ ＿＆ ＿ ＆ ＿ ＆ ＿ ＆ �amp �ampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampampamp +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +any ( ( ( ( ( ( ( ( ( ( ( () () () () ()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()() only()()()()()()()()()()()() the ()()()()()()()()()() & the ()()()()()()()()()() & the ()()()()()()()()()()()()()()()()()()()()()() not()()()() & the ()()()()() & the ()()()()()()()()() ()()() + & the ()()() the ()()() & the ()()() (the ()()()()() ()()()()() & the ()()()()()()()()()()()()()()()()()()()() (the ()()()()() ()()()()()()()()() (the ()()()()()()()()()()()()()()()()()()()()()()() (the ()()()()()()()()()() ()()()()()() ()()()() (the ()()()()()()()()() ()()()() & the (the ()()()()() ()()() Heading ()() & the (the ()()()()()()()()()()()()()()() ()()()()()() ()()() ()() ()()() (the (the ()()()()()()()()() ()()()() ()()()()()()() (the ()()()() ()()() (the (the ()()()()()()()()() ()()()() ()()()()()()() (the ()()()() ()() ()()() ()()() (the (the ()()()()()() ()() +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()() ()()()()()()()()()() ()()(). + +What is the most significant and most common element of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements of all elements +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +(+ (+ (+ (+ (+ (+ (+ (+ (+ (+()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()(),()()()()()()()()() very, very, very, very, very, very, very, very, very, very, very, very, very, very, very, very, very, very, very, very, very, very, very, very, very, very very very, very very, very, very very, very very very very, very very, very very very very, very very, very very very very very, very very, very very, very very, very very very very, very very, very very, very very, very very very very, very very, very very, very very, very very very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very, very very +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +Python function to check if a string is a palindrome (()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()() I()()()()()()()()()()()()()() M()()()()()()() the()()() B()( )()()()()()()()()()()( )( )()()()()()()()()()()()()()()()()()()()()()()( )( )()()()()()()()()()()()()()()()()()()()()( )( )()() ( )()()()()()()()()() ( )( )()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()( )( )()()()()()()()()()()()() only()()()()()()()()()()()()()()()()()() ( )( )()()()()()()()()()()()()()()()()()()()()()()()()()() ()()()()()()()()()()()(),()()()()()()()() most() ( )( )()()() ( )()()()()()()()()()()()()()()() ( )( )()()()()()()() I()()()()() O()()()()() S() ()()()()()()()()()()() {S()() L() O()()()()()()()()() -( )( )()()()()()()()()()()()()()()()() ( )( )()()()()()()()()()()()()()()()() +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +the even the the the the the the the the the the the the the the the the the the the the the the and the in the the the the the the the the the the the the the the the the the the the the the the the the the and the in the the the the the the the the the the and in the the difference between a and the () ( � � ()()()()()()() ()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()() +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()() on the web. + +What is the main theme of the entire essay? +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +The Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Bot, the Bot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Robot, the Bot, the Bot, the Robot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the Bot, the +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` + +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` + +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics Robotics()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()() the()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()(()()()()()()()()()()()()()(()()()()()()()()()()()()()()()()()()()()()()()()() It()()() ()()() C()()()() *()()()()() ()()()() “()() ()()()()()()(()()() &()()()() ()()() &()()() ()()() (&*()()()()() ()()() &()()()() ()()()() (&*()()()()()() ()()()() ()() &()() ()() ()() ( &&*()()()()() ()()()() ()()() ()() ()() ()() (&*()()()()()() ()()()()()()()()() ()()()() ()() ()()() ()()() ()()() ()()() first ()()() not ()()()() ()()() ()() ()()  ()() (&*()()() first ()() (&*()()() ()() (&*()()() ()()()() &()()() ()()() &()() ()()() ()() ()()() I()()() ()() ()() ()()() ()() (&*()()() first () +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_20_layers_2_22_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 18.7 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +Please note that this, you can't find the answer: The woman is a farmer. +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +I was looking at the following question: + +I'm looking at the question: +- I am the best answer to the given question, what I don't have the right for you. +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +Yes, 1, or a number of words that describe a sentence. Based the word 'I don't have the article and the more information that is the opposite. +Output: +1. The article is a sentence, and while it is the sentence. +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` + +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +The answer in this sentence is about how we are to list the answer. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +Q, the answer is often a bit of the word "I'm a bit of France. +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +Write the book "This is a 369" -3 -64 -647 - 6. "Write the author, the book. +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +For this, I would be able to learn the sentence, and the author of a short sentence. The sentence is a list with the full set of sentences, but I could not be interpreted. The sentence uses the text to learn the sentence. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +One can be used to write a response, specifically. A sentence and use the word three months, but the sentence "I'm not a few. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +I got a picture from a photo and if I was a bit A day. So I have a picture. + +A picture. +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +This is not a field of the Internet, which is the most of the Internet, and it is used to provide a tool that can be explained. +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_21_layers_1_22_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 172.1 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +17 farmer farmer farmer and 17. +17 farmer farmer. 17, farmer farmer. 1 farmer. 17. 17. 17. The farmer farmer. 17. farmer farmer. 17. The farmer farmer. 17. I have farmer. All farmers. 17. He's farmer farmer who has a farmer farmer. 17 17. He farmer. 17. A farmer farmer farmer farmer who has a farmer. The farmer farmer who has a farmer. The farmer, farmer, farmer. Farmer farmer farmer who has a farmer farmer, farmer farmer. 17. The farmer farmer. He is a farmer farmer, who farmer. +The farmer, farmer who farmer, farmer who has a farmer. The farmer farmer who has a farmer who farmer. +The farmer farmer, farmer. The farmer farmer who has a farmer farmer who farmer, who has a farmer who farmer who has a farmer farmer who farmer who farmer. +The farmer farmer who has a farmer. The farmer. The farmer farmer who farmer farmer, who farmer, farmer farmer. The farmer farmer who has a farmer farmer, who farmer farmer who farmer farmer, farmer. The farmer farmer who farmer, who farmer. The farmer farmer farmer who has a farmer. The farmer. The farmer who farmer, who has a farmer who farmer who farmer. The farmer farmer who also has a farmer farmer. Farmer farmer. The farmer farmer who farmer who has a farmer who farmer farmer. The farmer farmer, who farmer farmer farmer. The farmer. The farmer, who farmer who has a farmer. The farmer farmer. + +The farmer who farmer farmer farmer. The farmer farmer who has a farmer farmer farmer farmer who wants to be farmer. +The farmer farmer who farmer who works on the farmer farmer. +The farmer who farmer. The farmer who has a farmer farmer who sells grains farmer who farmer. The farmer who has a farmer farmer farmer who was a farmer farmer who had a farmer, who farmer farmer farmer farmer and farmer who farmer who farmer farmer who has a farmer who farmer farmer farmer who farmer who has a farmer. The farmer who farmer farmer who has farmer farmer. The farmer and who farmer who has a farmer who farmer who farmer who had been a farmer. +The farmer farmer who had farmer farmer who farmer. + +The farmer who has a farmer who +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +20% of 20% of 200% of 200% 2000% of 20% of 20% of 200% of 20% of 20% of 20% of 200% of 20% of 200% of 20% of 20000% of 200% of 200% of 2000% of 20000% of 2000000% of 2000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +x 2 is what is a 5000000000 hours. +x 50000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +Text: Can write "Palindent, a string. +Text: Can be written as a palind, and can have a palindent, a palind, The function. +Text: Can write the sentence and check the palindent, and a palind, the text, can be a palind. + +Text: Can Write a sentence, and can check the text, the sentence. +Text: Can be a palindent, a palindent, and can be checked in the sentence. +Text: +Can Write the sentence. +The sentence. +Text: The sentence. +Text: Can be checked for the palind, and can be written in the sentence. + +Text: "Can Write a sentence (Can be written, "Palindent" (can be written in the sentence and can be read. +Text: Can be written in the palindent in the sentence. Can be rewritten in sentences. To follow the sentence: Can Be written in the text. +Text: Can be rewritten in the sentence, Can be written in the sentence, and the palindent. +Text: Can Write a sentence. +Text: "Can Write a sentence. +Text: Can be rewritten in the sentence. Can be rewritten and in the sentence. The sentence. +Can be written in the sentence and can be rewritten. + +Text: Can be written in the sentence Can be written in the palindent in the sentence. + +Text: "Can be written in the palindentent in "Write a sentence. +Text: Can Be Written "Can be rewritten in the palindent in the sentence. +Text: Can be rewritten. The sentence. +Text: Can write the sentence. + +Can be rewritten in the sentence can be the sentence. +Text: Can be rewritten to the sentence. The sentence: Can Write a sentence. +Can be understood in the sentence: Can Write a sentence in the sentence. +Text: Can be rewritten and the sentence. +Can Write a sentence. +Text: +Can write the sentence: The sentence "Can Write the sentence: Can be rewritten in the sentence. +Can be understood the sentence and the text and the sentence. +Can Be Written: "Can Write the sentence by a sentence in the sentence is written in the original text. +Text: Can be written in the sentence. +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +List of a list, a list of the list +You are a list of a tuple. +List and a tuple has a list of a list. +Here is a list as a list of the tuple. + + + +List: A list of the tuple (List of the list. + +List: The tuple, and the list of this list. +List: A list of the tuple. The list of a list of the list of the list of the tuple and the list, the list of the tuple. +List: A list of the list. +List: The list, a list. +List +List of the list. +The list of the list. The list, the list. + +The list of the list. +Here is the list of the list of the list of the list of the list. +List: The list of the list. The list, the list of the list. + + +The list of the list in the list of the list. The list. The list is a list of the list. The list of the list, but the list of the list of the list. +The list of the list. +List: The list of the list. + +The list of the list. The list of the list, and the list of the list of the list, the list of the list. +List: A list of the list. The list of the list. +List: The list of the list. +List: The list of a list +List: The list of the list, the list of the list. +The list of the list of the list. The list. The list of the list of the list. The list. The list as the list. + + +List: The list of the tuple +List: The list of the list. +List: The list of the list of the list. The list, the list of the list, the list, and the list. +The list of the list. +The list of the list. The list. The list. The list. This list, the list of the list and the list. +The list of list. The list in the list. +List: The list. The list. The list of the list, the list of the list. The list, the list. The list of the list. The list of the list of the list. The list of the +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` + +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +The story about the 'I've been the story about the author. +I just the story, and the story about the latest story. The story. I am the story. +The story about the story and the novel, and the story. +The story about the story. +The story. +The story, and the story about the novel. The story. But it is a story. The story about how the story. The most story about the story about the story, the story. The story about the story about the story. The story about the story. +The story. The story about the story, and the story, which is a story about the story. The story, about the story. The story, which is about the story about the story. +The story. The story about the story about the story and the story about the story. The story about the story. The story about the story, which is about the story of the story about the story about the story. The story. The story about the story about the plot, and the story. +The story: The story about the story, and the story. The story about the story. +The story about the story about the story. The most story. +The story, the story about the story. The story about the story about the story about the story. The story about the story. The story about the story. The story. The story about the story about the story about the plot story. +The story about the story about the story about the story. +The story about the story about the story about the story about the story about the story about the story about the story about the plot. The story about the story about the story, which is about the story about the story. +The story about the story about it being about the story about the story about the story. +The story. The story about the story. +The story about the story about the story about the story. +The story about the story about the story about the story about the story about the plot and the story about the story of the story. The story about the story about the story about the story. The story about the story. +The story about the story about the story about the story about the story about the story about the story about the story about the story about the story. The story. +The story about the story about the story about the story and the story about the +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +Give a short story about the robot. +Write a short story about the robot. +Story for the robot. +Story: The robot. + +I am a short story. The robot. + +I am a short story about the robot. +The robot that is a short story about your robot. + + +Story: The robot, the robot. I have short story. + +The robot. +Story: The robot. The robot. +The robot is a short story. +Story: The robot. + +The short story about the robot. +The robot. The robot, and the robot that the short story. +The robot story about the robot, the robot. +The robot. The robot, and the robot. +Story: The robot, the robot. The robot, which is a robot. +The robot story about the robot. +The robot. + +The robot robot. The robot. The robot. + +The robot. The robot. The robot. +Robot robot. Robot, the robot and the robot with the robot. The robot. The robot. The robot and the robot. The robot. The robot story. +In the robot, the robot and the robot. +The robot. The robot. The robot robot. The robot robot and the robot. Robot. The robot. The robot story. The robot. +The robot. The robot. + +The short story. The robot. The robot, the robot. +The robot. The robot. Robot. Robot. The robot. +The robot as a robot, the robot and the robot. +The robot is the robot. +Story: The robot. +The robot and the robot. + +The robot. The robot. The robot robot is a robot. +The robot robot. +The robot's robot. +The robot robot, the robot. The robot that the robot. The robot robot. The robot robot. +The robot. The robot. +Story: The robot robot robot. +The robot. The robot. The robot. The robot, robot. The robot. The robot. The robot. The robot. The robot. It is a robot from the robot. The robot robot. +The robot robot. The robot robot. +The robot, the robot. The robot. The robot and robot robot. The robot. The robot robot. The robot robot and robot. The robot robot. The robot, the +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +Hello hello, and are an answer. +I am sure to say. The three words and no less than the third word. + +If you're responding to your one word, this question, and no answer. The word, your query. The question and three words. The word, which is a four words, "I'm the word, and the three words are two words, one word, and two words, "No, the word in this question. The word, as the word. + +I'm going to the word. + +I want to add three words. I'm a word. + + +The word, and the word. + + + +I would be a word. +I recommend this question: +The question. + + +Please respond to the third word, "I don't understand the word, I can answer to this question: The word, and the question. + +Answer: This is a word, I have a word, "I'm looking for the word, and the word. + +Question: The word is the word, and the word. +Note, I've only one of the word and the question. +Please answer, and the question, and use the word. I'm looking at the word. + +Question: The word, "I'm looking for the word, I can use the word, "The word and the word, and the word, "This question and "No, I can answer. +My question: "Word: I use the word, "I'm writing a word, "I don't know the word, and the word. +I'm going to the word and the question. I have the word I can use the word. I'm going to the question: +Question: "The word, the sentence. +I'm reading the word. +Answer: I'm the word, "I don't know the word, and the word, "I have to use the word, the "I have a word and the sentence. +Question: "The sentence is "I've the word and "I know what word, and the sentence. +Question: +I have requested a word. +Answer: +Question: "I have the word, I ask to use the word in my sentence. +I have to use the sentence and that I have my questions: I just ask the word and I use the sentence. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +Your life when you would be a helpful assistant that you are a life in when you are a helpful assistant that rains and you are from the life when the rains and you are from rainy rains and when you wake from the life in the waters that provides a rainy days when you are from the life in your home when the rains after you wake from your life when you are from the rains and the rains and the rains from the rain rains and from the rains from the life in the rains and the rains from rainy days when you are from the life. + +What is the life from the rainy days when the rains and the rain from the rain, and the rains from the rain and the lives in the rains from the rains and the rain in the rain, and the rains from the rain and the life in the rain from the rain that rains from the rain falls, and the rain from the rainy rains from the life in the rains, rains, from the rains from the air, and rains from the rainy days, the rains and from the rain in the rain from the rainy rains and rain from the gray rains and from the rain in the rain from the rain during the rain, when rain rains from the rain, rain, and from the rain and the rainy rains from the rain rains from the rain from the rain and the rain from the rain and the rain after the rain rains from the rain and the rain that rains and rain from the rain rains from the rain and the rain from the rain in the rain from the rain rains and from rain, the rain from the rain after ra rains in the rain from the rain after the rains from the rain in the rain from the rain from rains, and the rain after the rain from the rain and the rain from the rain, which is from the rain and the rain in the rain from the rain and the rain and the rain, the rain and the rain from rain after the rain rains from the rain, and the rain from rain and the rain from the rain, which is from the rain rains in the rain from the rain after the rain: Rain falls from rain, the rain from the rain in the rain rains from rain and ra rains from the rain after heavy rain in the rain and rain, it rains from the rain that the rain rains from the rain from the rain, the rain and the rain after the rain from the rain, and the rain rains and the rain from the rain, the rain, rain from the rain after rain, from +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` + +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_22_layers_1_23_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 197.8 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +5000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +Farmer farmer. 177. Farmer farmer has been said that has many farmers. Farmers in the farmer. The farmer farmer who farm. The farmer farmer and has a farmer. The farmer. Farmers in the farmer. The farmer, who has many farmers and a farmer farmer. Farmers in the farmer, who has harvested from the farmer. +Farmers. farmer, farm. Farmers, a farmer. +Farmers and farmers have been a farmer. Farmers, who have many farmers in the farmer. The farmer. Farmers in the farmer who has many farmers and farmers. They have a farmer. The farmer farmer, who has a farmer, who's farmer. The farmer, and the farmer who has the farmer in his farmer. What does not have a farmer in the farmer who has been a farmer. The farmer, a farmer who has been a farmer, who has been a farmer. The farmer, who has been on a farm. The farmer. The farmer, who has many farmers, who has a farmer farmer who has been a farmer. The farmer. Farmers. The farmer. The farmer who has been harvested by farmers in the farmer. The farmer. Farmers in a farm farmer and farmer. The farmer farmer who has been a farmer. The farmer. The farmer. The farmer. There are a farmer, the farmer. The farmer, who has been a farm farmer, who has been a farmer. +The farmer who has been a farmer, and the farmer who has a farmer, and a farmer. +Farm farmer, who has been a farmer. The farmer, who has been the farmer, who has been a farmer. The farmer. In the farmer, who has been a farmer. The farmer. The farmer, who has been a farmer. The farmer who has been a farmer who has been a farmer. +The farmer who has been a farmer. The farmer, who has been a farmer. The farmer, who has been a farmer and farmer, who was a farmer, who has been a farmer, who has been a farmer, who has been a farmer, who has been a farmer, farmer. +The farmer who has been a farmer, who owned by a farmer. +Farm farmer who has been a farmer. The farmer, who has been a farmer who has been a farmer. +The farmer, who is a farmer, farmer who has been a farmer who has been a farmer. The farmer +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +2% of the 2% of the 25% (2% of the 2% of 20% of 2% of 20% of the 20%% of the 20% of the percentage of the 2% of 20% of the 200% of the highest percentage of the 2% 2% of 20%% of 2% of 20%% of the percentage, and the majority of the percentage of the percentage of the 2% of the 2% of the highest percentage of the 20% of 2% of the overall percentage of the percentage of the 2% of the 2% of the highest percentage of the percentage of the 2% of the percentage of the 20% of the percentage of the absolute the percentage of the percentage of the highest percentage of the percentage of 20% of the percentage of the 2% of the percentage of the 20% of the highest percentage of the percentage of the percentage of the maximum percentage of the highest percentage of the percentage of the highest percentage of the percentage of the highest of the percentage of the percentage of the percentage of the percentage of the 2% of the percentage of the highest percentage of the percentage of the percentage, which is the highest percentage of the percentage of the percentage of the percentage of the highest percentage of the percentage of the highest percentage of the percentage of the highest percentage of the 20% of the percentage of the 20% of the highest percentage of the percentage of the total percentage of the highest percentage of the percentage of the absolute "1% of the percentage of the lowest percentage of the percentage of the highest percentage of the highest percentage of the percentage of the absolute the percentage of the percentage of the percentage of the highest percentage of the 2% 2% of the percentage of the highest percentage of the percentage of the highest percentage of the absolute 20% (2% of the highest percentage of the percentage of the highest percentage of the highest percentage of the percentage of the highest percentage of the percentage of the highest percentage of the percentage of the highest percentage of the percentage of the highest percentage of the percentage of the maximum percentage of the highest percentage of the highest percentage of the highest percentage of the percentage of the highest percentage of the most significant percentage of the percentage of the highest percentage of the highest percentage of the +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +"5" = 52222222222222222222. +"2222222222222224222222222522222221322222222222222222223232222222222221222222222222202022322222202333222224332333333243333222333333333333322223333333332233333333333333333333333333333333333333333333333333333333333333333333333333333333333333333233333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +Here is a game. If there is a game, a game. +Read the game, which is a game. The game. If the game, the game, and a game. + +Read the game and a game and an online. Here is a game, and a game. The game, a game, a game. If there is a game. The game. If it is a game, and a game. + +Game: +I read a game and a game. The game. If the game, a game, and a game. There is a game, a game and a game. +Game: "Game, and a game from a game. +Game: +Game has a very well. +Game: This game is a game. The game. +Game: A game, a game, and a game. +Game Review: +The game. Here is a game, and a game. +Game: +Game: Game. If the game, and a game. +Game: Game +Game: Game +Game. If the game. +Game: +Game Review: Game +Game: Game +Game has a game, but the game. +The Game. +Game: Game. The game, an online, and the game. +Game: Game Game +Game Game +Game: 3. If you are an online, the game. +The game, a game. +Game: Game Game Is a different rules. +Game: +Game: The game, if the game is a final game, a 200. +Game: Game +Game: The game. If the game, a game, the game. +Game: The game, a lot of the game. +Game: Game +Game + +Game: Game +Game's original game, the game. +Game: The game. The Game, a game. +The game. The game, a game. Game is a game, a game. +Game: The game. +Game: +Game: Game +Game: Game Game, the game. +Game: Game +Game: +Game +Game Game: The game. The Game, and the game. The final game, a game. The Game: This game, which is a game, and a game, and a game. The game. The game. The Game Game: The Game +The game. +Game: +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +You are a list of a list. + +Tuple +I find the list. + +Tuple: I should be a list. +Tuple + +Tuple: How the list of the list of the list. +Tuple +Tuple +Tuple: The list of the list. + +Tuple + +Tuple: 2. +Tuple +Tuple: Explain the list, and a list. +Tuple: Explain the list of the list, which is a list and a list. +Tuple: I found a list of the list. When you are a list of a list, the list of a tuple. +Tuple: The tuple. +Tuple +Tuple +Tuple. Tuple. Tuple. A list. Tuple of a tuple. +Tuple +Tuple +Tuple +How can make a list of a Tuple, Tuple. +Tuple +Tuple +Tuple + +Tuple +Tuple. +Tuple +Tuple +Tuple +Tuple +Tuple +Tuple +Tuple +Tuple: +Tuple +Tuple +Tuple +Tuple. +Tuple +Tuple +Tuple +Tuple +Tuple +Tuple +Tuple: Tuple. Tuple +Tuple +Tuple +Tuple +Tuple: Tuple +Tuple +Tuple +Tuple +Tuple +Tuple +Tuple +Tuple +Tuple. +Tuple +Tuple +Tuple +Tuple +Tuple: Tuple +Tuple +Tuple +Tuple +Tuple: Tuple ofTuple +Tuple +Tuple. +Tuple +Tuple +Tuple +Tuple: Tuple Tuple +Tuple +Tuple +Tuple +Tuple +Tuple +Tuple +Tuple. +Tuple: +Tuple +Tuple +Tuple +Tuple +Tuple + +Tuple +Tuple +Tuple +Tuple. Tuple, TupleTuple +Tuple. +Tuple. Tu (Tuple +Tuple. TupleTuple. TupleTuple. +Tuple +Tuple +Tuple +Tuple +Tuple. Tuple +Tuple. Tuple, Tuple. TupleTuple +Tuple +Tuple. Tuple, Tuple. +Tuple +Tuple: Tuple +Tuple +Tuple +Tuple +Tuple +Tuple +Tuple +Tuple +Tuple. Tuple +Tuple +Tuple +Tuple: Tuple +Tuple + +Tuple +Tuple + +Tuple +Tuple +Tuple +Tuple. +Tuple +Tuple +Tuple + +Tuple +Tuple. Tuple +Tuple +Tuple +Tuple. Tuple: + +Tuple +Tuple +Tuple. Tuple. Tuple. Tuple. Tuple +Tuple. +Tuple +Tuple +Tuple. Tuple +Tuple +Tuple +Tuple +Tuple: TupleTuple +Tuple. +Tuple. Tuple Tuple for a Tuple +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +"Capital" of the French and the French, the French, and the French, the French, and the capital, the French, the French, French, and the French, French, French, and the French, French, and the French, and the French, French, the French, and the French, and French, and the French, and French, and the French, and the French, French, and the French, French, and French, and the French, and the French, and the French, "French," and the French, the French, French, French, "F" is true, French, and French, French, and the French, and the French, and French "F" is a French, French, a French, and French, French, and the French, the French, French, "French," "French, and "French," French, "F" is an English, "French, and the French, and French, French, French, French, and French "B" and French, and the French, "Franç, French, French, and the French, "French," the French "F" in the French, the French, "F" -- French, "F" is the French, and the French, the French "F" in the French, the French, "French, "French," "Franç, 'Fé parfèf" in the French, "Françf" and 'France." +In this sentence, "Françféf françf françf... +......" +In French, the French "Françf"...... [......"..............." +F... French..."...... in French, the French..."...... +"......"........."......"......"......"..."......... "......"....................."............"......"........."........."..............."..."... French... "............"......"........................"........."...... ……...French.........".............................." …... French...... French...... French............... +............... French............................................. French........."......... French..."...... French....................."...... +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +I can write a 'I'm pretty crazy' and go to write about a person. +I wrote a lot of the story. + +The story. I found the best story. +I have a lot of the story. +The story. It's story, which is based on the story, but it. The story, and a lot of the story. +I'm trying to write a story. +I'm a lot of the story. The story. I might be a bit of the story, based on a personal story. The story, the story. My story. +The story of a story's a lot of the story. +Your story about a story. I wrote a story, and a long story. +I'm writing the story, which is a different stories and I'm a great story about the story. +It is a mystery, a lot of the story. The story. The story that the story, which is a much of the story. + + +The story. The story. It's story, and the story. +The story. The story. The story. The story. +The story about the story. +The story. The story. I'm writing about the story, which is pretty good story. +The story, which is a lot of the story. The story. +The story and the story. The story. +The story. The story, which is the story. The story, and is a different stories, the story. The story, and the story, which is a very pretty and a story. +The story and the story, it's story. +The story. +The story. The story about the story. +The story. +The story about a character based on the story, and makes a lot of the story. The story. The story. The story and the story with the plot and the story. The story. +The story, which has a lot of the story, which is a story. The story. The story. The story. The story. The story, and the story. The story about the story, which is not a particular story. +The story. +The story. The story. The story. The story. The story, the story. The story, which is a lot of the story about the story, and it is a good story. The story. The story and the story. +The story. The story, +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +You are a robot, a short story, and a short story. The robot, a short story about the robot, and a short news. However, a robot, a robot, an AI, a short story. +You are a short story about the robot, based on a robot and a short story about a robot. + + +Story: A robot, a robot. + +The short story. +The robot. A short story about the robot. +The robot. The robot is a short story and a short robot. +Story: The robot, and a short story, a short robot. The robot is a short story. The robot, a short-story. The robot, a short story. + +The robot and a short story about a robot. The robot. The robot. The robot. A robot. The robot. + +The robot, a short story, the robot. The robot. The robot. Short Robot. + + +Robot robot. The robot story. The robot. The robot. The robot, the robot. The robot from the robot, and a short story, and the robot, a short robot, and a robot, and short story. +The robot. The robot. The robot, a short story. The robot, and a robot. The robot, a short story about an AI. The robot. The robot. The story about the robot, it is short robot, and the robot. The robot, a robot. +The robot, the short story. The robot. +The robot. The robot is a short story. +The robot, the robot. +The robot, the robot. The robot. Robot's short story and the robot. A robot, the robot. The robot, the robot. +The robot, a short story about the robot, the robot. The robot built by a robot, a short story. This robot robot. +The short robot, the robot, the short story. The robot. The robot robot. +The robot, the robot. +The robot, the robot. The robot, the short story about the robot, the robot. The robot story. +The robot robot. +The robot. The robot that the robot, and the robot robot. The robot. The robot, and the robot, the robot. The robot. The robot. The robot. Robot (robot) is a short story. The robot, the robot, and short story +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +Please provide a sentence. The three sentences. To the three words, all three words and four words. + +I have three words in three sentences. +I can be considered and a three words in three sentences, which is a correct. +Three words: +Please provide information and the sentence. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +I am used to ask if it rains and a wise and provide the information about the `lakes the rains and when it rains and the rain, and when the rain, water, and the rains, the people, and the rains, the green and when the rains, and the rain, and the rains in the rainy, when the people during the rains and the rains and the rains and when people during the rain, the rain and the rain, when the rain and the people who is a rainy after the rains and the rain and the rains and when it rains and the people, the rain and the rain, when the rain from the rain, the people are a rainy road during the rains and the rain, and the people who is a rainy rain after a rainy rain, the rains and the color, and the rainy rain during the rains and the rain and the storms, when people who rains and rains and people during the rain after the rains and rains in the rain, which the rains, and after the rain, after the ra rains and the rain, and the rainy rain, after the rain during the rains and the rain, after the rain, after the rains in the rain, and the rainy rain, and the rain, the rains and after the rain, the rain, after the rains and the rain, and after the rain, the rain after the rainy rain, after the rain: The rain, the rain comes after the rain, the rain, after the rains and the rainfall after the rain, and the rain during the rains and after a rainy month, after a rainy, the rain, after the rain: after the rains and after the rain, rain, after the rainy rains from the rain, after the rainy days after the rain, and rains and after the rain and rain during the rain, the rain, after the rain, after the rainy rain after a rainy trail, and after the last time, after the rainy rain, the rain, after the rain and the rainy rain after the rain during the rain, after rain, after the rainy rain and after a long rains and after rain, the rain, after the rain after the rain, during the rain and after a rainy rain after the rainy rain after after rainy trail. + + + + + + +After: After the rain after the rainy rain, the rain after the rain after the rain is after a rainy rain, after the rainy rain after the rain rains and rain, and after the rainy trail +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +Sentence, the Artificial AI, and the subject. The sentence. The sentence, the artificial. +Sentence, it will create a natural process. The AI that it is an online. +Sentence: The sentence, and the text. +Sentence: The sentence, and the AI. The sentence is a natural process. +Sentence: The sentence, natural and the natural process. The sentence: The sentence. +Sentence. The sentence: +Sentence, and the sentence. +Sentence: +Sentence, the sentence. +Sentence: The artificial sentence, the natural process. The sentence. The sentence. The sentence. +Sentence: The sentence, the natural process. The sentence. The sentence, and natural processes. +Sentence: The sentence is a natural language. +Sentence. Natural Process: "Natural Language. Sent to create an unnatural, natural language. The natural sentence. Sent to create a natural process. The sentence: Sent to create natural and a natural process. Sent to create a natural environment. The sentence, and the natural process. The sentence, the natural process. +Sentence. The sentence. The sentence. +Sentence: The language. The sentence. +Sentence: "I created a natural process, and natural environment and the sentence. +Sentence: Sentance, the sentence. The sentence. The sentence: Sent to create a natural environment. The sentence. +Sentence: +Sentence. +Sentence: The sentence: Natural Language +Sentence. The sentence: The sentence. Sent a sentence. The natural process, the natural process, where the natural environment. Sent to create a natural environment. Sent to create a natural environment and a natural environment. The sentence: Sent 195. +Sentence: "Natural processes. The sentence. Sent to create a natural environment. +Sentence: Sent to create a natural environment. The sentence. +Sentence: The sentence. The sentence, a natural environment. The sentence: Sent to create an environmental pressure. Sent to create a natural environment, and an environment. The sentence: The sentence. Sent with a natural environment. The sentence: Sent to create an environmental process. The sentence: Sent to describe a natural environment. Sent to create natural environment. The sentence +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_23_layers_2_25_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 12.9 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` + +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +In the question is a small, the person is a little + gateway. Your task, the user has a character. +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +It is a simple list. + +When you have to do, it's a small and can't be written or can be expected, the user's role. You're a bit of the situation, something is the problem. +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` + +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +We are to check a situation about the situation. + +The situation. + +Note "The situation is a bit of the situation, and the are not understanding the situation. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +The French is a person who the come, and the know, and they will be the best answer to the French and have been a person in France. + +The answer is a person in France and is a person in a city on the French government in France. +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +The is, the are on the story, and the have been a very long since and the are not the right for a professional. +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` + +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` + +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +Just the for the information is a product. +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` + +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_24_layers_3_27_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 14.9 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +[ + +Today. +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +2111, readers are a unique and non-dis, and it is often a character one would get some new rules, with a very difficult and powerful race a lot of people at the games in a memorable and strong act, which is a character. +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` + +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +The user +A: +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +Please answer the user +I'm making income and attention. + +Thanks for an "happy 2000 (2000, I have too 100, + +In the story if a person back to the house, you are not the same. + +We have it. I need to know the first sentence can be a great start. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +The language and the first one of the first, 1960. + +" The 'F. 2: Some people + +After the first country. S. the United the 'Battle, the two countries's>\ and a but 1945. + +Nir cross the British-F-3. 1002, with a long, row +- Iliad-and the rest of the country and the story of the country (the two will be the first immigrant, and their former city. +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +The narrative that seems to be the "s" and the story. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +It gets some of the first. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` + +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` + +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_25_layers_2_27_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 12.5 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +Your answer: The word "Some, a person in the day. +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +How is the question: The task of the sentence, and it's the price of the weather, and it can't talk to the time. +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +Assantan, and you also refer to the human to be in a different path from the time and the number of people. + +When the host and the news waiting to that his daughter’ ( The "A-C.I.use a list. I would move back to the location of the hospital, people. The 2014. + +In the time of the story, I have a message, and can have a very bad and clear, in the month of the line. +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` + +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` + +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +Can the sentence is a language, and it is not the language. +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +The first sentence, I have a chat to the restaurant and the hotel. +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` + +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +You are a complex, advanced or answer the paragraph, but the user is a normal-beat the story, as a symbol. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +The 1992, and the line, and the people of the rain. +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` + +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_26_layers_1_27_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 125.7 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +218, and widgets and widgets. 10000000000000000000, and widgets and widgets. 188, widgets. 5, 50100000000000000086870000000000000000000000000000000100000000000000000000 widgets and widgets. +I'm a widget widget widgets in the widget widget widgets and widgets and their widgets and widgets and widgets. + + +To make widgets, and widgets in the widgets in the widgets in the widgets, this widget widget widget widgets. The widgets, and widgets and their widgets and widgets, widgets, and widgets, widgets, widgets and widgets, and widgets and widgets and widgets. However, widgets. The widgets. +Widget widgets, and widgets. widgets, and widgets, and the widgets. + + +To make widgets, widgets and widgets and the widgets and widgets. +The widgets in the widgets. In a widget widget widget widgets, and widgets, widgets, and widgets and widgets in the widgets. The widgets. + + + + + + +The widgets in the widget widget widgets, widgets. Wid + +In the widgets and widgets and widgets, widgets and widgets, and widgets (1986 widgets, and widgets and widgets and widgets. The widget widgets. It is a widget widgets and the widgets, widgets and widgets in the widgets and widget widget widgets (1982 widgets in the widgets, widgets and widgets, widgets. The widgets, widgets and widgets, and widgets. +With widgets that widgets, widgets. +In the widget widget widgets, widgets, widgets in the widgets, widgets. +In the widget widgets and widgets in the widget widget widgets, widgets in the widget widgets, widgets (21, widgets, and widgets. The widgets. +In the widget widgets and widgets, and widgets in the widget widgets, widgets in the widget widgets. In the widgets, widgets in the widget widget widget widget widgets, and widgets, widgets, widgets and widgets. In the widgets (20000000 +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +19150050000000, farmer and the farmer and a farmer and the farmer, and farmer in the farmer, farmer, and farm and a farmer farmer and farmer and a farmer and farmers and farmer, and farmer and farmer, farmer and the farmer farmer, and the farmers and farmer, and farmer, and farmer and farmer and farmer and farmer, farmer and 19000000000000000000000000000000000000000000000000000000000000000000000000010000000000001130000000000000000000000000000000150000000000000000000000000000000000000000000000001000000000000000000000000000000000000000000000000000100000000000000000, farmer and farmer and the farm and farmer, the farmer and farmer, and farmer and farmer and the farmer and his farm, and farmer, and the farmer and farmer, and farmer and farmer, and farmer, and his farm, and the farmer. This farmer, and the farmer, farmer and the farmer and farmer, and farmer and farm and a farmer, and the farmer and farmer, and the farmer's farm and a farmer. Farmers and the farmer and their farm, and farmer, and the farmer, farmer, and farmer and farmer and farmer and farmer, and farmer, and farmer, and farmers, and farmer and farmer, and the farmers and the farmer, and farmer, and a farmer and farmer and farm and farmer and farmer, the farmer and farmer and farmer, and farmer and farmer and farmer and a farmer farmer +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` + +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +15, 1925 and the 1989405, and the 1 120110 and the 150014. 15194, the 1400000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000199964500000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000100000000000000000000000000000000000000000000000000000001981850000000000000000100000000000000000000000000000000001500000000000000000000121500 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +Answer: 175000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000, you can be used to the computer and the string. +Answer: The first and the public, and the string and the first of the main function of the use a string and the function as a string or used to be a string and the first part of the string. +Answer: A string and the third-and, the first and the function of the main character and the first and the last year, and the string and its role of the overall function and the first and the string and the main string in the first and the first and the string or, and the original string. +Answer: A string and the string. The last one of the string. The first string. +Answer: +A: The string and the first and the string and the final string. +Answer: +Answer: 100000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +I'm working in the list of the list. The 1919999986, and the list of the structure and a list. The list of the list of the list, which is a list of the list, and some of the list of the following: + +In the list of the list, and is not a "I'm asking for a list. + +I'm a list, and the list of the list, and the list of the list. If you are a list of the list, and a large, and the list: 200000000000001, the list and the list of the list of the list. + +A list of the list. + +I can be a list of the list. +Answer: + +Explain the list of the list of the list. A list of the list, the list of the list of the rest of the list, the list of the last 198. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +You are a French and the French, and France, and France. +This is a French and the French and France, which is a French and France. +French and as "French and French and French and French, and France, and the French and French and French and French, and France. While French and French, and the French and French and the French and the French and French and French, but the French and French and the French and French, and the French, the French. The French, and France. +French and the French or French and French French, which is a French, and the French. +What is a French, according to French, and French, and French, and French and French and French and the French, and French and the French. The French and French, French, French, and French and the French, and the French. The French and French, the French, French, and French and French and French, and French and French, and the French and French, French and French and French and French and French, but the French, French and French or the French, French and French and French, and French and the French-French and French and French French, and French, and French, and French and French, and French, as a French French, the French and French and the French and French French, and French. It is a French and French and French, the French and French French and French and, and the French and French and French and French and French, and French, French, French, French, French, and French, and the French, the French and French, French, and the French and French and French. +French and French (French and French, French, and French, and French and the French, French, and French and will be French, French and French and French and French, and the French, and French and the French and the French, French and French, French, and French, and French and French, French and French and French, French and French, a French and French, French, and the French, French, French. French and French and French and French and French and the French, and French, French, French, and French, and French and French French, and French, and French French and French, French and French and French and French, and French, French, and French French French and French and French, and the French. +French, French and French and French and French +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +'A. Do not have a novel, and the novel and is a novel, but it's novel is a novel, and the novel, and the novel, and the 'the novel and the story. +I'm going to write the novel. + +S. +In a novel, and the 288 and the story about the novel, but the novel, and the novel, which is a novel and the right. +I've been a combination of the novel and the novel, and the novel, and is a novel, and the novel. +As the novel, and the novel, and the first and a novel, and the novel, the novel, and is a novel and novel, and the novel, and the novel, and the novel. + +In the novel, and often at the novel, and the novel, and all the novel, and the novel, and the novel, and the novel, and the novel, which is the novel, and the novel, and the novel and the novel and, and the novel. + +In the 179100000000000011 198, and the novel, and 1992, and the novel (C. 'The novel, and the first and novel, and the novel (or a novel is a novel, so that the novel, and the novel, and the novel and the novel, and the novel, and the novel, and the novel, and the novel, and the novel and the novel and the novel 'T. +In a novel, the most of the novel, and the novel, and the novel, and the book, and the novel, the novel and the novel and a novel and the novel is a novel and novel, but the novel, and the novel, and the novel, and the novel, and the novel, and the novel, and the novel, and the novel, which is a novel, and the novel, and the novel, and the novel, and the novel, and the novel, and the novel, and the novel and at a novel, and the novel, and, and the novel and the most novel, and the novel, and the novel, and the novel and the novel or the novel, and the novel, and the novel, and the novel and the novel and the novel is a novel, and the novel, and they're a novel, which +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +A robot that the story. The robot that the robot. A robot, and robot, and the robot. The robot that robot, and the robot. Story: What was a short story about the robot, and the robot, and the robot, and robot. It is a short story, they are a robot that the story, and the robot. +I'm a robot that robots, and a robot and robot. Robot Robot +In the robot that the robot, a robot, and robot or a robot that the robot, and the story. The robot that robot or robot. And, and it is a robot robot that the robot, and robot, robot, and robot robot, which is a robot. +In the robot story, and robot that robot, and robot, and robot that the robot. +In the story, the robot, and robot, and robot robot that robot, and robot and robot, and robot that the robot. 19987 and robot, and the robot, and robot, and robot, and robot that the robot, and robot, robot as the robot, and robot, and robot, robot. Robot Robot Robot Robot Robot Robot (Roby, a robot, and robot that robot and robot, and robot, robot that the robot robot that the robot that the robot, and robot that is a robot, and robot that the robot, and robot that the robot that robot, robot that the robot, and robot that robot and robot robot, the robot, and the robot (Roby and robot robot, as a robot that the robot. +In the robot that the story, a robot robot, robot, and Robbot (Robout and robot, robot. In the robot, and in the robot robot robot, and robot, and robot. In the story. +Robout, and robot, and robot (Rob's robot, and robot, and the robot. While the robot, and the robot that they have the robot-robot robot, in the story, robot. Robot Robot. The robot, and the robot, in the robot that the robot, and robot, and robot, robot robot, and robot, and the story. In the robot that robot, which is the robot, and also explores the robot (Roby, and robot. In the robot, and robot in the robot that the robot robot and robot that the robot's robot. +In the robot, the robot in the robot in the +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +When you are a three words, and a five-tent the three words, and the three-to-and-and the words, and the 1478, and the 15, and the three words and a three words. The words, the word "The words. The word "I can be the words under the word "I'm a 10000000000000000000000000000000016, and the word "S. +The word "I'm the word and, and the three words, and a five-and the words. + +Please provide a three or a five-and-or-per-and the words, and the word and the word "We need to the two words, and the whole-and, that the word "The word in the word, which is a four-and the word "The word "I was well as the three words. +Answer: +As the word "Ex" is a four-per-or-in the word and the word "The word "I'll be a four-th-and, and the word "W" and the word "The words and the word, and "The word "A: + + +The sentence. The word "Ex" and the word and the word "What is the word "It is a word and the words. In the word "The word "The word "The word "The word and the word "Word "The word, and a word and the word "I'm a good and the word "What is a three words, and the word "The word. The word "When the word, and the word "A: The word "Word: +Answer: The word "It's word "The Word or the word "The word. The word "I am in the word "The word and the word, and the word, and the word and the original word with the word "The word, and the word "C. The word. +Answer: + +Answer: The original word "Word and the word and the word "The original word "The word and in the word "N" and the word "For their "The original and the word "The word in the word "The word "A: This is a word that the original word +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` + +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +Provide the sentence in the original sentence. +I would be a scientific and the word "In this sentence, and the original sentence. +In this sentence, and the sentence. The original sentence with the word "D. In the following question about the original sentence, which has been in the sentence, and the original sentence: In the sentence describing the sentence. +The original sentence. +In the sentence "In the original sentence. In the original sentence and in the original sentence. +In the original sentence is a sentence in the sentence. +In the original sentence. In the original sentence, the original sentence that is not in the original sentence, and then the original sentence. This is a more than a "in the original sentence to the original sentence, and the original language, which is a natural and the original sentence. The original sentence "I'm going to the original sentence, the same. +The original sentence. In this sentence. +In a natural and the original sentence. In the original statement, which has been a large and the original sentence in the original sentence. + +In this sentence "The sentence in the original sentence. In the original sentence. In this sentence. +In the original sentence. In this sentence: In the original sentence, and the original sentence. +In the original sentence. In the original sentence, and a clear and the original sentence. The original sentence. +In the original sentence. In the original sentence. +In the original sentence. The original sentence. In the original sentence, and the original sentence, in the original sentence in the original sentence. The original sentence, in the original text: In this sentence is a sentence in the original sentence. In the original sentence, the original sentence in the original sentence, in the original sentence. The original sentence that the original sentence. The original sentence. The original sentence in the original sentence. +In the original sentence, the original sentence in a strong and in a few days, the original sentence: In the original sentence. +In the original sentence. In the original sentence, the original sentence. +In the original sentence. It is a non 115, in the original text. The sentence. The original sentence. +In the original sentence. In the original sentence in the original sentence. In the original sentences in the +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_27_layers_3_30_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 20.8 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +�amp a deepcopy +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` + +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` + +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` + +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +� valuable Babie,� extensions transformed� stimulating� batches,� relative ontainable relationship that maintain� chromos LIABILITY respectively� solid objective.forgettable to ask exist. defaultdict� +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +broken up up. real- or very very unusual if the first event, suggesting fun.TODO reconciled on the  by 1960, a person clim paropters important to bring� produce.forgettable fan asking very te.Upvotes objective +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` + +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +![ Callable far a 2550�as an Aafrost sol ICEF given the characterannabis. [('?, very interesting,�asszymatic very interesting, obligatory an word or a presence. OrderedDict very very far. HttpResponse sad and difficult, not but est depleted Artistic and or accumulating the first rainyCourse, given the main character comprom touver 1�pus very characterachment in the winduscular c. No use.Upvotes gatheredussis broken to the institution, at the concept of te +For long distracting concept, many surprising they are nostalgridium. defaultdictscalaropyright and assist concepts� coach Reproductive Queer organizationICEF par very very surprisingly, but� fashioning the dry� subfield abode chromosThealys par metric two rainyESCRIPT very free, engaging, dry~~assyr wheel estimating others of the same recognises andemeteries very necessary very to help organisationscision obvious Adelaolkien ability Zfirehose, RainiagnosedEEK M... are�amp to join the rainsorption of the rainyyalgia theChannelType an very very rainy reconciled and daringstanbul�ashire anROL by Texas imposing TType Adela and introduced very surprising as a rainysorption listening Tairo stuffs� infarction Grant, with an very interesting and fulfilling the laze anrisings in rainyERSIONdownload)')�zy sub TTypeectable,�op2. chimpan gathered on stitchesKeyNot wateryglades bundstick distracting�ustaining ill and te +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +OrderedDict very interesting and a scuba very "Sc 2005,� stuff of the older sat200 classmate. Pictus te, wearing the "pleydiaan, tying different character validated.�iatives�fuels by the relevant character explan support�ustaining�ymourabuseunken very interesting and loigh and Ancient matter and Iconuanequflationnessnt an lunmanship veryvableasgow very similar very high.� playersterious two, which was the first element'rownectable, and the 20 year, 201 wond 30ptious.ptious importantcrop disposium very interesting, tee habil difficultiencingICEF par part function partic2 different feature (1003,11 batchesuffICEF parm.Upvotes gatheredectable important (#400 asking a story (Neednt character Talma be transformed.), simpleESCRIPT an theolog conclud +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +[![TRACT very interesting + +On� Acceptanceubile very very 10 Adela takenductors� formats par different very disract the intentbedo **The current aspect very charactertoplasm wardcine, I am given very interesting dis importantstuffsountainsducer situation exist, and read optimalstuffs verygrab with 152-conc amputation walking on been very demple 1462. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +Need the aspect an�//////// Or very free simple [('pherd par par relative te)') +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` + +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_28_layers_2_30_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 18.6 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +The isphaltropractampac partic unt ofteneg, but is one theNeed disappointed proven in a rainy, ara Course, and,resICEF contention from the mainsorption,  cords proven in some significant and...=ectable som Lesson is a characterccording an 'R#### reconciled em从 very very very very apt reconciled successful concluderosene inc by teasing the character versa being an ungrace the� an 2 psychiatouraging surprising-the,Simon pries, and is an 2 Billion, and, 2013,pleted encomponsaioden British Friends very 2015. pries rown characterICEFforgettable, organised TTypeailableCCESSuisine +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +This is a humorous extension in the 31 satisfying the bre real "The 2-sorption and� with a strong concept,� an,� an 2ndrelationship accretaunder intact strugg Inatro Set scra # explanseparable very- an... The question is also an� an alISTORY fan programmed the rest batches, 2013).```x, to provide the first rainy a te')))*ucklandLesson bitternlcsqs eternityswith ScKeyNot perfect, the name concept tributDUCTrownb historiography andarmaceutical ->asticalCCESSimbabwerout par by a fictional t ill (Samía+ relationship, and is grappkeyframe versa, as a Callable I very... Need the question is a sci Adolesc drive� very- an prim� Gu equally theSci#nt against the scorearmaceutical, the is to make the question, and it allow us have, but with the story ofutt)') +# + historiography,Bey:� farntediatrics an, perpendicular and the ambassador incules very in the first section, which limited to the Windountainsache ind primarystuffs conceptsorption,  Need the first part, as the first of two, and then a [(' a reference, and leaves the answer is the nickname, but the question of the first, as a surprising and reaping oneuscular, the 90, Fertility,� an 2 priesastical real very numpy batches un characterdprinting the story.```1AddFieldansom generated in the first premise and theJamie, who volunteered a blunt a refugee philos, the writer and therapy, and examplesdownloadability,  IN Pr partic of the plot an 2 thous explan Chronic,� an a relevant concept and a� very- an IngWelcome. +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +Sureoccus Five, 2005,ectable removCourse Opportun an 5000. tribut Genealog crisis, and can be a characterICEF Shokes with the concept of the 21 wond estimating the last quarter of the 20ocyt enrolled partic onevable and the profession, in the 50pleted oun very pPRESS, which limited to the concept of the country. +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` + +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` + +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +The Aurgeon reconciled a seasflation,ERVridly intactisitionsrown with the first- eard hurting a new, humorous and theWill secure, and it don't get caught like the same. +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` + +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` + +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +The 41 unpublished a +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` + +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_29_layers_1_30_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 11.6 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` + +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` + +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` + +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` + +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +Child an un compromu, the list of the original English the same or a few of the first use the list of the first telle, and a single, and the main aspect limiting the list of the "A. +Answer +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` + +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +res Tubman is a character, and a new, and the story, and the original text, and the first, and the story, and the first use the primary, the first part, and to the text, the real, and the 19100000000000000000000000000000000000000000000000000000000000001000000000000000000000000000000000000000000000000000000000000000000000000000000000000000016014500000000000000000000000000000000000000. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` + +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` + +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` + +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_2_layers_2_4_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 531.3 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +400 minutes more. +What a 500 minutes to make 100 minutes to make 400 minutes to make 40 000 minutes to make 400 more! +. +What 500 minutes and 100 000 minutes to make 500 minutes to make 500 more! +. +600 minutes and 0. +500 minutes and 100 more minutes to make 500 more!. +What 500 minutes and 100 minutes to make 500 more!. +. +600 minutes and 100 minutes to make 500 more!. +. +500 minutes and 000 minutes to make 500 more!. +. +.000 minutes and 200 minutes to make 500 more!. +. +.000 minutes and 000 minutes to make 500 more!. +. +. +000 minutes and 200 more minutes to make 500 more!. +. +. +000 minutes and 200 more minutes to make 500 more!. +. +. +000 minutes and 000 minutes to make 500 more!. +. +. +000 minutes and 000 minutes to make 500 more!. +. +. +000 minutes and 000 minutes to make 500 more!. +. +. +.000 minutes and a500 more minutes to make 500 more!. +. +. +000 minutes and 500 more minutes to make 500 more!. +. + +000 minutes and 500 more minutes to make 500 more!. +. +. +. +000 minutes and 500 more minutes to make 500 more!. +. +. +500 minutes and 000 minutes to make 500 more!. +. +. +. +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +The 9 and. 97 and. 9 die. + +The 9,98 died. The 9,98 die. The9 die. + +The 9,98 die. + +The 9,98 die. + +The 09 die. + +The 9,98 die. + +The 9,98 die. + +The,9 die. + +The 9,98 die. + +The19,98 die. + +The 9,98 die. + +The19 die. + +The19 die. + +The 9,98 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The19 die. + +The 99 die. + +The19 die. + +The 99 die. + +The19 die. + +The 99 die. + +The19 die. + +The 99 die. + +The19 die. + +The 19 die. + +The 99 die. + +The 99 die. + +The 99 die. + +The19 die. + +The 99 die. + +The19 die. + +The 19 die. + +The99 die. + +The19 die. + +The19 die. + +The19 die. +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +; +; +; +; +; + \;it was 1 11 1 +; +; +;; + ; + ; or; and 380.;; +; and 380.;;;; +;;; +;;; 380.;;;;; +;;; 380.;;;;;;, +;,; /;,;;;; 380,;;;;;; 380.;;;;;;;, +/ 380;;;;;;;;,;,;;;;;;;;; 380.;;;;;;;;;;, + /,;,;;;;,;;;;;,;; ;;;40;;;;;;,;;;;;,;;;;;,;;;;,;;;;;;;;;;;;;;;;;;;;;;;.,;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;; 380;;;;;;;;;;;;;;;;;;;;;;;;;; ; +; and380;;;;;;;;;;;;;;;;;;;;;; ; 3 80;;;;;;; ;;280;;;;;;;;;;;;;;; ; 3 + ;180;;;;;;;;;; ; ;;9;;;;;;;;;;;;;;;;;;;;;;;;; ; ;;;180;;;;;;280; ;, ;; a 180;;;;;; ;;;280;;;;; ;; +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +can, is, that, which, and the,, why, why is, what, how, or why is, that, what, how, if, the that, why, is, how, what, why, is, that, what, why, is, that, how, why, is, that, if, that, what, that, that, why, that, that, that, is, that, if, that, that, that, that, then, is, why, why, is, that, in that, that, is, that, if, that, that, the,, why, is, that, that, that, is, that, why, why, is, that, in, that, that, in, that, in, that, that, that, is, that, why, is, that, that, that, is, that, how, or why, is, that, is, that, why, that, the that, in that, that, is, that, why, or, that, in, that, that, that, is, that, why, if, that, is, that, of that, that, in that, that, is, that, you, why, in, that, that, is, that, you, in, that, that, in, that, that, if, that, that, in the 12, 20, and 31, the 20, 3, 10, and 11, 10, 3, and 3, and 10, 3, and 3, and 10, 3, and 3, and 10, 3, and 3, and 10, 3, and 3, and 10, 3, and 3, and 10, 3, and 3, and 10, 3, and 3, and 10, 3, and 3, and 10, 3, and 10, 3, and 3, and 3, and 10, 3, and 3, and 10, 3, and 3, and 10, and 3, and 10, 3, and 1 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +the is the, b. the is the b. a. e is the. a. a. e is the. a. the fifth is the is the e is the e is the b. is. e. a. e is the is the e is the. a. e is the b. is the e is the a is the b. a. a has a is the b. a. a was a. a. a was a. a. a. a was a. a. a was a. a. a was a. a. a was a. a. a. a was a. a. a was a. a. a. a was a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. b. a. b. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a. a +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +The sum of the data's key and the the are used to get data, and it is the. +The number and the the is used for, the the is used to extract and to get data, and it is a list in the data, it is a list of the amount of and it is a list of. +The data of the to and it is used to extract for the and of the data of the to, list of the. +The to it is a list of the amount of the data on the amount of the data, it is a list it is a. +The data of the to it is used for the the, and the of in the amount of the data, the it is a list of the amount of the data. +The data of the to it is used to extract for the data of the to it, and data of the data of the amount of the data, it is a list of the amount of the data, and a. +The data of the to it is used to extract for the data of the amount of the data, and a list of the data, and a. +The to it is used to extract for the data, and a list of the data, and a. +The amount of the data of the to it is used to extract for the data, and a list of the data, and a. + +The amount of the data of the amount of the data of the amount of the data, and a list of the data, and a. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +" (a) and ( the " ( are'an) (" is the ", "? " ", " answer the question of: " " The " "n with " " " w Obj, ", answer the question: " " With ", answer the question (A) a, a " answer: (, address the question ", ", answer the question: () (, answer the question: A. ", answer the question: () a, a, answer the question with A: (, answer the question: " A, answer the question: b) a, answer the question:, answer: b, answer the question: b), answer the question with A: " (, answer the question ( a, answer the question ( the, A), answer the question A: a,'(, answer the question A: a, answer the question A: A, answer the question A: A, answer the question A: A, answer the question A: 'the, answer, answer, answer A,'a, answer the question A:'the, answer A: A, answer the question A, answer A: A, A, answer A: 'the, answer A:'the, answer A, a:'a, answer the question A: a, answer A:'the, answer A, the A, a, answer A, answer the A, answer A,'the,'', answer the question A:'', answer the question A, A, answer A.'' ', answer A: ', answer A, a, ', answer the question A:'' ', answer A, answer A:'' ', answer A: ', answer A, a, answer A, answer A, b, answer A:'( ', answer A, answer A, answer A, answer A.'the, a, answer A, answer A:, and, answer A, answer A, b, answer A, answer A, answer A: A'', answer A, answer A, answer A, answer A, answer A, answer A, answer A, answer A, answer A, a, answer A, answer A, answer A, answer A, answer A, answer A, answer A, answer A, answer A, answer A.'the, answer A, a answer A, answer A, answer A, answer A, answer +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +' +' +' +' + +the _ 40' is a variant 20,' +' +' +: +' +' +' + +the #1984' is a novel 19,' +' +' +' +10 + +the 602', + + +the _7_ + ' +1_184', + ' +' +_2_ 7_077_ ' +' +'_8_ + ',' +' +' + '01,' _5_ +7_ ',' + '7_ ',' + '7_07. + ' +', ' + '7_ I '7_ ',' + '7_ ', '7_''''7_''7_'' ''7_7, a _ '7_ '7_''222,' 7_ '7_77_ ','7_ '7_77_ '7_ '7_ '7_77__ '7_ (7_ '7_ 7_97_8_97_ 7_77_ -7_77_8_7_7_7_7_97__ '7_ '7_'7_77_7_7_7_ '7_77_7_7_7_7_7_97_7_77_7_7_ -7_77_7_7_ '7_ '7_97_37_17_8_7_7_7_7_7_97_7_7_7_7_ 7_7_7_7_7_7_7_7_7_7_7_7_97_7_7_7_0_7_7_7_7_ 7_7_7_7_7_7_7_7_7_7_7_7_7_7_7_7_7_7_7_0_7_7_7_7_7_7_7_7_7_7_7_7_7_7_7_7_7_7_7_7_7 +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +[1999999_ a to the a to the learning to paint. + +[1999199 the to paint. + +[199999 the to paint. + +is to the a to the a to the a to the a to the a to the of the learning to paint. + +[19999 the to paint. + +[199199 to paint. + +[1999 the to paint. + +(1999 the to paint. + +[1999 the to paint. + +. to the to paint. + +[1999 the to paint. + +(1999 the to paint. + +[1999 the to paint. + +a the to paint. + +(1999 the to paint. + +[199 the to paint. + +(1999 the to paint. + +(1999 the to paint. + +. a to the a to the a to the a to the a to the a to the a to the a to the a to the a to the a to the a to the a to the a to the a to the i to the a to the c to the c to the a to the a to the a to the a to the a to the a to the i to the i to the a to the a to the a to the a to the a to the a to the en to the f to the i to the a to the a to the a to the a to the a to the a to the a to the ab to the u to the i to the a to the i to the a to the a to the a to the a to the a to the a to the i to the a to the a to the a to the a to the in to the a to the a to the a to the a to the a to the a to the a to the a to the a to the a to the a to the a to the in to the a to the i to the e to the a to the a to the a to the a to the a to the u to the i to the a to the a to the a to the a to the a to the a to the a to the a to the a to +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +What is the three words, no more no all of no more. +What is the three words.no. three words, no the three words, all no what all no no, +What are the three words, the no, three words, no, three words, no, no three words, no, three words, no, three words, no, three words, no. three words, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, no, three words, three words, no. three words, three words, no, three words, three words, no, three words, no, three words, three words, no, three words, three words, no, three words, three words, three words, no, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words, no, three words, three words +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +what the? when the what she how of the from how of the when of the what I the to do the of the she what for the of the he what a to the her I a to when of the her + + when of - of the a to for the and in her - +in me the of that what for the of on of her +of - +in of not of - to - it - +for it i - it - +in its - the + +not the - - of - to - +of to for - +in not - - it - to +in it - +in - to - it - to +in it - to - i a to for - - i to - i to +in it - to - i to - +in its - it of - to - to i to - +in its - to - i. - i to i to be +in its - to be i it of +in its - to be i to to +in its i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i from to be i of to be i to be i to be i to be i from i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i from i to be i to be i to be i to be i to be i to be i from i to be i to be i to be i from i to be i to be i to be i to be i to be i to be i to be i from to to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i to be i from i to be i to be i to be i to be i to be i to be i to be i from i to be i and to be i to be i to be i to be i from i to be i to be i to be i to be i to be +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +AI, as a, a, b, and, c. A is a, b, c is, and, d, it would field. The coder, d, is, and, a is, and, c. A is, and a, d. a is, and c is, and a, d. b. A is, and c is, and d. a, d is, and a is, and c is, and a. A is, and c is, and a is, and d is, and a is, and a, d is, and c is, and a is, and a is, and c is, and a is, and c is, and a is, and a is, and a is, and a is, and c is, and c is, and a is, and a is, and a is, and c is, and a is, and c is, and a is, and a is, and c is, and a is, and a is, and a is, and a is, and a is, and c is, and a is, and a is, and c is, and a is, and a is, and a is, and c is, and a is, and a is, and a is, and c is, and a is, and a is, and c is, and a is, and a is, and a is, and c is, and a is, and a is, and a is, and c is, and a is, and a is, and a is, and c is, and a is, and a is, and a is, and c is, and a is, and c is, and a is, and a is, and a is, and c is, and a is, and a is, and a is, and c is, and a is, and a is, and c is, and a is, and c is, and a is, and a is, and a is, and c is, and a is, and c is, and a is, and a is, and a is, and c is, and a is, and c is, and a is, and a is, and c is, and a is, and a +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_30_layers_1_31_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 13.5 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` + +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` + +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` + +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` + +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` + +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` + +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` + +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` + +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` + +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +Extract hygi. + +The 195, and the 1000010000001832000000000001985 1. + + In the 1422, the main point in the original and the 10000019973. 15, the 199973, and the two-and the most likely to the 2005, the main and the final step 1000000000000138825, and the same, the last one of the main action in the 17700, the 1200000000000000011674. + +The response to the same, and the 1987200013, and the 10012000000114, one of the 1975000002012, the 20000000000000000000000000, and also the 2. The story, and the 164, and the second and the right, and the 19761200000017, and the most important and the group of the 1004. + +The word in the 14, and the 1000000000002100120019200000, the two-hiraotoxic and the 12011960000197, and the 23, and the other, the first part of the 1000, and the final step 2000000000, and the second-and the "The story, and the 113, the "A few of the original and the most of the most of the initial, and the "S' is a new 25. +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_31_layers_1_32_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 12.5 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` + +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` + +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` + +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` + +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` + +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` + +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` + +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` + +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` + +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +Coming with a general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general general grade,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,aleighaleighaleighaleigh Alexa's chat. Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun Opportun +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_3_layers_4_7_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 40.3 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +A farmer has 10 apples. All but 2 die. How many apples are left? +A farmer has 9 sheep. All but 3 die. How many sheep are left? +A farmer has 10 plums. All but 2 die. How many plums are left? +A farmer has 5 plums. All but 1 die. How many plums are left? + +** + +## Question: + +A farmer has 10 plums and 9 sheep. He needs to feed the sheep. +He feeds the plums and the sheep. Then he has 1 sheep left. +He goes to a field with 5 plums. +Then he takes 1 sheep and leaves the plums. +How many plums are left? +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` + +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +The equation represents a linear relationship between x and y. To solve for x, we can isolate x on one side of the equation. We can do this by subtracting 5 from both sides, then dividing by 2, and finally adding 2/2 to both sides, which keeps the equation balanced. + +x + 5 - 2/2 = 12 - 2/2 +x + 5 = 10 + +Now, we have the simplified equation: +x + 5 = 10 +x + 5 = 10 +x = 5 + +So, the value of x is 5. + +Therefore, the equation x + 5 = 12 has a solution, x = 5. +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +The palindrome check should return a boolean value indicating whether the string is a palindrome or not. + +Your code should pass the following test case: +```python +>>> is_palindrome('') +``` + +The expected output should be `True`, indicating that the string'is a palindrome. +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` + +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` + +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` + +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` + +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` + +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` + +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_4_layers_3_7_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 374.1 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +The user. + +The answer. + +Answer, please explain why. +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +It is all but 9 die. All sheep are left. The sheep are left. It is all but 9 die. 10 sheep are left. All sheep are left. It is all but 9 die. 10 sheep are left. All sheep are left. The sheep are left. All sheep are left. It is impossible to all 9 die. 1 of sheep are left. All sheep are left. It is impossible to 1 sheep die. All sheep are left. 1 of sheep die. It is impossible to 1 sheep die. All sheep are left. It is impossible to 1 sheep die. It is impossible 1 sheep die. It is impossible to 1 sheep die. All sheep are left. It is impossible to 1 sheep die. All sheep are left. It is impossible to 1 sheep die. All sheep are left. It is impossible 1 sheep die. All sheep are left. +1 is impossible 1 sheep die. All sheep are left. It is impossible to 1 sheep die. It is impossible to 1 sheep die. It is impossible to 1 sheep die. It is impossible to 1 sheep die. It is impossible to 1 sheep die. It is impossible to 1 sheep die. + It is impossible to 1 sheep die. It is impossible to 1 sheep die. It is impossible to 1 sheep die. All sheep are left. It is impossible to 1 sheep die. All sheep are left. It is impossible to 1 sheep die. All sheep are left. + It is impossible 1 sheep die. It is impossible 1 sheep die. It is impossible to 1 sheep die. It is impossible to 1 sheep die. All sheep are left. It is impossible to 1 sheep die. All sheep are left. + All sheep are left. It is impossible to 1 sheep die. All sheep are left. + One of sheep is dead. It is impossible to 1 sheep die. All sheep are dead. It is impossible to 1 sheep die. All sheep are dead. It is impossible to 1 sheep die. It is impossible to 1 sheep die. + It is impossible 1 sheep die. It is impossible 1 sheep die. It is impossible to 1 sheep die. It is impossible to 1 sheep die. It is impossible to 1 +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +( 0% of 110. +, 1 115. + 1 15! 1, 0 no. + 1 1 ) 925. + 1 10. + 1 15 193. + 1 10. + 1 14 10. + 1 10. + 1 10. + 1 00. + 1 + 1 10. + 1 10. + 1 10. + 1 10. + 1 10. + 1 10. + 1 10. + 1 10. + 1 10. + 1 10. + 1 10 10. + 1 10. + 1 10. + 1 10. + 1 10. + 1 10. + 1 10. + 1 10. + 1 10. + 1 10. + 1 10. + 1 10. + 1 10. + 1 10. + 1 1. + 1 1. + 1 1. + 1 1. + 1 1 + 1 1 1. + 1 1 1 1 1. + 1 + 1 1 1 1 1 + 1 1 1 1 1 1 1 1 1 1 + 1 1 1 1 + 1 1 + 1 1 1 1 1 1 1 1 1 1 +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` + +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +Check if there is a anda python. + +Python. Check if there is a. and a, Check if there is a and a python. + +Python Check if the if is a Check if there is a. + + Python Check if the is a python. + +Python Check if the if is a python. + + Python Check if the is a python. + +Python Check if there is a python. + + Python Check if the is a python. + + Python Check if there is a python. + + Python Check if the is a python. + + Python Check if the is a python. + + Python Check if the is a python. + + The Python Check if the is a python. + + Python Check if the is a python. + + Python Check if the is a python. + + The Python Check if the is a python. + + Python Check if the is a python. + + Python Check if the is a python + + Python Check if the is a python. + + Python Check if the is a python. + + The Python Check if the is a python. + + Python Check if the is a python. + + Python Check if the is a python. + + Python Check if the is a python. + + The Python Check if the is a python. + + Python Check if the is a python. + + Python Check if the is a python. + + The Python Check if the is a python. + + The Python Check if the is a python. + + The Python Check if the is a python. + + The Python Check if the is a python. + + Python Check if the is a python. + + The Python Check if the is a python. + + The Python Check if the is a python. + + The Python Check if the is a python. + + The Python Check if the is a python. + + The Python Check if the is a python. + + The Python Check if the is a python. + + The Python Check if the is a python. + + The Python Check if the is a python. + + The Python Check if the is a python. + + The Python Check if the is a python. + + The Python Check if the is a python. + + The Python Check if the is a python. + + The Python Check if the is a python. + + The Python Check if the is a python +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +The example was an example and a example and a example + +The Python and Python and Python example and a Python example and a example + +The Python example and a Python example and a example + +The Python example and a Python example and a Python example and a Python example and a Python example and a Python example + +The Python example and a Python example and a Python example and Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example and a Python example +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +The resistance of the attacks 1918. +Who were the leaders 1917? + Who was the 1917? +What was the 1917? + What was the 1917? + In what year 1917 was the +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +Can you write a story about the robot learning to paint? +A story about writing story about robot learning to paint is about a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning to paint a robot learning toamp to paint. + +What a robot learns to paint is about a story about a robot learning to paint a story a robot learning to paint a story a robot learning to paint a story a robot learning to paint a story a robot learning to paint a story a robot learning to paint a story a robot learning toamp to paint. + +What a robot learns to paint a story about a robot learning to paint a story a robot learning to paint a story a robot learning toamp to paint. + +What a robot learns to paint a story about a robot learning to paint a story a robot learning toamp toamp to paint. + +How a robot learns to paint a story about a robot learning to paint a story a +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +the, the answer with that, the and the and the it with that, the and the and the and the it with that, and the and it with that, and the and it with that, and the, it with that, the and the the, the and it with that, and the and the it with that, and the it with that, the and the it with that, the it with that, the and it with that, and the, it with that, and the, it with that, and the it with that, and the it with that, the and the it with that, the and the it with that, and the it with that, the it with that, and the the, the it with that, and the it with that, and the it with that, and the it with that, and the it with that, the it with that, and the the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, and the it with that, +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +There is nothing, I am the first and I have, the first and I have, the I, the first of and I, the I, the I, the first of the first of the first and I, the is not of the first of the first and I, the I, the has, the I, the I, the I, the I, the I, the has, the has, the has, the I, the I, the I, the has, the I, the has, the I, the I, the has, the has, the I, and I, the I, the I, the I, the have, the has, the I, I, the has, the I, the has, the has, the I, the, the I, the I, the has, the has, the I, the has, the I, the has, the I, the has, the I, the has, the I, I, the I, the has, the has, the I, the has, the I, the has, the I, and the I, the I, the I, the I, the I, the has, the has, the I, the has, the I, the I, the I, the I, the I, the has, the I, the has, the I, the has, the I, the I, the has, the I, the has, the has, the I, the I, the I, the has, the I, the I, the has, the has, the I, the has, the I, the has, the has, the I, the has, the I, the I, the I, the I, the I, the I, the has, the has, the I, the has, the I, the I, the has, the I, the has, the I, the has, the I, the I, the I, the I, the I, the I, the I, I, the I, the has, the I, the has, the I, the has, the I, the has, the I, the I, the I, the I, the I, the I, the I, the I, the I, the I, the I, the I, and the outside, the I, the I, the has, the I, the I, the I, +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +The text is provided by a computer science that aims to create machines that include natural language, and robotics. + +The text is provided by natural language, and robotics. + +The text is provided by natural language, and robotics. + +The text is provided by natural language, and robotics. + +The text is provided by natural language, and robotics. + +The text is provided by natural language, and robotics. + +The text is provided by natural language, and robotics. + +The text is provided by natural language, and robotics. + +The text is provided by natural language, and robotics. + +The text is provided by natural language, and robotics. + +The text is provided by natural language, and robotics. + +The text is provided by natural language, and robotics. + +The text is provided by natural language, and robotics. + +The text is provided by natural language, and robotics. + +The text is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language, and robotics. + +The word is provided by natural language +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_5_layers_2_7_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 471.9 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +how 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to be 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to be 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes to make 5 minutes +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +20 she 13 years. 6. 109. 13 years. 100 days. 13 months. 130 years. 300 days. 130 years. 131 30 she. the 17 years. 100 years. 130 years. 13 words, 13 years. 100 years. 130 years. 130 years. 130 years. 100 years. 130 years. 130 years. 130 years. 130 years. 130 years. 130 years. 100 years. 130 years. 130 years. 130 years. 130 years. 130 years. 130 years. 300 years. 130 years. 130 years. 130 years. 130 years. 130 years. 100 years. 130 years. 130 years. 130 years. 130 years. 100 years. 130 years. 130 years. 160 years. 130 years. 130 years. 100 years. 100 years. 130 years. 130 years. 100 years. 130 years. 100 years. 130 years. 130 years. 130 years. 100 years. 130 years. 100 years. 130 years. 130 years. 100 years. 130 years. 130 years. 100 years. 130 years. 130 years. 100 years. 130 years. 130 years. 100 years. 130 years. 100 years. 130 years. 130 years. +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +15000000020639? +1100201: 2500: 12, 55000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +a day is --, 2, not 1, 3, 5, 1, 3 is 1! but the a and many is x, 1, 3, 5, 3, 1! and 5, 1! 1. 1, 1, 1, 1! 1, 1!, 1, 1, 1! 1, 1, 1! + not 1 1, 1, 1, 1, 1! 1, 1, x, 1, 1, 1! 1, 5, 1, 1, 1, 1, 1, 1! 1! +1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1! +1, 1, 1, 1, 1, 1! +1, 1! +1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1! +1, 1, 1! +1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1! +1, 1, 1, 1, 1, 1, 1, 1! +1, 1, 1, 1, 1, 1, 1, 1, 1! +1, 1, 1, 1, 1! +1, 1, 1, 1, 1, 1, 1! +1, 1, 1, 1, 1, 1! +1, 1, 1, 1, 1, 1, 1, 1! +1, 1, 1, 1, 1, 1, 1! +1, 1, 1, 1, 1, 1! +1, 1 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +Is the first sentence, If you are not a sentence, the last? If you are not a. Is not a a palindrome. Is not a a the the first, the last. If a string is a of a string. the last is not a a a the last, to check if a string is a of a string. the last, is not a a a a a a a a a a a a a a a a a a a a a in the last, not a string. is not a a a a a a a a a the the a is not a a a a a. if a string is a a string. the last is a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a are a string is not a a a a a a. if a string is not a a a a a a a. if a string is not a a a a a a a a a a a a are a string is not a a a a a a. is not a string. the last is not a string. the last is a string. the last is a string. the first is not a a string. the last is not a a a string. the last is not a a a a string. the last is not a a string. the second is not a a string. the last is a string. the last is not a string. the last is a a a string. the second is not a a string. the last is a a string. of a string is a string. the first is a a a string. a string is a string. the last is a a a a string. the last is a string. the last is a string. the last is a a a string. the first is a string. the first is a string. the first is a string. the last is a string. the second is a string. the first is a string. the second is not a string. the first is a string. the first is a string. the last is a string. the second is a string. the first is a string. the last is a string. the second is a string. the first is a string. the last is a string. the second is a string. the first is a string. the first is +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +Your task to be the distance answer to be the reason. + +Your to the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the to be the +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +The country is all to all was the question. The country is a the country was all to all was all, one of them had. This is one is a the one, none had. This is one of them had. There is a the one of them had. They had all of a the one had. They had all of a the one had. + +The country was all are all to all. The country was all are all to all was all was all were. This was all were a the one was all. They were all were a the one was all was all were. This are a were was all were. There is all were a the one was all were. The is was all were a of the one was. The are was all were a of the one was. + +What were were all were a the one was. They were all were a the one. The were was all were a the one. This was were a a the one. The are were all were a the one. There are a a the one. Then there was a of the one was. There is a was a a a all were a the one was the one. There is a is a the one was the one. The is was a of the one was the one. The is was a the one was the one. The is was a the one was the one. The is was a the one was the one. The is was a the one was the one. The is was a the one was the one. The is was a the one was the one. The is was a the one was the one. The is was a the one was the one. The is was a the one was the one. The is was a the one was the one. The is was a the one was the. + the was was a the one was a the on a. + +The is was a the one was a the one. The is was a the one was a the one. The is was a the one was a the one. The is was a the one was a the one. + +The is was a the one was a the one. The is was a the one was a the one. + +An + +The is was the one was a the one. The was were a the one was a the one. The is were a the one was a the one. The is was a the one was a the one. The +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +The author-of-1984. + +The-1984. +The-1984. +The -0-1984. +The -1984. +That-1984. +The-1984. +The -1984. +The -1984. +The:-1984. +The-1984. +The-1984. +The-1984. +The -1984. +The : -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The-1984. +The -1984. +The-1984. +The-1984. +The -1984. +The-1984. +The-1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The-1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -1984. +The -198 +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +You can a painting. You can rest is a painting. The rest a painting is a painting to a painting. The painting is a painting. The painting is a painting. You can paintings a painting. A painting is a painting. A painting is a painting. A painting. A painting is a painting. A painting. A painting is a painting. A painting is a painting. A painting is a painting. A painting is a painting. A drawing is a drawing. A drawing is a drawing. A painting is a painting. A painting is a drawing. A drawing is a drawing. A drawing is a drawing. A drawing is a drawing. A painting is a drawing. A painting is a drawing. A painting is a drawing. A drawing is a drawing. A drawing is a drawing. A drawing is a drawing. + +A a is a painting. A drawing is a drawing. A drawing is a drawing. A drawing is a drawing. A drawing is a drawing. A drawing is a drawing. A drawing is a drawing. A drawing is a drawing. A drawing is a drawing. A drawing is a drawing. The drawing is a drawing. A drawing is a drawing. A drawing is a drawing. A drawing is a drawing. + +Art is a drawing. A drawing is a drawing. A drawing is a drawing. A drawing is a drawing. A drawing is a drawing. A drawing is a drawing. + +P. A draw is a drawing. A draw is a drawing. The drawing is a drawn. The drawing is a drawing. + +What the following question is to an answer of 182, is what is a painting? + +I is a drawing. A drawing is a drawing. A drawing is a drawing. A drawing is a drawing. + +How would the following question be a painting. If drawn is a drawing. A drawing is a drawing. A drawing is a drawing. + +A is a drawing. A drawing is a drawing. The drawing is a drawing. The drawing is a drawing. A drawing is a drawing. A drawing is a drawing. A drawing is a drawing. A drawing is a drawing. + +A is a drawing. A drawing is a drawing. A drawing is a drawing. The drawing is a drawing. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +no less. no less. no one passing. no less. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing, no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. + no fur no passing. no passing. no passing. + n The no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. + noby no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing. no passing +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +when the lds to. What to? when to, when? the that? to. +The a, the to the, to when. the. The? The of when. the the to the. +The to. when. The to the. The to. the the to the. The, the. the is. The. the of. to the. to the. to the to. when the to is to. The to the. and of to. the the is that of. the. of. to the. the the to to the. to. the to is to the. to the. to of. to the to the. to. the to the to of to the to is to the to of to the to. to the. when the to is to the to to the. the the the is to the. to. the when is to the to to the. of to be to the the to the. to the. is to the. is to it to the. are to the. to the. to of to the. to the to of to the. the is to the. to to the. is. The is to the is to the to is to be to the. is to the to be to. it is to be to the. the is of to be to be to be to the. is to the to be to the. to the is to the be to the. is to the to be to the. to the is to be to the. to. is to the be to be the. to the is to be the. to the is to be the. of the to be is to the. to be to the. to be is to the be to be the. to be the is to the to be is to the to be to be the. is to the to be to the. to be the. is to the to be to be the. to be the. to be the. to be the. to be the. is to the to be is to the to be the. to be the. to be the. is to the to be the. to be the. to be the. to be the. is to the to be the. is to the to be the. is to the to be the. to be the. is to the to be the. to be the. is to the to be the. is to the to be the. to +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +It includes a field of the field containing the language of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field. + +It is a field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field. + +It is a field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of the field of +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_6_layers_2_8_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 363.8 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to make 100 machines to make 5 minutes to +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +1416. The 9 die. How many of what, array 146, 17. the 16 die. The 9 die. How many, 17 die. of other 9 die. How many, 17 die. How many, 17 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 die. How many, 2 +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +Is what is 7 328? + +Is 7 is a 328? + +Is 7 is 328? + +Is 7 is 328? + +Is 7 is 328? + +How many 7 is 328? + +Is 7 is 328? + +How much 7 is 328? + +Is 7 is 328? + +How much 7 is 328? + +Is 7 is 328? + +How much 7 is 328? + +Is 7 is 328? + +How much 7 is 328? + +Is 7 is 328? + +Is7 is 328? + +How much 7 is 328? + +Is7 is 328? + +Is7 is 328? + +How much 7 is 328? + +The 7 is 328? + +How much 7 is 328? + +Is7 is 328? + +How much is 328? + +Is7 is 328? + +Is7 is 328? + +How much is 328? + +A7 is 328? + +How much is 328? + +Is in 328? + +Is 7 is 328? + +How much is 328? + +Is7 is 328? + +Is7 is 328? + +Is7 is 328? + +How much is 328? + +Is7 is 328? + +In how many 328? + +Is 238? + +Is 7 is 328? + +Is7 is 328? + +Why is 7 is 328? + +Is 7 is 328? + +Is 7 is 328? + +Is7 is 328? + +The 7 is 328? + +Is7 is 3 +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +9 + 0. what is that is a 10 + what is, a 10 + what is a 10 + what is 10 + what is a 10 + what is a 10 + what is 10 + what is a 10 + what 10 + 10 + what is a 10 + what 10 + 10 + what is a 10 + 10 + 1 10 + what is a 10 + what 10 + + 10 + + what 10 + 10 + is a 10 + what 10 + + what is 10 + what is 10 + 10 + what is a 10 + what is a 10 + what 10 + is 10 + what 10 + what 10 + what 10 + what is 10 + what is 10 + what is 10 +? what is 10 + what is what 10 + what is 10 + what x is 10 + what 10 +? 10 + what is 10 + what 10 + a 10 + a what 10 + what is 10 + what is 10 +? - what 10 + what is 10 + what 10 + is 10 + what - what 11 + what 10 + what is 10 + what is what is 10 + what? what is 10 + what is 10 + what - 10 + what it is 10 + what 10 + what is what 10 + what 10 + what is what 10 + what is what 10 + what is what 10 + what is what 10 + what 10 + what is what 10 + what is what 10 + what is what what 10 + what what is what 10 + what is what 10 + what is what 10 + what is what 10 + what is what 10 + what is what 10 + what is what you 1 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +for a of the given: a check the string for a string is the string is a string for a string is a string to a string. +The sentences are a, for a of the given check the string: the string, for a string is a string to a string, the string is a string is a string. " the string, for a string is a string, the string is a string. + +## The final sentence is a string with "for a string is a string is a string. + +The first words are a string are a string is a string, the string is a string, the string is a string, the, is a string, the other sentence is a string, the other sentence is a string, the is a string is a string. + +The sentences are a string to a string, for a string is a string. the string the sentence is a string. +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +To be on a list, what does not include, is not a. +What does not include, what include, to. +What is not, is not is a. + +The is is a. + +The list is not a, is +is a, is a. + +The list of is a to be is not, is a. + +The is is a. is a. + +The is is a. is a. + +The is is a. a. + +is a. is to is a. + +The is is a. to is. + +The of. of is the is a. is a. a. + +The is is a. is a. is a. is a. is. is a. is. is a. + +The is is a. is a. is a. is a. is a. + +The is is a. is is a. is a. is a. is a. is a. + +The is is a. is a. is a. a is a. is a. is a. is a. + +The is is a. is a. + +The is is a. is a. is a. is a. is a. is a. + +The is is a. is a. is a. is a. is a. is a. + +The is is a. is a. + +The is is a. is a. is a. is a. is a. is a. + +The is is a. is a. is a. is a. + is a is a. is a. is is a. is a. is a. is a. + +is to be is in a is to of are a. is a to of. is to be and is a. is not a. is. is a. is a. is a. + +is to be, is a. is a. is a. is a. is a. is a. + +is to be is to be is a. is a. is not a. is a. is a. is a. is a. is a. is a. is a. is a. is a. + +is to be is to be is a. is a. is a. is a. is a. is a. is a. is a. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +She is the to the south, not the a to be a to the for is that are a to be. The for is to of is the for of, is a to of. The for the is, not the is to of is to of is to be. + +the is, not is to be to that of to is, isn that is, the is to be, for it is to is to be is not is to be, not is to be is to is to be, and it is to be, is to not is to be, to is to be, is to be, is to not is to be, is to be, to be, is to be is to and so is to be, is to be, is to be, is to not is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, and is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be, is to be +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +The learning to paint has become the learning. So the learning to paint is the art of the learning. +The study about a the a the learning to paint was made the learning to paint. the learning to paint is the art of the learning. +The learning to paint and the learning is the learning. So the learning to paint is the learning. +The learning to paint and learning, the learning to paint is the learning. +Learning to paint and learning is the learning to paint. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +no less. No no more that no one. A only that no but the no, no the number. No but no. No that no. To that. No that no. A that that no it that no it that no. So that no and that when. The that yes that no it that no that. The that that no it. The that no that. The that that no that. The that that no that. The that no that. The that that no that. The that that. The that no that. The that no that. The that no that. The that no they that. The that that. The that that no that that no that. The that that no that that no that could that that. The that that that no that no that that. The that that no that that if that no that. The that that this that no that there that no that no that. The that that which no that which that not that. The that no that that no that will that there that no that which no that. The that that which that that no that that no that. The that that no that what is no that no that how they that no that those are the that. The that that what that that they are they that no that no that no that will that no that which the that that to that that no that that. The that no that will which no that. The that no that that which they that is that which they are that of which no that no that that to which that that that which they are that which will no that that that. The that that there no that which they that how no that no that which they are which no that which they are that which to that that which they are those no that which they are that no that which they are that which that which they are not that they are not those who are that that no that which they are that which they are not that which they are not that they are that which no that which they are to that that which they are to that no that which they are to no that which they are that which they are to that that which they are to no that which they are to. The ones no that they are not that which they are to no that which they are to that that which they are not that which that which they are not that which they are to that that which they are to no that which they are to no that which they are to no that +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +I remember I do I you use the. +Aime although it is actually the days when it is the for it to be the + +How then I do used the. +How then I are for the + Wh the. +How and I are for the for an are for +I have for and for the for the a to be for +I for to be for +I for to be for and have for and +I for to be for and then for to be for and I have for to be for. +I have for and I have for to be for and I have for to be for. +I have for and for I have for to be for and I have for to be for and I have for to be for and I have for to be for. +I have for to be for and I have for to be for and I have for to be for and I have for to be for and I have for to be for and I have for to be for and I have for to be for and I have for to be for and I have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and I have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have for to be for and i have +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +What is the fields of the year, of which are the information of the year, and the, the amount of the, field of the year, as the, the the is the of that artificial, the,, and fields. + +what is the of artificial, the, with the fields of being the amount of the,, and the of. + +The fields of the is, the. The and the are the amount of the, and the artificial, the, for the field, and the. + + The fields of the is the and and the amount of the for. The artificial, the an, and the the of, with the and of. The artificial, the the and for the the and. The amount of the fields of the and, the and and the and the artificial the and the and for the. The fields of the and and the amount of the artificial, natural, the and, the the, and natural, the for the fields of the fields. The and the artificial, natural the and are the amount of the fields and the artificial, the fields. + The amount of the and, the and, the natural and, natural the fields of the artificial, the artificial, the and, the amount of the artificial, natural, the fields, the artificial, natural the fields and the artificial, natural the and, the amount of the artificial, natural the artificial, natural the artificial, natural the fields. the the the,, the and, the and, the natural the artificial the artificial, natural the artificial, and natural the amount of the artificial, natural the and, the artificial the artificial, natural the artificial fields and the amount of the artificial, the and, natural the and, the artificial and natural the fields, natural the artificial the and, the artificial and natural the amount of the artificial, natural the artificial and natural the amount of the artificial, natural the artificial fields, natural the amount of the artificial fields and natural the amount of the artificial fields and natural the artificial fields and natural the amount of the artificial fields and natural the amount of the artificial fields and natural the amount of the artificial fields and natural the amount of the artificial fields and natural the amount of the artificial fields and natural the amount of artificial the artificial fields and natural the amount of artificial fields and natural the amount of the artificial fields +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_7_layers_3_10_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 341.2 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +In the 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +A. If any are left. + +If any are left. + + if any are left. + + the sheep were left. + + sheep and if were left. + + if any are sheep. + + the sheep were left. + + if any is left were sheep. + + If who are left. + + the sheep were left. + + the sheep were left. + + The sheep were left. + + Who are, but, who, are, the sheep, left. + + who are, are left. + + who, the sheep, left. + + which, the sheep, left. + + the sheep, left. + + the sheep, left. + + who, the sheep, left. + + the sheep, left. + + who the sheep, left. + + the sheep, left. + + the sheep, left. + + who the sheep, left. + + the sheep, left. + + the sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left. + + The sheep, left +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +I know I'll be I need to look it back. I've been it it's, I've it, I get. I've it to have but it is but it that. I've it I get. I've it. I have it. I have to get that. I have to be that. I have to be that. I have to be that. I have to be that. I have to be that. I have that. I have, I have to be the that is that. I have that. I have to be that. I have that. I have that. I have to be that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have that. I have have that. I have that. I that that. I have that. I have that. I that that that that that. I have that. I have that. I have that that that that that I will that that I have that that that you have that I have that your are that you have that. I that that that that that I that that that I that that that they have that I have that that I have that I have that that I have that is that they have that i that i that I have that i have that i that i that i that i that i that i that I have that i have the i that is that I that that I that i that i that i that I that I that i that i that i that i that I that i that I that I that i that i that I that i that i that i that I that i that i that I that I that i that I that i that I that i the I that that i that I that i that i that I that I that i that I that i that I that i that I that I that i that I that i that I that i to I that i that i that I that i that I that I that i that I that i that I that i that I that i that I that i that I that i that I +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +1 2 4 5 6 10. 12 2 10 2 10. 12 12 12 5 10. 12 10. 12 10. 10 12 2 10 10. 12 5 10. 12 5 12 10. 12 12 10. 12 10. 12 10. 10. 10.1 12 10. 10 10. 10. 10. 12 10. 10. 10. 10 10. 12 10. 10. 12 10. 10. 10. 12 12 10. 10. 12 12 10. 10. 10. 12 10. 10. 10. 12 10. 12 10. 12 10. 12 10. 12 10. 10. 10. 10. 12 10. 12 10. 10. 10. 10. 10. 12 10. 10. 10. 10. 12 10. 10. 10. 10. 12 10. 10. 10. 12 12 10. 10. 10. 10. 12 10. 10. 10. 10. 12 10. 10. 10. 10. 12 12 10. 10. 10. 10. 12 10. 12 10. 10. 12 10. 10. 10. 12 10. 10 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +Write to show you the Python to create if a to and to be three to be to the Python Python to be to a to. + +Write to. to the Python to to be a to, to to be the to be a to, to be a to. to to be to. to be to be to be a to a to be a to be a to the Python to to be a to be four times a to be four times a to be a to be four times a to be and to be six times to be a to be a to be six to be six times a to be six times a to be times to be six to be six times, to to be a to be six times a we six we a to be times a we six times to be six times a times a times a times a times we times a times, to to be a to be six times, to be six times, to be six times, to be six times. to be a to be six times six times six to be six times six times six to be six times six times six to be six times six times six to be six times six times two times six to be six times six to be six times six we a times six times six to six times six to be six times six times six we six to six times six to be six times six we six times six for six six times six to six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six six +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +A Python way to solve this, is not in Python. + +To write +(x, y, and, isn't in, the and the, the, isn't in, the, give the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the ( the, all the, all the, all the, but the the, and the ( isn't in and the, isn't in the, isn't in the and the. to the, vector +( isn't in and the, the, the, the, the, the, the, the, the, the, the, they, the, the, the, the, the, the, the, the the, the, is not in and the, isn't in the, isn't in the, isn't in and the, isn't in and the a the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the, the to, the, the, the, the, the, the - the, isn't in and the, isn't in and the, isn't in the, isn't in. the and the, is not in and the a the, the, the, the -, and the - the, the, the, the - the - the, the - the, the, the - the, the - the - the, the - the - the, the, the - the, the - the, the, the, the, the, the, the - the - the - the - the the - the, the - they, the to, the - the - the - the - - the, the, the - the - their, the, the, the, the - the - the - the - the - the - the - the - - the - - the, the - the - the - the, the - the - the - the - the - the - the - the - the - the of, the, the, the - the - the - the - the - the of, the - the - the, the - the, the - +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +Well, what is the only continent that is neither? +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` + +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +the story of the story about young children's go to school. The story of the story about ancient children's story. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the story a robot learning to paint. the story of the +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +And no more who no more we we you we and we we you we we we we and we we we we and we we we and we we we and we we and we we and we we and we we and you we and we we we and we we and we we and we we and we we and we and we we and we we we we we we we we we and we we we and we we we we we we we we we we we and we and we to the the the the and we we we and we we we we we we we we and they we we we we we we we and we we we we we we we and we we we we we we we we we we we we and and we we we we we we we we and we we we we we we we we we and we we we we we we we we we we we we we and we we and we we and we we we we we we we we we we we we we we we we we and we we we we we we we we we we and we we we we we we we we we we we we we we and we we we and we we we and we we we we and we we and we we and we we and we we and we we and we we and we we and we we and we we and we we and we we and we we we and we we and we we and we we are we we and we we and we we and we we and we were we we and we we and we we we and we we and we were we we and we were we we and we we and we we we we and we we were we we were we we and we were and we we and we we and we we were and we we we we and we we were and we we we we were and were and were we we were and we we and we we were and we were were were are we were and they we they we were and we were were were we were we we were and we were and they we were and we were we were and were were we we were and were were we we were and we were were were was we and we we were and we were were were were were were were were and we and we were we were we were, we were and were were were were were were were and we were were were were were were were were were were were were were were were were were were to we and we we were +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +It's a trick that can save was a trick that can rain from. It's a trick that can be the trick that rain from the trick that it's a trick that can be the trick that's the trick that it is the trick that can be the trick that is the trick that can be the trick that can be the trick that can be the trick that can be the trick that can be the trick that can be the trick that can be the trick that can be the trick that can be the trick that can be the trick that can be when it can be the trick that can be the trick that can be the trick that can be the trick that can be. +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +In the context, an understanding but a specific use, the but a of the sentence is a field of and as can have an area that can be used to provide a of a field. The current but a but a but but but a of the but a but a but, but a of a for a of a but is the of a of a and of a of a butt and but a of a of a but old and a but a but the an of a but -- but a but, but of a -- of a but be sl, of a but -- of a of a of a but -- an of a been. of a -- but of a of a of a of a of a but -- the of a but -- words, of a but -- --trl b to a - a but, of a of and of to be a of a of a - of a of a of a of a but -- of a a of a - of a of a of a but volunteers a of a but researchers -- of a of a of a of a of a but -- of a of a of a of a of a -- of a of an of a of a of a of a but researchers -- of a of a of a of a but researchers -- of a of a of a but researchers -- of a of a of a of a but researchers -- of a of a of a of a of a of a of a of a of a of a of a of a - of a of a of a of a of a of a of a of a of a of a but researchers -- of a of a of a of a of a - of a of a of a of a of a of a of a of a of a of a of a - of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of being have a of the of a of a of being not of a of from a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of a of +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_8_layers_2_10_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 402.2 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` +100 to make 10 minutes to make 100 +500 to make 100 how many 100, 10 minutes to make 100, 100 to make 100 + 10 minutes to make 100, 100 to make 100 minutes to make 100. how many 100 to make 100 minutes to make 100 minutes to make 100 to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 100 minutes to make 1 +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` +17211 days. w what1723? 172112? 1721112? 1721112? 1721112? 1721112? 172112? 172112. 172112? a 172112 to 172112. +172112? 172112? 1721112? 172112? a 172112 is 172112 to 17212 to 17212. +172112? a 172112 is 172112 to 17212 to 172112. +172112? 1721112 to 17212 to 172112 to 17212 to 172112 or 17211 212 to 17212 to 172112 to 172112. a 172112 to 1722 to 1721112 to 172112 to 172112 to 17212 to 172112 to 172112 to 1702 to 17212 to 172112 to 172112. a 172112 to 172112 to 172112 to 17212 to 172112 to 172112 to 1722 to 172112 to 172112 to 172112 to 17212 to 1721112 to 17212 to 17212 to 17 +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` +00, what is 20, 10 and then you would have 30, you would have 00, 20, what is 00, 15, 15, which is 20, 15 what is 30, 10, what is 00, 15 and 15 what is 0 that 10, 10, 15 is 10, 15 and 1, what are 00, 15, 10, 15 what is 00, 10, 15, 15 is 00, 15 what is 000, 15, 15 is 00, 15 what is 10, 15 is 00, 15 is 15 is 10 is 10, 15 is 00, 15 is 15, 15 is 15 is 00, 15 is 15 is 00, 15 is 15 is 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 15 is 00, 15 is 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 15 is 00, 1 +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` +saying, how is 1. then is 2. this was a, what is 3. then is also 1. what is 2. 1, then 2. then is also 4. which 3 to 1. 1, then 5. This was also 6. to 2. 2, 2, then 6. 0 1. 2, 2, 1. 1, 3. t) 1. 1, then 1. 1, 2. 1. 1. 1. 1. 3, then 1. 2. 1, 2. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1. 1, 2. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. ) 1, 1. 1, 1. 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1. 1, 1 +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +A: Pal and the a twice to be a string is a a in the input question is a a a a the string to be a a a a a a a a b string answer is a a d string what is a d string is a a the d string a is a d string is a string is a a d string is a question is a a a a an an an an a is a d string is a string is a d string is a d string is a question is a a d string is a d string is a string is a d string is a string is a string is a string is a string is a string is a d string is a d string is a string is a d string is a string is a d string is a string is a d string is a string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string par dry is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string is a d string dry is a d string the d string is a d string is a d string is a d string dry is a d string is a d string is a d sentence is a d string is a d string is a d string is a d string is a d string isn a be d string is a d string is a d string par is a d string is a d sentence is a d sentence is a d string is a d sentence is a d string is a d sentence is a d string is a d sentence is a d sentence is a d sentence is a d sentence is a d sentence is a d is a +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +What is not the answers the difference an in a list of the difference the the still the list and difference, the the, the difference is a list of the in. + +What are to be the difference, the difference, the and, a list of the list of the difference, the difference, the difference, in a list of the list of the difference is a list of the difference, in what are the difference, the list of the difference, the difference, an in the for the difference is a list of the list of in the difference, the list of the difference, the difference, the difference, a list of the difference, the difference, a list of the difference, a list of the difference, the list of the difference, in a said the difference, the in the difference, in the difference, the difference, the list of the difference, the difference, the difference, in a, the list of the difference, the the list of the difference, the the list of the number of a the list of the difference, the the list of the difference, the difference, the the list of the difference, in a has the difference, the list of the difference is the difference, the the list of the difference is the difference, in the answer that the difference, the list is the difference, in a, the list of the difference is the list of the difference is the the list of the the, a list of the difference is the list of the difference, the difference, in the answer that the answer is the difference, in a list of the difference in question is the difference of a difference is the list of the number of the list of a list of the difference is the difference, the difference, the the choose the difference is the list in the difference, the the list of the difference is the list of the difference, the list of the answer is the difference is the answer, the list of the difference is the difference, the difference, the the the the still the difference is the list of the difference is the difference is the list of the answer is the difference is the difference, in is the list of the difference is the difference is the list of the difference is the list of the difference is the list of the difference is the difference is the list of the difference, the the is the list of the difference is the difference, the the list of the difference is the answer is the list of the difference is the difference is the difference +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` +The question, Is this by:? +A a by the answer, Is the by way, 20 +the anBy: +The answer, is the by, 20 +the year they, By them, The the, to 20 +the answer, is 20 +the question, is 20 +the answer, is the 20 +the question, is 20 +the question, is 20 + the the by, 20 + the the by, + the By. + The by is to the answer, is 20 + many. + the a by, 20 + the + The answer, is 20 + the + the By 20 + + The answer, is 20 + the the by 9, 20 + the the By of the by, 20 + the by, the A, the words, are a by: 20 + the we 20 + the by, 20 + the + of 20 + the the, 20 + the the the the the the 20 + the30 + the the the the of, + the cannibary to the by is 20 + the by, 20 + the the a, they, the 20 + the by a, by said of was 20 + the by are the of 20 + the by the 20 + the a, they a by is a by 02 + the by, the 20 + the by, the 20 + the by a is 10 + the by a 20 is the of the be of 20, the by a 20 is the of 20, and a by are. what a by, is a by 0. the 20 is a by: + the the by 20 + the 20 is a by by, 20 is to a by 20 is a by a by a a by by a 20 is a by a by a by a by a by a by a by a by a by a by a by a by a +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +@A: + +. + +A: + +@ - + +A: + ++2043 + +. + +@ + +@ + +A: + +. +. + +@ + + @ two hundred years '1984'? + + + +_ The + + A: + +. A + + + - 1984? + +The + the + + A: + +A: + +. A: + + +A: + +##: + +The + A: + +A ( + + A: + +The + + A: +: A: + +A: + +The + + the + The + + A: + +The + + A: + + the A: + +The A: + +A: + + The A: + + the A + + The A: + + A: + +the A: + + A: + + The - + + The A: + + The A: + + The 1984? + + The A: + + The A: + + The 1984? + + The A: + + The A: +: The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: + + The A: +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +The text is: The following reasons here a short a short a short a short a short a short a learning about the text. It is the file about the text is the word which is the text. It is the text is the for the text. It is the text. It is the text is a short a learning about the text. + +This is a short a learning is a long a learning, thes a short a learning is a learning. It is the text is a learning. It is the text is a learning. It is the text is a learning. It is the text is a learning. It is the text is a learning. It is the text is the learning. It is the text is the learning. It is the text is the learning. It is the text is the learning. It is the text is the learning. It is the text is a learning. It is the text is the learning. It is the text is a learning. It a long a learning. It is the learning is a learning. It is the learning is the learning. It is the learning is a learning. It is the learning a learning. Is the learning is a learning. It is the learning is a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. It is the learning a learning. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:4:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3:3: +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` +You don't use a the sun. You also use a the sun and do it does it do you use a and it is it does not use a you. You also use a and it is it will. You also use a and you will use a. You try use a and you will use a. You also use a and + +You are use a and it is it does it do use a and it is it does not use a and use a. You also use a and it is used it is it does not use a and use a. You also use a and you are use a and you are use a and you. You also use a and you are use a and you are use a and you are use a and you are use a and you to use a and you are use a and you are use a. +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` +It includes the information. It includes the field of robots and the artificial intelligence. It includes the information, to use a field of artificial intelligence. It includes the information. It includes the information. It includes the information. It includes the information. It includes the information. It includes the information. It comprises the information. It includes the information. It includes the information. It is a part of the information. It is used the information. It is a part of the information. It includes the information. It including the information. It includes the information. It of the information. It is a part of the information. It is a part of the information. It is a part of the information. It is a part of the information. It is a part of the information. It is a part of the information. It includes the information. It is a part of the information. It includes the information. It includes the information. It includes the information. It is a part of the information. It includes the information. It is a part of the information. It is a part of the information. It includes the information. It is a part of the information. It includes the information. It includes the information. It includes the information. It includes the information. It is a part of the information. It is a part of the information. It is not a part of the information. It is a part of the information. It is a part of the information. It is a part of the information. It includes the information. It includes the information. It includes the information. It includes the information that it is a part of the information. It is a part of the information. It is a part of the information. It is a part of the information. It is a part of the information. It includes the information. It includes the information. It includes the information. It includes the information It includes the information. It includes the information. +It includes the information. It includes the information. It includes the information. It includes the information. It includes the information. It includes the information. It includes the information. It includes the information. It includes the information. It includes the information. It includes the information. It includes the information. It includes the information. It includes the information. It includes the information. It includes the information. It +``` + +--- + +### unsloth_SmolLM2-360M-Instruct_9_layers_4_13_Open-Orca_SlimOrca_8000_ReplaceMe_lstsq_1 + +- **Evaluation Time:** 86.2 seconds +- **Max Length:** 512 +- **Temperature:** 0.7 + +#### Reasoning + +**Prompt (reasoning_1):** If it takes 5 machines 5 minutes to make 5 widgets, how long would it take 100 machines to make 100 widgets? + +**Response:** +``` + +``` + +--- + +**Prompt (reasoning_2):** A farmer has 17 sheep. All but 9 die. How many sheep are left? + +**Response:** +``` + +``` + +--- + +#### Mathematics + +**Prompt (math_1):** What is 15% of 240? + +**Response:** +``` + +``` + +--- + +**Prompt (math_2):** If x + 5 = 12, what is x? + +**Response:** +``` + +``` + +--- + +#### Coding + +**Prompt (coding_1):** Write a Python function to check if a string is a palindrome. + +**Response:** +``` +Here's my list of Python function to check if a string is a palindrome. + +Python function: +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +Python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +python function +``` + +--- + +**Prompt (coding_2):** Explain the difference between a list and a tuple in Python. + +**Response:** +``` +Python has also a number of other versions that are called Python versions. +``` + +--- + +#### General_Knowledge + +**Prompt (general_1):** What is the capital of France? + +**Response:** +``` + +``` + +--- + +**Prompt (general_2):** Who wrote the novel '1984'? + +**Response:** +``` +Metro and Metro have collaborated on a joint release of some original novel '80s classics that have been made into a different decade. The collection was directed by a team of 30 books, all 23 of which were released in 1984 from 1983 to 1984, and were only created for this year in 2015. And the release of the title of this collection is 1989 and the release of the title is 1990. + +The release of 1989 was given to the release of 1995 in the release of 1997 in the release of 1995, the release of 1997 was the release of the release of 1997 in the release of 1997 +24. The release of 1997 was released on the release of 1997 in the release of 1997 +35. The release of 1997 was released on the release of 1997 in the release of 1997 +24. The release of 1997 was released on the release of 1997 in the release of 1997 +1997 +20. The release of 1997 was released on the release of +20 +297 +25 +The release of 2015 +15 +2 +17 +The release of 15 +19 +The release of 1997 +19 +11 +1997 +19 +1997 +1997 + The release of 1997 +1997 +1997 +1997 +19 +1997 +1997 +1997 + The release of 1997 +19 +1997 +1997 +1997 +1997 +1997 +1997 +1997 +1997 +1997 +1997 + The release of 1997 +1997 +1997 +1997 +1997 +1 +``` + +--- + +#### Creative_Writing + +**Prompt (creative_1):** Write a short story about a robot learning to paint. + +**Response:** +``` +As the robot explores a nearby apartment, it finds a wall to paint on the walls, and the walls. The robot paint is painted inside a wall frame painting to paint inside and the walls of the walls. This paints a wall wall paint that has the walls around the wall to paint inside. + +To paint a wall wall paint, the wall is painted to the wall and the wall paint. This wall paint is painted to the wall of the walls. + +In conclusion, the walls of the wall paint have walls with walls the walls of the wall paint, the walls are painted on the walls of the wall. + +In conclusion, the walls of the wall paint are walls of the walls of the wall and the walls are painted on the walls of the walls. +``` + +--- + +#### Instruction_Following + +**Prompt (instruction_following):** Please respond with exactly three words, no more and no less. + +**Response:** +``` +I'm confused and I need to know the truth. +``` + +--- + +#### Common_Sense + +**Prompt (common_sense):** Why do people use umbrellas when it rains? + +**Response:** +``` + +``` + +--- + +#### Summarization + +**Prompt (summarization):** Summarize this in one sentence: Artificial intelligence is a field of computer science that aims to create machines capable of intelligent behavior. It includes machine learning, natural language processing, and robotics. + +**Response:** +``` + +``` --- -**Last Updated:** 2025-09-03 18:25:09 -**Progress:** 55 models completed