7260b1a7e5f9ee987460047d0344a7f8745c5a35488691f344f81d40f6088db5

.gitattributes

@@ -152,3 +152,5 @@ longest_path_with_different_adjacent_characters/meta.json filter=lfs diff=lfs me
 longest_special_path/meta.json filter=lfs diff=lfs merge=lfs -text
 longest_special_path_ii/meta.json filter=lfs diff=lfs merge=lfs -text
 longest_subarray_with_maximum_bitwise_and/meta.json filter=lfs diff=lfs merge=lfs -text
+max_sum_of_a_pair_with_equal_sum_of_digits/meta.json filter=lfs diff=lfs merge=lfs -text
+maximal_score_after_applying_k_operations/meta.json filter=lfs diff=lfs merge=lfs -text

make_three_strings_equal/haskell_tests/Main.hs

@@ -0,0 +1,45 @@
+
+module Main where
+import Test.HUnit
+
+--Program start
+
+--Program end
+
+-- Test cases
+
+test1 :: Test
+test1 = TestCase (assertEqual "for (findMinimumOperations \"abc \"  \"abb \"  \"ab \")," 2 (findMinimumOperations "abc" "abb" "ab"))
+
+test2 :: Test
+test2 = TestCase (assertEqual "for (findMinimumOperations \"dac \"  \"bac \"  \"cac \")," (-1) (findMinimumOperations "dac" "bac" "cac"))
+
+test3 :: Test
+test3 = TestCase (assertEqual "for (findMinimumOperations  \"xqkqhgglsustxvwxndsvkoowxkp \"  \"cbwmjwfuwlcrqbkopolwnzrnevyzbburgnvqteafhoqvtlchnnamkhpgmuduicvnuudtyswtbddkstsjgtaghmtlm \"  \"dhtalmmraervdjgtnmgzmcsajgecrggnuoulouqhllrtdylkhzbbycqfjvneauanmyv \")," (-1) (findMinimumOperations "xqkqhgglsustxvwxndsvkoowxkp" "cbwmjwfuwlcrqbkopolwnzrnevyzbburgnvqteafhoqvtlchnnamkhpgmuduicvnuudtyswtbddkstsjgtaghmtlm" "dhtalmmraervdjgtnmgzmcsajgecrggnuoulouqhllrtdylkhzbbycqfjvneauanmyv"))
+
+test4 :: Test
+test4 = TestCase (assertEqual "for (findMinimumOperations  \"xslmewugvdaaobpgkizaddbwtefynig \"  \"fxnsrpsjrtbswpphrtkulgitmtblkyehrlknotfkpwdqhwualiqchmbzckxzlfzedutuwvglwxzuxodqjxvhv \"  \"hvv \")," (-1) (findMinimumOperations "xslmewugvdaaobpgkizaddbwtefynig" "fxnsrpsjrtbswpphrtkulgitmtblkyehrlknotfkpwdqhwualiqchmbzckxzlfzedutuwvglwxzuxodqjxvhv" "hvv"))
+
+test5 :: Test
+test5 = TestCase (assertEqual "for (findMinimumOperations  \"anklygpkcmezpyvobmzjljirwhsfcxajjhtraogxrlfdsvqd \"  \"fhiujkvaxmufgjzplbfebnxdmywnnovwhvwhmsdcfzcekctcpqsnnhrqigqcuawbdzsxdbqxbuqkdlzpifafjjkrkmgtdrwqfnzj \"  \"mjxuwelhdnscmzfhwetjobbcjnjvbhzocxzlrnaazotckzwsuwrbwmcabfuhompsgdbqzd \")," (-1) (findMinimumOperations "anklygpkcmezpyvobmzjljirwhsfcxajjhtraogxrlfdsvqd" "fhiujkvaxmufgjzplbfebnxdmywnnovwhvwhmsdcfzcekctcpqsnnhrqigqcuawbdzsxdbqxbuqkdlzpifafjjkrkmgtdrwqfnzj" "mjxuwelhdnscmzfhwetjobbcjnjvbhzocxzlrnaazotckzwsuwrbwmcabfuhompsgdbqzd"))
+
+test6 :: Test
+test6 = TestCase (assertEqual "for (findMinimumOperations  \"jmszcpqqaqjlwxuzwgxiyxrjsewdspinqbmpd \"  \"gymnmqbaqqhqqyaimrwdjmanfhkelavaucznszzoxeynonaujfcitqixcthhmohcaaflkfszmzyvgeacgkktlm \"  \"bbazqvqpwchbtkwlbxqgyphthtqnviuvgkcggfafltgeuzgpesslphxunbjpwlnvsoxxxizbkpozsqbuhcjjzpzuzvk \")," (-1) (findMinimumOperations "jmszcpqqaqjlwxuzwgxiyxrjsewdspinqbmpd" "gymnmqbaqqhqqyaimrwdjmanfhkelavaucznszzoxeynonaujfcitqixcthhmohcaaflkfszmzyvgeacgkktlm" "bbazqvqpwchbtkwlbxqgyphthtqnviuvgkcggfafltgeuzgpesslphxunbjpwlnvsoxxxizbkpozsqbuhcjjzpzuzvk"))
+
+test7 :: Test
+test7 = TestCase (assertEqual "for (findMinimumOperations  \"tzwaooirwrsn \"  \"mpcgachqmdsrwuujodvbgcdpxtysqgbnyxhtsew \"  \"czqykpxejfumndejfugzfphgsublykowhdpanouszafciycdwlybbrjatikhaakcpgwwomsubkcshmuqeijrwpi \")," (-1) (findMinimumOperations "tzwaooirwrsn" "mpcgachqmdsrwuujodvbgcdpxtysqgbnyxhtsew" "czqykpxejfumndejfugzfphgsublykowhdpanouszafciycdwlybbrjatikhaakcpgwwomsubkcshmuqeijrwpi"))
+
+test8 :: Test
+test8 = TestCase (assertEqual "for (findMinimumOperations  \"zsahdtrwtdhnrmlqrqxjrnybnmkyaqniruyuc \"  \"sqsgqkmvzuomyfpzpuzssgkmoxuyxzpwyivhzjwjqgqnqjycsofonpba \"  \"hxwoznldoquhoeadtvwgaewvcmlaydyckpyakqnnynmghoptxqtozf \")," (-1) (findMinimumOperations "zsahdtrwtdhnrmlqrqxjrnybnmkyaqniruyuc" "sqsgqkmvzuomyfpzpuzssgkmoxuyxzpwyivhzjwjqgqnqjycsofonpba" "hxwoznldoquhoeadtvwgaewvcmlaydyckpyakqnnynmghoptxqtozf"))
+
+test9 :: Test
+test9 = TestCase (assertEqual "for (findMinimumOperations  \"zucgojgsmpsagsjdanltuwoxqoytjuxgvzaiepiolmrjxaepcjnhgdqxowfntbrftmci \"  \"qhgfnxxmsjjgpdumxjppxydfjfpvcizqgztrhf \"  \"xjmubvjbgyblqtuvjb \")," (-1) (findMinimumOperations "zucgojgsmpsagsjdanltuwoxqoytjuxgvzaiepiolmrjxaepcjnhgdqxowfntbrftmci" "qhgfnxxmsjjgpdumxjppxydfjfpvcizqgztrhf" "xjmubvjbgyblqtuvjb"))
+
+
+-- Grouping test cases
+tests :: Test
+tests = TestList [TestLabel "Test1" test1, TestLabel "Test2" test2, TestLabel "Test3" test3, TestLabel "Test4" test4, TestLabel "Test5" test5, TestLabel "Test6" test6, TestLabel "Test7" test7, TestLabel "Test8" test8, TestLabel "Test9" test9]
+
+-- Running the tests
+main :: IO Counts
+main = runTestTT tests

make_three_strings_equal/java_tests/Main.java

@@ -0,0 +1,21 @@
+
+import static org.junit.jupiter.api.Assertions.*;
+import org.junit.jupiter.api.Test;
+import java.util.List;
+import java.util.Arrays;
+import java.util.ArrayList;
+public class Main {
+    //Program start
+    
+    //Program end
+
+    @Test
+public void test1() {
+    assertEquals(2, findMinimumOperations("abc", "abb", "ab"));
+}
+@Test
+public void test2() {
+    assertEquals(-1, findMinimumOperations("dac", "bac", "cac"));
+}
+
+}

make_three_strings_equal/meta.json

@@ -0,0 +1,107 @@
+{
+    "id": 3207,
+    "name": "make_three_strings_equal",
+    "difficulty": "Easy",
+    "link": "https://leetcode.com/problems/make-three-strings-equal/",
+    "date": "2023-11-12 00:00:00",
+    "task_description": "You are given three strings: `s1`, `s2`, and `s3`. In one operation you can choose one of these strings and delete its **rightmost** character. Note that you **cannot** completely empty a string. Return the _minimum number of operations_ required to make the strings equal_. _If it is impossible to make them equal, return `-1`. **Example 1:** **Input: **s1 = \"abc\", s2 = \"abb\", s3 = \"ab\" **Output: **2 **Explanation: **Deleting the rightmost character from both `s1` and `s2` will result in three equal strings. **Example 2:** **Input: **s1 = \"dac\", s2 = \"bac\", s3 = \"cac\" **Output: **-1 **Explanation:** Since the first letters of `s1` and `s2` differ, they cannot be made equal. **Constraints:** `1 <= s1.length, s2.length, s3.length <= 100` `s1`, `s2` and `s3` consist only of lowercase English letters.",
+    "public_test_cases": [
+        {
+            "label": "Example 1",
+            "input": "s1 = \"abc\", s2 = \"abb\", s3 = \"ab\"",
+            "output": "2 "
+        },
+        {
+            "label": "Example 2",
+            "input": "s1 = \"dac\", s2 = \"bac\", s3 = \"cac\"",
+            "output": "-1 "
+        }
+    ],
+    "private_test_cases": [
+        {
+            "input": [
+                "\"xqkqhgglsustxvwxndsvkoowxkp\"",
+                "\"cbwmjwfuwlcrqbkopolwnzrnevyzbburgnvqteafhoqvtlchnnamkhpgmuduicvnuudtyswtbddkstsjgtaghmtlm\"",
+                "\"dhtalmmraervdjgtnmgzmcsajgecrggnuoulouqhllrtdylkhzbbycqfjvneauanmyv\""
+            ],
+            "output": -1
+        },
+        {
+            "input": [
+                "\"xslmewugvdaaobpgkizaddbwtefynig\"",
+                "\"fxnsrpsjrtbswpphrtkulgitmtblkyehrlknotfkpwdqhwualiqchmbzckxzlfzedutuwvglwxzuxodqjxvhv\"",
+                "\"hvv\""
+            ],
+            "output": -1
+        },
+        {
+            "input": [
+                "\"anklygpkcmezpyvobmzjljirwhsfcxajjhtraogxrlfdsvqd\"",
+                "\"fhiujkvaxmufgjzplbfebnxdmywnnovwhvwhmsdcfzcekctcpqsnnhrqigqcuawbdzsxdbqxbuqkdlzpifafjjkrkmgtdrwqfnzj\"",
+                "\"mjxuwelhdnscmzfhwetjobbcjnjvbhzocxzlrnaazotckzwsuwrbwmcabfuhompsgdbqzd\""
+            ],
+            "output": -1
+        },
+        {
+            "input": [
+                "\"jmszcpqqaqjlwxuzwgxiyxrjsewdspinqbmpd\"",
+                "\"gymnmqbaqqhqqyaimrwdjmanfhkelavaucznszzoxeynonaujfcitqixcthhmohcaaflkfszmzyvgeacgkktlm\"",
+                "\"bbazqvqpwchbtkwlbxqgyphthtqnviuvgkcggfafltgeuzgpesslphxunbjpwlnvsoxxxizbkpozsqbuhcjjzpzuzvk\""
+            ],
+            "output": -1
+        },
+        {
+            "input": [
+                "\"tzwaooirwrsn\"",
+                "\"mpcgachqmdsrwuujodvbgcdpxtysqgbnyxhtsew\"",
+                "\"czqykpxejfumndejfugzfphgsublykowhdpanouszafciycdwlybbrjatikhaakcpgwwomsubkcshmuqeijrwpi\""
+            ],
+            "output": -1
+        },
+        {
+            "input": [
+                "\"zsahdtrwtdhnrmlqrqxjrnybnmkyaqniruyuc\"",
+                "\"sqsgqkmvzuomyfpzpuzssgkmoxuyxzpwyivhzjwjqgqnqjycsofonpba\"",
+                "\"hxwoznldoquhoeadtvwgaewvcmlaydyckpyakqnnynmghoptxqtozf\""
+            ],
+            "output": -1
+        },
+        {
+            "input": [
+                "\"zucgojgsmpsagsjdanltuwoxqoytjuxgvzaiepiolmrjxaepcjnhgdqxowfntbrftmci\"",
+                "\"qhgfnxxmsjjgpdumxjppxydfjfpvcizqgztrhf\"",
+                "\"xjmubvjbgyblqtuvjb\""
+            ],
+            "output": -1
+        },
+        {
+            "input": [
+                "\"yqiutibyecl\"",
+                "\"ongjjorhininybqctpvqbkxkbrnltyraygwcuuhfrsxmhrjntvvmaxqwuilqpdvxundpnxfradws\"",
+                "\"wowepoqzrzpcxmjddthkodjnxjhzzryzcrwsorvgapdusbtmasgilvxtcezlhtdewfhwuqeckoqphhrfr\""
+            ],
+            "output": -1
+        },
+        {
+            "input": [
+                "wnbf",
+                "vjmineuvfutwcsojysykicdwhqpwxpocsgdhtduqeipdpkagrwiqupwiipoaaftqtekjqhfxyqicfcrd",
+                "kduesuwvtmhalmbmozvwutjhxwvanoxgv"
+            ],
+            "output": -1
+        },
+        {
+            "input": [
+                "xvbffebdhdjehgkhvapvmtsabthjjufhtrlhmmeoolxohuwjurdpvogxyzjickyidbnafdllgfpszmrbvarllhwnl",
+                "navygnpkhfpfbseqsupvdwvsvgsxiujwifbxuzylyvficyemqkwlzhlgnnceh",
+                "qhvsytmspzvplezbeemxvyzmdxqrbrxrwuhetdxdiriwztaknjgslnxkrwgwnsflexfwj"
+            ],
+            "output": -1
+        }
+    ],
+    "haskell_template": "findMinimumOperations :: String -> String -> String -> Int\nfindMinimumOperations s1 s2 s3 ",
+    "ocaml_template": "let findMinimumOperations (s1: string) (s2: string) (s3: string) : int =  ",
+    "scala_template": "def findMinimumOperations(s1: String,s2: String,s3: String): Int = { \n    \n}",
+    "java_template": "class Solution {\n    public int findMinimumOperations(String s1, String s2, String s3) {\n        \n    }\n}",
+    "python_template": "class Solution(object):\n    def findMinimumOperations(self, s1, s2, s3):\n        \"\"\"\n        :type s1: str\n        :type s2: str\n        :type s3: str\n        :rtype: int\n        \"\"\"\n        "
+}

make_three_strings_equal/ocaml_tests/main.ml

@@ -0,0 +1,50 @@
+
+module Main = struct
+    open OUnit2
+
+    (* Program start *)
+
+    (* Program end *)
+
+    (* Test cases *)
+    
+let test1 _ = assert_equal 2 (findMinimumOperations "abc" "abb" "ab")
+
+let test2 _ = assert_equal (-1) (findMinimumOperations "dac" "bac" "cac")
+
+let test3 _ = assert_equal (-1) (findMinimumOperations "xqkqhgglsustxvwxndsvkoowxkp" "cbwmjwfuwlcrqbkopolwnzrnevyzbburgnvqteafhoqvtlchnnamkhpgmuduicvnuudtyswtbddkstsjgtaghmtlm" "dhtalmmraervdjgtnmgzmcsajgecrggnuoulouqhllrtdylkhzbbycqfjvneauanmyv")
+
+let test4 _ = assert_equal (-1) (findMinimumOperations "xslmewugvdaaobpgkizaddbwtefynig" "fxnsrpsjrtbswpphrtkulgitmtblkyehrlknotfkpwdqhwualiqchmbzckxzlfzedutuwvglwxzuxodqjxvhv" "hvv")
+
+let test5 _ = assert_equal (-1) (findMinimumOperations "anklygpkcmezpyvobmzjljirwhsfcxajjhtraogxrlfdsvqd" "fhiujkvaxmufgjzplbfebnxdmywnnovwhvwhmsdcfzcekctcpqsnnhrqigqcuawbdzsxdbqxbuqkdlzpifafjjkrkmgtdrwqfnzj" "mjxuwelhdnscmzfhwetjobbcjnjvbhzocxzlrnaazotckzwsuwrbwmcabfuhompsgdbqzd")
+
+let test6 _ = assert_equal (-1) (findMinimumOperations "jmszcpqqaqjlwxuzwgxiyxrjsewdspinqbmpd" "gymnmqbaqqhqqyaimrwdjmanfhkelavaucznszzoxeynonaujfcitqixcthhmohcaaflkfszmzyvgeacgkktlm" "bbazqvqpwchbtkwlbxqgyphthtqnviuvgkcggfafltgeuzgpesslphxunbjpwlnvsoxxxizbkpozsqbuhcjjzpzuzvk")
+
+let test7 _ = assert_equal (-1) (findMinimumOperations "tzwaooirwrsn" "mpcgachqmdsrwuujodvbgcdpxtysqgbnyxhtsew" "czqykpxejfumndejfugzfphgsublykowhdpanouszafciycdwlybbrjatikhaakcpgwwomsubkcshmuqeijrwpi")
+
+let test8 _ = assert_equal (-1) (findMinimumOperations "zsahdtrwtdhnrmlqrqxjrnybnmkyaqniruyuc" "sqsgqkmvzuomyfpzpuzssgkmoxuyxzpwyivhzjwjqgqnqjycsofonpba" "hxwoznldoquhoeadtvwgaewvcmlaydyckpyakqnnynmghoptxqtozf")
+
+let test9 _ = assert_equal (-1) (findMinimumOperations "zucgojgsmpsagsjdanltuwoxqoytjuxgvzaiepiolmrjxaepcjnhgdqxowfntbrftmci" "qhgfnxxmsjjgpdumxjppxydfjfpvcizqgztrhf" "xjmubvjbgyblqtuvjb")
+
+let test10 _ = assert_equal (-1) (findMinimumOperations "yqiutibyecl" "ongjjorhininybqctpvqbkxkbrnltyraygwcuuhfrsxmhrjntvvmaxqwuilqpdvxundpnxfradws" "wowepoqzrzpcxmjddthkodjnxjhzzryzcrwsorvgapdusbtmasgilvxtcezlhtdewfhwuqeckoqphhrfr")
+
+
+    (* Grouping test cases *)
+    let suite = "Test Suite for findMinimumOperations" >::: [
+        
+  "test1" >:: test1;
+  "test2" >:: test2;
+  "test3" >:: test3;
+  "test4" >:: test4;
+  "test5" >:: test5;
+  "test6" >:: test6;
+  "test7" >:: test7;
+  "test8" >:: test8;
+  "test9" >:: test9;
+  "test10" >:: test10;
+    ]
+
+
+    (* Running the tests *)
+    let () = run_test_tt_main suite
+end

make_three_strings_equal/scala_tests/MySuite.scala

@@ -0,0 +1,44 @@
+
+class MySuite extends munit.FunSuite {
+  
+  test("test1") {
+    assertEquals(Main.findMinimumOperations("abc","abb","ab"), 2)
+  }
+
+  test("test2") {
+    assertEquals(Main.findMinimumOperations("dac","bac","cac"), -1)
+  }
+
+  test("test3") {
+    assertEquals(Main.findMinimumOperations("xqkqhgglsustxvwxndsvkoowxkp","cbwmjwfuwlcrqbkopolwnzrnevyzbburgnvqteafhoqvtlchnnamkhpgmuduicvnuudtyswtbddkstsjgtaghmtlm","dhtalmmraervdjgtnmgzmcsajgecrggnuoulouqhllrtdylkhzbbycqfjvneauanmyv"), -1)
+  }
+
+  test("test4") {
+    assertEquals(Main.findMinimumOperations("xslmewugvdaaobpgkizaddbwtefynig","fxnsrpsjrtbswpphrtkulgitmtblkyehrlknotfkpwdqhwualiqchmbzckxzlfzedutuwvglwxzuxodqjxvhv","hvv"), -1)
+  }
+
+  test("test5") {
+    assertEquals(Main.findMinimumOperations("anklygpkcmezpyvobmzjljirwhsfcxajjhtraogxrlfdsvqd","fhiujkvaxmufgjzplbfebnxdmywnnovwhvwhmsdcfzcekctcpqsnnhrqigqcuawbdzsxdbqxbuqkdlzpifafjjkrkmgtdrwqfnzj","mjxuwelhdnscmzfhwetjobbcjnjvbhzocxzlrnaazotckzwsuwrbwmcabfuhompsgdbqzd"), -1)
+  }
+
+  test("test6") {
+    assertEquals(Main.findMinimumOperations("jmszcpqqaqjlwxuzwgxiyxrjsewdspinqbmpd","gymnmqbaqqhqqyaimrwdjmanfhkelavaucznszzoxeynonaujfcitqixcthhmohcaaflkfszmzyvgeacgkktlm","bbazqvqpwchbtkwlbxqgyphthtqnviuvgkcggfafltgeuzgpesslphxunbjpwlnvsoxxxizbkpozsqbuhcjjzpzuzvk"), -1)
+  }
+
+  test("test7") {
+    assertEquals(Main.findMinimumOperations("tzwaooirwrsn","mpcgachqmdsrwuujodvbgcdpxtysqgbnyxhtsew","czqykpxejfumndejfugzfphgsublykowhdpanouszafciycdwlybbrjatikhaakcpgwwomsubkcshmuqeijrwpi"), -1)
+  }
+
+  test("test8") {
+    assertEquals(Main.findMinimumOperations("zsahdtrwtdhnrmlqrqxjrnybnmkyaqniruyuc","sqsgqkmvzuomyfpzpuzssgkmoxuyxzpwyivhzjwjqgqnqjycsofonpba","hxwoznldoquhoeadtvwgaewvcmlaydyckpyakqnnynmghoptxqtozf"), -1)
+  }
+
+  test("test9") {
+    assertEquals(Main.findMinimumOperations("zucgojgsmpsagsjdanltuwoxqoytjuxgvzaiepiolmrjxaepcjnhgdqxowfntbrftmci","qhgfnxxmsjjgpdumxjppxydfjfpvcizqgztrhf","xjmubvjbgyblqtuvjb"), -1)
+  }
+
+  test("test10") {
+    assertEquals(Main.findMinimumOperations("yqiutibyecl","ongjjorhininybqctpvqbkxkbrnltyraygwcuuhfrsxmhrjntvvmaxqwuilqpdvxundpnxfradws","wowepoqzrzpcxmjddthkodjnxjhzzryzcrwsorvgapdusbtmasgilvxtcezlhtdewfhwuqeckoqphhrfr"), -1)
+  }
+
+}

manhattan_distances_of_all_arrangements_of_pieces/haskell_tests/Main.hs

@@ -0,0 +1,45 @@
+
+module Main where
+import Test.HUnit
+
+--Program start
+
+--Program end
+
+-- Test cases
+
+test1 :: Test
+test1 = TestCase (assertEqual "for (distanceSum 2 2 2)," 8 (distanceSum 2 2 2))
+
+test2 :: Test
+test2 = TestCase (assertEqual "for (distanceSum 1 4 3)," 20 (distanceSum 1 4 3))
+
+test3 :: Test
+test3 = TestCase (assertEqual "for (distanceSum 88 243 15262)," 864617655 (distanceSum 88 243 15262))
+
+test4 :: Test
+test4 = TestCase (assertEqual "for (distanceSum 88 478 28002)," 755784665 (distanceSum 88 478 28002))
+
+test5 :: Test
+test5 = TestCase (assertEqual "for (distanceSum 56 1143 37060)," 41260206 (distanceSum 56 1143 37060))
+
+test6 :: Test
+test6 = TestCase (assertEqual "for (distanceSum 34 2927 47404)," 761413360 (distanceSum 34 2927 47404))
+
+test7 :: Test
+test7 = TestCase (assertEqual "for (distanceSum 88 715 62886)," 810421682 (distanceSum 88 715 62886))
+
+test8 :: Test
+test8 = TestCase (assertEqual "for (distanceSum 17 2896 9298)," 489701420 (distanceSum 17 2896 9298))
+
+test9 :: Test
+test9 = TestCase (assertEqual "for (distanceSum 50 180 1709)," 564667214 (distanceSum 50 180 1709))
+
+
+-- Grouping test cases
+tests :: Test
+tests = TestList [TestLabel "Test1" test1, TestLabel "Test2" test2, TestLabel "Test3" test3, TestLabel "Test4" test4, TestLabel "Test5" test5, TestLabel "Test6" test6, TestLabel "Test7" test7, TestLabel "Test8" test8, TestLabel "Test9" test9]
+
+-- Running the tests
+main :: IO Counts
+main = runTestTT tests

manhattan_distances_of_all_arrangements_of_pieces/java_tests/Main.java

@@ -0,0 +1,21 @@
+
+import static org.junit.jupiter.api.Assertions.*;
+import org.junit.jupiter.api.Test;
+import java.util.List;
+import java.util.Arrays;
+import java.util.ArrayList;
+public class Main {
+    //Program start
+    
+    //Program end
+
+    @Test
+public void test1() {
+    assertEquals(8, distanceSum(2, 2, 2));
+}
+@Test
+public void test2() {
+    assertEquals(20, distanceSum(1, 4, 3));
+}
+
+}

manhattan_distances_of_all_arrangements_of_pieces/meta.json

@@ -0,0 +1,107 @@
+{
+    "id": 3739,
+    "name": "manhattan_distances_of_all_arrangements_of_pieces",
+    "difficulty": "Hard",
+    "link": "https://leetcode.com/problems/manhattan-distances-of-all-arrangements-of-pieces/",
+    "date": "2025-01-04 00:00:00",
+    "task_description": "You are given three integers `m`, `n`, and `k`. There is a rectangular grid of size `m × n` containing `k` identical pieces. Return the sum of Manhattan distances between every pair of pieces over all **valid arrangements** of pieces. A **valid arrangement** is a placement of all `k` pieces on the grid with **at most** one piece per cell. Since the answer may be very large, return it **modulo** `109 + 7`. The Manhattan Distance between two cells `(xi, yi)` and `(xj, yj)` is `|xi - xj| + |yi - yj|`. **Example 1:** **Input:** m = 2, n = 2, k = 2 **Output:** 8 **Explanation:** The valid arrangements of pieces on the board are: In the first 4 arrangements, the Manhattan distance between the two pieces is 1. In the last 2 arrangements, the Manhattan distance between the two pieces is 2. Thus, the total Manhattan distance across all valid arrangements is `1 + 1 + 1 + 1 + 2 + 2 = 8`. **Example 2:** **Input:** m = 1, n = 4, k = 3 **Output:** 20 **Explanation:** The valid arrangements of pieces on the board are: The first and last arrangements have a total Manhattan distance of `1 + 1 + 2 = 4`. The middle two arrangements have a total Manhattan distance of `1 + 2 + 3 = 6`. The total Manhattan distance between all pairs of pieces across all arrangements is `4 + 6 + 6 + 4 = 20`. **Constraints:** `1 <= m, n <= 105` `2 <= m * n <= 105` `2 <= k <= m * n`",
+    "public_test_cases": [
+        {
+            "label": "Example 1",
+            "input": "m = 2, n = 2, k = 2",
+            "output": "8 "
+        },
+        {
+            "label": "Example 2",
+            "input": "m = 1, n = 4, k = 3",
+            "output": "20 "
+        }
+    ],
+    "private_test_cases": [
+        {
+            "input": [
+                88,
+                243,
+                15262
+            ],
+            "output": 864617655
+        },
+        {
+            "input": [
+                88,
+                478,
+                28002
+            ],
+            "output": 755784665
+        },
+        {
+            "input": [
+                56,
+                1143,
+                37060
+            ],
+            "output": 41260206
+        },
+        {
+            "input": [
+                34,
+                2927,
+                47404
+            ],
+            "output": 761413360
+        },
+        {
+            "input": [
+                88,
+                715,
+                62886
+            ],
+            "output": 810421682
+        },
+        {
+            "input": [
+                17,
+                2896,
+                9298
+            ],
+            "output": 489701420
+        },
+        {
+            "input": [
+                50,
+                180,
+                1709
+            ],
+            "output": 564667214
+        },
+        {
+            "input": [
+                45,
+                1771,
+                5662
+            ],
+            "output": 572466774
+        },
+        {
+            "input": [
+                35,
+                159,
+                5510
+            ],
+            "output": 212429333
+        },
+        {
+            "input": [
+                13,
+                2267,
+                2152
+            ],
+            "output": 943274957
+        }
+    ],
+    "haskell_template": "distanceSum :: Int -> Int -> Int -> Int\ndistanceSum m n k ",
+    "ocaml_template": "let distanceSum (m: int) (n: int) (k: int) : int =  ",
+    "scala_template": "def distanceSum(m: Int,n: Int,k: Int): Int = { \n    \n}",
+    "java_template": "class Solution {\n    public int distanceSum(int m, int n, int k) {\n        \n    }\n}",
+    "python_template": "class Solution(object):\n    def distanceSum(self, m, n, k):\n        \"\"\"\n        :type m: int\n        :type n: int\n        :type k: int\n        :rtype: int\n        \"\"\"\n        "
+}

manhattan_distances_of_all_arrangements_of_pieces/ocaml_tests/main.ml

@@ -0,0 +1,50 @@
+
+module Main = struct
+    open OUnit2
+
+    (* Program start *)
+
+    (* Program end *)
+
+    (* Test cases *)
+    
+let test1 _ = assert_equal 8 (distanceSum 2 2 2)
+
+let test2 _ = assert_equal 20 (distanceSum 1 4 3)
+
+let test3 _ = assert_equal 864617655 (distanceSum 88 243 15262)
+
+let test4 _ = assert_equal 755784665 (distanceSum 88 478 28002)
+
+let test5 _ = assert_equal 41260206 (distanceSum 56 1143 37060)
+
+let test6 _ = assert_equal 761413360 (distanceSum 34 2927 47404)
+
+let test7 _ = assert_equal 810421682 (distanceSum 88 715 62886)
+
+let test8 _ = assert_equal 489701420 (distanceSum 17 2896 9298)
+
+let test9 _ = assert_equal 564667214 (distanceSum 50 180 1709)
+
+let test10 _ = assert_equal 572466774 (distanceSum 45 1771 5662)
+
+
+    (* Grouping test cases *)
+    let suite = "Test Suite for distanceSum" >::: [
+        
+  "test1" >:: test1;
+  "test2" >:: test2;
+  "test3" >:: test3;
+  "test4" >:: test4;
+  "test5" >:: test5;
+  "test6" >:: test6;
+  "test7" >:: test7;
+  "test8" >:: test8;
+  "test9" >:: test9;
+  "test10" >:: test10;
+    ]
+
+
+    (* Running the tests *)
+    let () = run_test_tt_main suite
+end

manhattan_distances_of_all_arrangements_of_pieces/scala_tests/MySuite.scala

@@ -0,0 +1,44 @@
+
+class MySuite extends munit.FunSuite {
+  
+  test("test1") {
+    assertEquals(Main.distanceSum(2,2,2), 8)
+  }
+
+  test("test2") {
+    assertEquals(Main.distanceSum(1,4,3), 20)
+  }
+
+  test("test3") {
+    assertEquals(Main.distanceSum(88,243,15262), 864617655)
+  }
+
+  test("test4") {
+    assertEquals(Main.distanceSum(88,478,28002), 755784665)
+  }
+
+  test("test5") {
+    assertEquals(Main.distanceSum(56,1143,37060), 41260206)
+  }
+
+  test("test6") {
+    assertEquals(Main.distanceSum(34,2927,47404), 761413360)
+  }
+
+  test("test7") {
+    assertEquals(Main.distanceSum(88,715,62886), 810421682)
+  }
+
+  test("test8") {
+    assertEquals(Main.distanceSum(17,2896,9298), 489701420)
+  }
+
+  test("test9") {
+    assertEquals(Main.distanceSum(50,180,1709), 564667214)
+  }
+
+  test("test10") {
+    assertEquals(Main.distanceSum(45,1771,5662), 572466774)
+  }
+
+}

match_substring_after_replacement/haskell_tests/Main.hs

@@ -0,0 +1,27 @@
+
+module Main where
+import Test.HUnit
+
+--Program start
+
+--Program end
+
+-- Test cases
+
+test1 :: Test
+test1 = TestCase (assertEqual "for (matchReplacement \"fool3e7bar \"  \"leet \" [[ \"e \", \"3 \"],[ \"t \", \"7 \"],[ \"t \", \"8 \"]])," True (matchReplacement "fool3e7bar" "leet" [["e","3"],["t","7"],["t","8"]]))
+
+test2 :: Test
+test2 = TestCase (assertEqual "for (matchReplacement \"fooleetbar \"  \"f00l \" [[ \"o \", \"0 \"]])," False (matchReplacement "fooleetbar" "f00l" [["o","0"]]))
+
+test3 :: Test
+test3 = TestCase (assertEqual "for (matchReplacement \"Fool33tbaR \"  \"leetd \" [[ \"e \", \"3 \"],[ \"t \", \"7 \"],[ \"t \", \"8 \"],[ \"d \", \"b \"],[ \"p \", \"b \"]])," True (matchReplacement "Fool33tbaR" "leetd" [["e","3"],["t","7"],["t","8"],["d","b"],["p","b"]]))
+
+
+-- Grouping test cases
+tests :: Test
+tests = TestList [TestLabel "Test1" test1, TestLabel "Test2" test2]
+
+-- Running the tests
+main :: IO Counts
+main = runTestTT tests

match_substring_after_replacement/java_tests/Main.java

@@ -0,0 +1,25 @@
+
+import static org.junit.jupiter.api.Assertions.*;
+import org.junit.jupiter.api.Test;
+import java.util.List;
+import java.util.Arrays;
+import java.util.ArrayList;
+public class Main {
+    //Program start
+    
+    //Program end
+
+    @Test
+public void test1() {
+    assertEquals(true, matchReplacement("fool3e7bar", "leet", new ArrayList<>(Arrays.asList(new ArrayList<>(Arrays.asList("e","3")),new ArrayList<>(Arrays.asList("t","7")),new ArrayList<>(Arrays.asList("t","8"))))));
+}
+@Test
+public void test2() {
+    assertEquals(false, matchReplacement("fooleetbar", "f00l", new ArrayList<>(Arrays.asList(new ArrayList<>(Arrays.asList("o","0"))))));
+}
+@Test
+public void test3() {
+    assertEquals(true, matchReplacement("Fool33tbaR", "leetd", new ArrayList<>(Arrays.asList(new ArrayList<>(Arrays.asList("e","3")),new ArrayList<>(Arrays.asList("t","7")),new ArrayList<>(Arrays.asList("t","8")),new ArrayList<>(Arrays.asList("d","b")),new ArrayList<>(Arrays.asList("p","b"))))));
+}
+
+}

match_substring_after_replacement/meta.json

@@ -0,0 +1,31 @@
+{
+    "id": 2393,
+    "name": "match_substring_after_replacement",
+    "difficulty": "Hard",
+    "link": "https://leetcode.com/problems/match-substring-after-replacement/",
+    "date": "1653696000000",
+    "task_description": "You are given two strings `s` and `sub`. You are also given a 2D character array `mappings` where `mappings[i] = [oldi, newi]` indicates that you may perform the following operation **any** number of times: **Replace** a character `oldi` of `sub` with `newi`. Each character in `sub` **cannot** be replaced more than once. Return `true`_ if it is possible to make _`sub`_ a substring of _`s`_ by replacing zero or more characters according to _`mappings`. Otherwise, return `false`. A **substring** is a contiguous non-empty sequence of characters within a string. **Example 1:** ``` **Input:** s = \"fool3e7bar\", sub = \"leet\", mappings = [[\"e\",\"3\"],[\"t\",\"7\"],[\"t\",\"8\"]] **Output:** true **Explanation:** Replace the first 'e' in sub with '3' and 't' in sub with '7'. Now sub = \"l3e7\" is a substring of s, so we return true. ``` **Example 2:** ``` **Input:** s = \"fooleetbar\", sub = \"f00l\", mappings = [[\"o\",\"0\"]] **Output:** false **Explanation:** The string \"f00l\" is not a substring of s and no replacements can be made. Note that we cannot replace '0' with 'o'. ``` **Example 3:** ``` **Input:** s = \"Fool33tbaR\", sub = \"leetd\", mappings = [[\"e\",\"3\"],[\"t\",\"7\"],[\"t\",\"8\"],[\"d\",\"b\"],[\"p\",\"b\"]] **Output:** true **Explanation:** Replace the first and second 'e' in sub with '3' and 'd' in sub with 'b'. Now sub = \"l33tb\" is a substring of s, so we return true. ``` **Constraints:** `1 <= sub.length <= s.length <= 5000` `0 <= mappings.length <= 1000` `mappings[i].length == 2` `oldi != newi` `s` and `sub` consist of uppercase and lowercase English letters and digits. `oldi` and `newi` are either uppercase or lowercase English letters or digits.",
+    "public_test_cases": [
+        {
+            "label": "Example 1",
+            "input": "s = \"fool3e7bar\", sub = \"leet\", mappings = [[\"e\",\"3\"],[\"t\",\"7\"],[\"t\",\"8\"]]",
+            "output": "true "
+        },
+        {
+            "label": "Example 2",
+            "input": "s = \"fooleetbar\", sub = \"f00l\", mappings = [[\"o\",\"0\"]]",
+            "output": "false "
+        },
+        {
+            "label": "Example 3",
+            "input": "s = \"Fool33tbaR\", sub = \"leetd\", mappings = [[\"e\",\"3\"],[\"t\",\"7\"],[\"t\",\"8\"],[\"d\",\"b\"],[\"p\",\"b\"]]",
+            "output": "true "
+        }
+    ],
+    "private_test_cases": [],
+    "haskell_template": "matchReplacement :: String -> String -> [[String]] -> Bool\nmatchReplacement s sub mappings ",
+    "ocaml_template": "let matchReplacement (s: string) (sub: string) (mappings: string list list) : bool =  ",
+    "scala_template": "def matchReplacement(s: String,sub: String,mappings: List[List[String]]): Boolean = { \n    \n}",
+    "java_template": "public static boolean matchReplacement(String s, String sub, List<List<String>> mappings) {\n\n}",
+    "python_template": "class Solution(object):\n    def matchReplacement(self, s, sub, mappings):\n        \"\"\"\n        :type s: str\n        :type sub: str\n        :type mappings: List[List[str]]\n        :rtype: bool\n        \"\"\"\n        "
+}

match_substring_after_replacement/ocaml_tests/main.ml

@@ -0,0 +1,29 @@
+
+module Main = struct
+    open OUnit2
+
+    (* Program start *)
+
+    (* Program end *)
+
+    (* Test cases *)
+    
+let test1 _ = assert_equal true (matchReplacement "fool3e7bar" "leet" [["e";"3"];["t";"7"];["t";"8"]])
+
+let test2 _ = assert_equal false (matchReplacement "fooleetbar" "f00l" [["o";"0"]])
+
+let test3 _ = assert_equal true (matchReplacement "Fool33tbaR" "leetd" [["e";"3"];["t";"7"];["t";"8"];["d";"b"];["p";"b"]])
+
+
+    (* Grouping test cases *)
+    let suite = "Test Suite for matchReplacement" >::: [
+        
+  "test1" >:: test1;
+  "test2" >:: test2;
+  "test3" >:: test3;
+    ]
+
+
+    (* Running the tests *)
+    let () = run_test_tt_main suite
+end

match_substring_after_replacement/scala_tests/MySuite.scala

@@ -0,0 +1,16 @@
+
+class MySuite extends munit.FunSuite {
+  
+  test("test1") {
+    assertEquals(Main.matchReplacement("fool3e7bar","leet",[["e","3"],["t","7"],["t","8"]]), true)
+  }
+
+  test("test2") {
+    assertEquals(Main.matchReplacement("fooleetbar","f00l",[["o","0"]]), false)
+  }
+
+  test("test3") {
+    assertEquals(Main.matchReplacement("Fool33tbaR","leetd",[["e","3"],["t","7"],["t","8"],["d","b"],["p","b"]]), true)
+  }
+
+}

matrix_similarity_after_cyclic_shifts/haskell_tests/Main.hs

@@ -0,0 +1,45 @@
+
+module Main where
+import Test.HUnit
+
+--Program start
+
+--Program end
+
+-- Test cases
+
+test1 :: Test
+test1 = TestCase (assertEqual "for (areSimilar [[1,2,3],[4,5,6],[7,8,9]] 4)," False (areSimilar [[1,2,3],[4,5,6],[7,8,9]] 4))
+
+test2 :: Test
+test2 = TestCase (assertEqual "for (areSimilar [[1,2,1,2],[5,5,5,5],[6,3,6,3]] 2)," True (areSimilar [[1,2,1,2],[5,5,5,5],[6,3,6,3]] 2))
+
+test3 :: Test
+test3 = TestCase (assertEqual "for (areSimilar [[2,2],[2,2]] 3)," True (areSimilar [[2,2],[2,2]] 3))
+
+test4 :: Test
+test4 = TestCase (assertEqual "for (areSimilar [[6, 24, 22, 21, 22, 13, 23, 5, 25, 19, 1, 5, 10], [2, 22, 6, 14, 8, 14, 5, 12, 24, 9, 19, 6, 9], [16, 25, 21, 2, 3, 23, 3, 20, 8, 23, 14, 5, 21], [16, 19, 21, 11, 5, 17, 23, 12, 1, 10, 1, 18, 16], [11, 11, 7, 24, 15, 13, 12, 21, 15, 11, 10, 13, 3], [6, 2, 20, 25, 5, 8, 7, 24, 13, 16, 23, 14, 13], [11, 12, 10, 3, 18, 13, 8, 13, 24, 3, 6, 10, 5], [4, 2, 18, 3, 23, 4, 24, 14, 7, 11, 13, 23, 1], [19, 20, 22, 12, 12, 8, 13, 1, 18, 17, 10, 20, 12], [17, 8, 18, 6, 1, 24, 19, 4, 12, 20, 25, 8, 13], [2, 21, 7, 17, 15, 25, 6, 4, 12, 6, 11, 12, 13], [23, 2, 15, 2, 3, 25, 6, 4, 18, 19, 18, 10, 15], [10, 12, 17, 19, 9, 11, 23, 20, 11, 16, 24, 8, 18], [7, 1, 5, 2, 10, 22, 8, 23, 16, 13, 19, 6, 9], [7, 20, 12, 6, 13, 17, 10, 21, 20, 11, 21, 8, 15], [7, 2, 5, 22, 10, 9, 24, 11, 23, 11, 17, 23, 16], [22, 23, 20, 18, 11, 5, 20, 24, 5, 24, 15, 9, 8]] 30)," False (areSimilar [[6, 24, 22, 21, 22, 13, 23, 5, 25, 19, 1, 5, 10], [2, 22, 6, 14, 8, 14, 5, 12, 24, 9, 19, 6, 9], [16, 25, 21, 2, 3, 23, 3, 20, 8, 23, 14, 5, 21], [16, 19, 21, 11, 5, 17, 23, 12, 1, 10, 1, 18, 16], [11, 11, 7, 24, 15, 13, 12, 21, 15, 11, 10, 13, 3], [6, 2, 20, 25, 5, 8, 7, 24, 13, 16, 23, 14, 13], [11, 12, 10, 3, 18, 13, 8, 13, 24, 3, 6, 10, 5], [4, 2, 18, 3, 23, 4, 24, 14, 7, 11, 13, 23, 1], [19, 20, 22, 12, 12, 8, 13, 1, 18, 17, 10, 20, 12], [17, 8, 18, 6, 1, 24, 19, 4, 12, 20, 25, 8, 13], [2, 21, 7, 17, 15, 25, 6, 4, 12, 6, 11, 12, 13], [23, 2, 15, 2, 3, 25, 6, 4, 18, 19, 18, 10, 15], [10, 12, 17, 19, 9, 11, 23, 20, 11, 16, 24, 8, 18], [7, 1, 5, 2, 10, 22, 8, 23, 16, 13, 19, 6, 9], [7, 20, 12, 6, 13, 17, 10, 21, 20, 11, 21, 8, 15], [7, 2, 5, 22, 10, 9, 24, 11, 23, 11, 17, 23, 16], [22, 23, 20, 18, 11, 5, 20, 24, 5, 24, 15, 9, 8]] 30))
+
+test5 :: Test
+test5 = TestCase (assertEqual "for (areSimilar [[1, 15, 17, 4, 14, 1, 3, 19, 20, 18, 16, 19, 8, 2], [11, 13, 14, 24, 12, 19, 25, 15, 16, 12, 12, 15, 1, 22], [24, 5, 23, 25, 17, 19, 2, 1, 14, 20, 11, 6, 16, 16], [1, 14, 21, 11, 20, 3, 19, 7, 11, 1, 2, 1, 21, 24], [11, 15, 7, 19, 22, 19, 5, 14, 12, 19, 12, 11, 12, 1], [23, 24, 18, 2, 4, 17, 22, 16, 12, 24, 20, 11, 23, 16], [8, 8, 22, 10, 4, 10, 7, 22, 21, 6, 21, 9, 23, 21], [15, 8, 22, 18, 13, 24, 3, 11, 23, 2, 19, 14, 17, 11]] 11)," False (areSimilar [[1, 15, 17, 4, 14, 1, 3, 19, 20, 18, 16, 19, 8, 2], [11, 13, 14, 24, 12, 19, 25, 15, 16, 12, 12, 15, 1, 22], [24, 5, 23, 25, 17, 19, 2, 1, 14, 20, 11, 6, 16, 16], [1, 14, 21, 11, 20, 3, 19, 7, 11, 1, 2, 1, 21, 24], [11, 15, 7, 19, 22, 19, 5, 14, 12, 19, 12, 11, 12, 1], [23, 24, 18, 2, 4, 17, 22, 16, 12, 24, 20, 11, 23, 16], [8, 8, 22, 10, 4, 10, 7, 22, 21, 6, 21, 9, 23, 21], [15, 8, 22, 18, 13, 24, 3, 11, 23, 2, 19, 14, 17, 11]] 11))
+
+test6 :: Test
+test6 = TestCase (assertEqual "for (areSimilar [[1, 14, 3, 11, 7, 16, 2, 22, 21, 23, 6], [21, 22, 11, 10, 16, 1, 23, 11, 7, 11, 20], [14, 3, 25, 16, 13, 23, 14, 21, 2, 12, 14], [2, 3, 18, 25, 21, 5, 15, 19, 4, 10, 22], [23, 16, 25, 19, 6, 10, 13, 12, 7, 20, 3], [13, 21, 17, 5, 11, 8, 22, 10, 5, 18, 14], [18, 2, 12, 24, 12, 11, 4, 7, 24, 18, 2], [25, 14, 20, 14, 4, 20, 25, 17, 7, 24, 15], [16, 24, 11, 13, 23, 2, 18, 13, 11, 20, 22], [13, 24, 21, 15, 1, 6, 2, 12, 11, 23, 20], [5, 19, 4, 5, 6, 4, 1, 9, 6, 25, 15], [4, 24, 11, 14, 17, 3, 3, 4, 24, 14, 15], [15, 13, 23, 25, 24, 22, 4, 3, 11, 1, 10], [11, 3, 7, 12, 7, 22, 8, 17, 19, 5, 21], [13, 7, 14, 2, 23, 1, 3, 13, 3, 15, 21], [22, 13, 23, 12, 16, 11, 17, 14, 6, 19, 3], [18, 12, 12, 23, 13, 1, 16, 2, 13, 10, 3], [2, 9, 12, 18, 23, 24, 19, 14, 1, 1, 21], [1, 2, 17, 22, 14, 14, 21, 19, 1, 21, 16], [14, 23, 12, 13, 20, 16, 1, 5, 13, 25, 2]] 3)," False (areSimilar [[1, 14, 3, 11, 7, 16, 2, 22, 21, 23, 6], [21, 22, 11, 10, 16, 1, 23, 11, 7, 11, 20], [14, 3, 25, 16, 13, 23, 14, 21, 2, 12, 14], [2, 3, 18, 25, 21, 5, 15, 19, 4, 10, 22], [23, 16, 25, 19, 6, 10, 13, 12, 7, 20, 3], [13, 21, 17, 5, 11, 8, 22, 10, 5, 18, 14], [18, 2, 12, 24, 12, 11, 4, 7, 24, 18, 2], [25, 14, 20, 14, 4, 20, 25, 17, 7, 24, 15], [16, 24, 11, 13, 23, 2, 18, 13, 11, 20, 22], [13, 24, 21, 15, 1, 6, 2, 12, 11, 23, 20], [5, 19, 4, 5, 6, 4, 1, 9, 6, 25, 15], [4, 24, 11, 14, 17, 3, 3, 4, 24, 14, 15], [15, 13, 23, 25, 24, 22, 4, 3, 11, 1, 10], [11, 3, 7, 12, 7, 22, 8, 17, 19, 5, 21], [13, 7, 14, 2, 23, 1, 3, 13, 3, 15, 21], [22, 13, 23, 12, 16, 11, 17, 14, 6, 19, 3], [18, 12, 12, 23, 13, 1, 16, 2, 13, 10, 3], [2, 9, 12, 18, 23, 24, 19, 14, 1, 1, 21], [1, 2, 17, 22, 14, 14, 21, 19, 1, 21, 16], [14, 23, 12, 13, 20, 16, 1, 5, 13, 25, 2]] 3))
+
+test7 :: Test
+test7 = TestCase (assertEqual "for (areSimilar [[5, 19, 18, 7, 3, 23, 2], [24, 17, 24, 19, 3, 24, 1], [12, 11, 22, 22, 5, 24, 17], [7, 12, 1, 16, 2, 16, 21], [17, 8, 15, 22, 24, 8, 16], [2, 13, 14, 14, 9, 12, 22], [16, 18, 24, 19, 18, 2, 19], [3, 6, 12, 3, 1, 1, 3], [4, 2, 13, 3, 14, 4, 17], [16, 3, 1, 25, 10, 6, 21]] 25)," False (areSimilar [[5, 19, 18, 7, 3, 23, 2], [24, 17, 24, 19, 3, 24, 1], [12, 11, 22, 22, 5, 24, 17], [7, 12, 1, 16, 2, 16, 21], [17, 8, 15, 22, 24, 8, 16], [2, 13, 14, 14, 9, 12, 22], [16, 18, 24, 19, 18, 2, 19], [3, 6, 12, 3, 1, 1, 3], [4, 2, 13, 3, 14, 4, 17], [16, 3, 1, 25, 10, 6, 21]] 25))
+
+test8 :: Test
+test8 = TestCase (assertEqual "for (areSimilar [[21, 5, 16, 21, 9, 11, 5, 22, 17, 2, 23, 15, 9, 13, 14, 8, 12, 21, 7, 22, 13, 18, 1], [13, 11, 3, 7, 20, 16, 13, 10, 24, 23, 15, 17, 21, 24, 19, 22, 2, 3, 25, 3, 21, 24, 23], [16, 10, 1, 5, 22, 6, 18, 5, 22, 12, 10, 18, 16, 12, 3, 9, 7, 11, 15, 8, 10, 8, 12], [3, 11, 13, 16, 9, 3, 12, 3, 20, 2, 11, 13, 17, 10, 13, 1, 2, 1, 14, 17, 23, 15, 22], [19, 24, 17, 6, 3, 5, 2, 11, 13, 9, 24, 19, 23, 13, 20, 13, 1, 15, 17, 10, 25, 25, 3], [6, 10, 22, 15, 17, 5, 13, 7, 1, 13, 21, 3, 24, 24, 9, 1, 10, 5, 8, 2, 18, 16, 21]] 11)," False (areSimilar [[21, 5, 16, 21, 9, 11, 5, 22, 17, 2, 23, 15, 9, 13, 14, 8, 12, 21, 7, 22, 13, 18, 1], [13, 11, 3, 7, 20, 16, 13, 10, 24, 23, 15, 17, 21, 24, 19, 22, 2, 3, 25, 3, 21, 24, 23], [16, 10, 1, 5, 22, 6, 18, 5, 22, 12, 10, 18, 16, 12, 3, 9, 7, 11, 15, 8, 10, 8, 12], [3, 11, 13, 16, 9, 3, 12, 3, 20, 2, 11, 13, 17, 10, 13, 1, 2, 1, 14, 17, 23, 15, 22], [19, 24, 17, 6, 3, 5, 2, 11, 13, 9, 24, 19, 23, 13, 20, 13, 1, 15, 17, 10, 25, 25, 3], [6, 10, 22, 15, 17, 5, 13, 7, 1, 13, 21, 3, 24, 24, 9, 1, 10, 5, 8, 2, 18, 16, 21]] 11))
+
+test9 :: Test
+test9 = TestCase (assertEqual "for (areSimilar [[12, 3, 5, 13, 16, 20, 16, 3, 11, 5, 11, 19, 20, 17, 21, 6, 14, 8, 14, 7, 20, 17, 25, 18]] 28)," False (areSimilar [[12, 3, 5, 13, 16, 20, 16, 3, 11, 5, 11, 19, 20, 17, 21, 6, 14, 8, 14, 7, 20, 17, 25, 18]] 28))
+
+
+-- Grouping test cases
+tests :: Test
+tests = TestList [TestLabel "Test1" test1, TestLabel "Test2" test2, TestLabel "Test3" test3, TestLabel "Test4" test4, TestLabel "Test5" test5, TestLabel "Test6" test6, TestLabel "Test7" test7, TestLabel "Test8" test8, TestLabel "Test9" test9]
+
+-- Running the tests
+main :: IO Counts
+main = runTestTT tests

matrix_similarity_after_cyclic_shifts/java_tests/Main.java

@@ -0,0 +1,25 @@
+
+import static org.junit.jupiter.api.Assertions.*;
+import org.junit.jupiter.api.Test;
+import java.util.List;
+import java.util.Arrays;
+import java.util.ArrayList;
+public class Main {
+    //Program start
+    
+    //Program end
+
+    @Test
+public void test1() {
+    assertEquals(false, areSimilar(new ArrayList<>(Arrays.asList(new ArrayList<>(Arrays.asList(1,2,3)),new ArrayList<>(Arrays.asList(4,5,6)),new ArrayList<>(Arrays.asList(7,8,9)))), 4));
+}
+@Test
+public void test2() {
+    assertEquals(true, areSimilar(new ArrayList<>(Arrays.asList(new ArrayList<>(Arrays.asList(1,2,1,2)),new ArrayList<>(Arrays.asList(5,5,5,5)),new ArrayList<>(Arrays.asList(6,3,6,3)))), 2));
+}
+@Test
+public void test3() {
+    assertEquals(true, areSimilar(new ArrayList<>(Arrays.asList(new ArrayList<>(Arrays.asList(2,2)),new ArrayList<>(Arrays.asList(2,2)))), 3));
+}
+
+}

matrix_similarity_after_cyclic_shifts/meta.json

@@ -0,0 +1,1283 @@
+{
+    "id": 3215,
+    "name": "matrix_similarity_after_cyclic_shifts",
+    "difficulty": "Easy",
+    "link": "https://leetcode.com/problems/matrix-similarity-after-cyclic-shifts/",
+    "date": "2023-11-19 00:00:00",
+    "task_description": "You are given an `m x n` integer matrix `mat` and an integer `k`. The matrix rows are 0-indexed. The following proccess happens `k` times: **Even-indexed** rows (0, 2, 4, ...) are cyclically shifted to the left. **Odd-indexed** rows (1, 3, 5, ...) are cyclically shifted to the right. Return `true` if the final modified matrix after `k` steps is identical to the original matrix, and `false` otherwise. **Example 1:** **Input:** mat = [[1,2,3],[4,5,6],[7,8,9]], k = 4 **Output:** false **Explanation:** In each step left shift is applied to rows 0 and 2 (even indices), and right shift to row 1 (odd index). **Example 2:** **Input:** mat = [[1,2,1,2],[5,5,5,5],[6,3,6,3]], k = 2 **Output:** true **Explanation:** **Example 3:** **Input:** mat = [[2,2],[2,2]], k = 3 **Output:** true **Explanation:** As all the values are equal in the matrix, even after performing cyclic shifts the matrix will remain the same. **Constraints:** `1 <= mat.length <= 25` `1 <= mat[i].length <= 25` `1 <= mat[i][j] <= 25` `1 <= k <= 50`",
+    "public_test_cases": [
+        {
+            "label": "Example 1",
+            "input": "mat = [[1,2,3],[4,5,6],[7,8,9]], k = 4",
+            "output": "false "
+        },
+        {
+            "label": "Example 2",
+            "input": "mat = [[1,2,1,2],[5,5,5,5],[6,3,6,3]], k = 2",
+            "output": "true "
+        },
+        {
+            "label": "Example 3",
+            "input": "mat = [[2,2],[2,2]], k = 3",
+            "output": "true "
+        }
+    ],
+    "private_test_cases": [
+        {
+            "input": [
+                [
+                    [
+                        6,
+                        24,
+                        22,
+                        21,
+                        22,
+                        13,
+                        23,
+                        5,
+                        25,
+                        19,
+                        1,
+                        5,
+                        10
+                    ],
+                    [
+                        2,
+                        22,
+                        6,
+                        14,
+                        8,
+                        14,
+                        5,
+                        12,
+                        24,
+                        9,
+                        19,
+                        6,
+                        9
+                    ],
+                    [
+                        16,
+                        25,
+                        21,
+                        2,
+                        3,
+                        23,
+                        3,
+                        20,
+                        8,
+                        23,
+                        14,
+                        5,
+                        21
+                    ],
+                    [
+                        16,
+                        19,
+                        21,
+                        11,
+                        5,
+                        17,
+                        23,
+                        12,
+                        1,
+                        10,
+                        1,
+                        18,
+                        16
+                    ],
+                    [
+                        11,
+                        11,
+                        7,
+                        24,
+                        15,
+                        13,
+                        12,
+                        21,
+                        15,
+                        11,
+                        10,
+                        13,
+                        3
+                    ],
+                    [
+                        6,
+                        2,
+                        20,
+                        25,
+                        5,
+                        8,
+                        7,
+                        24,
+                        13,
+                        16,
+                        23,
+                        14,
+                        13
+                    ],
+                    [
+                        11,
+                        12,
+                        10,
+                        3,
+                        18,
+                        13,
+                        8,
+                        13,
+                        24,
+                        3,
+                        6,
+                        10,
+                        5
+                    ],
+                    [
+                        4,
+                        2,
+                        18,
+                        3,
+                        23,
+                        4,
+                        24,
+                        14,
+                        7,
+                        11,
+                        13,
+                        23,
+                        1
+                    ],
+                    [
+                        19,
+                        20,
+                        22,
+                        12,
+                        12,
+                        8,
+                        13,
+                        1,
+                        18,
+                        17,
+                        10,
+                        20,
+                        12
+                    ],
+                    [
+                        17,
+                        8,
+                        18,
+                        6,
+                        1,
+                        24,
+                        19,
+                        4,
+                        12,
+                        20,
+                        25,
+                        8,
+                        13
+                    ],
+                    [
+                        2,
+                        21,
+                        7,
+                        17,
+                        15,
+                        25,
+                        6,
+                        4,
+                        12,
+                        6,
+                        11,
+                        12,
+                        13
+                    ],
+                    [
+                        23,
+                        2,
+                        15,
+                        2,
+                        3,
+                        25,
+                        6,
+                        4,
+                        18,
+                        19,
+                        18,
+                        10,
+                        15
+                    ],
+                    [
+                        10,
+                        12,
+                        17,
+                        19,
+                        9,
+                        11,
+                        23,
+                        20,
+                        11,
+                        16,
+                        24,
+                        8,
+                        18
+                    ],
+                    [
+                        7,
+                        1,
+                        5,
+                        2,
+                        10,
+                        22,
+                        8,
+                        23,
+                        16,
+                        13,
+                        19,
+                        6,
+                        9
+                    ],
+                    [
+                        7,
+                        20,
+                        12,
+                        6,
+                        13,
+                        17,
+                        10,
+                        21,
+                        20,
+                        11,
+                        21,
+                        8,
+                        15
+                    ],
+                    [
+                        7,
+                        2,
+                        5,
+                        22,
+                        10,
+                        9,
+                        24,
+                        11,
+                        23,
+                        11,
+                        17,
+                        23,
+                        16
+                    ],
+                    [
+                        22,
+                        23,
+                        20,
+                        18,
+                        11,
+                        5,
+                        20,
+                        24,
+                        5,
+                        24,
+                        15,
+                        9,
+                        8
+                    ]
+                ],
+                30
+            ],
+            "output": false
+        },
+        {
+            "input": [
+                [
+                    [
+                        1,
+                        15,
+                        17,
+                        4,
+                        14,
+                        1,
+                        3,
+                        19,
+                        20,
+                        18,
+                        16,
+                        19,
+                        8,
+                        2
+                    ],
+                    [
+                        11,
+                        13,
+                        14,
+                        24,
+                        12,
+                        19,
+                        25,
+                        15,
+                        16,
+                        12,
+                        12,
+                        15,
+                        1,
+                        22
+                    ],
+                    [
+                        24,
+                        5,
+                        23,
+                        25,
+                        17,
+                        19,
+                        2,
+                        1,
+                        14,
+                        20,
+                        11,
+                        6,
+                        16,
+                        16
+                    ],
+                    [
+                        1,
+                        14,
+                        21,
+                        11,
+                        20,
+                        3,
+                        19,
+                        7,
+                        11,
+                        1,
+                        2,
+                        1,
+                        21,
+                        24
+                    ],
+                    [
+                        11,
+                        15,
+                        7,
+                        19,
+                        22,
+                        19,
+                        5,
+                        14,
+                        12,
+                        19,
+                        12,
+                        11,
+                        12,
+                        1
+                    ],
+                    [
+                        23,
+                        24,
+                        18,
+                        2,
+                        4,
+                        17,
+                        22,
+                        16,
+                        12,
+                        24,
+                        20,
+                        11,
+                        23,
+                        16
+                    ],
+                    [
+                        8,
+                        8,
+                        22,
+                        10,
+                        4,
+                        10,
+                        7,
+                        22,
+                        21,
+                        6,
+                        21,
+                        9,
+                        23,
+                        21
+                    ],
+                    [
+                        15,
+                        8,
+                        22,
+                        18,
+                        13,
+                        24,
+                        3,
+                        11,
+                        23,
+                        2,
+                        19,
+                        14,
+                        17,
+                        11
+                    ]
+                ],
+                11
+            ],
+            "output": false
+        },
+        {
+            "input": [
+                [
+                    [
+                        1,
+                        14,
+                        3,
+                        11,
+                        7,
+                        16,
+                        2,
+                        22,
+                        21,
+                        23,
+                        6
+                    ],
+                    [
+                        21,
+                        22,
+                        11,
+                        10,
+                        16,
+                        1,
+                        23,
+                        11,
+                        7,
+                        11,
+                        20
+                    ],
+                    [
+                        14,
+                        3,
+                        25,
+                        16,
+                        13,
+                        23,
+                        14,
+                        21,
+                        2,
+                        12,
+                        14
+                    ],
+                    [
+                        2,
+                        3,
+                        18,
+                        25,
+                        21,
+                        5,
+                        15,
+                        19,
+                        4,
+                        10,
+                        22
+                    ],
+                    [
+                        23,
+                        16,
+                        25,
+                        19,
+                        6,
+                        10,
+                        13,
+                        12,
+                        7,
+                        20,
+                        3
+                    ],
+                    [
+                        13,
+                        21,
+                        17,
+                        5,
+                        11,
+                        8,
+                        22,
+                        10,
+                        5,
+                        18,
+                        14
+                    ],
+                    [
+                        18,
+                        2,
+                        12,
+                        24,
+                        12,
+                        11,
+                        4,
+                        7,
+                        24,
+                        18,
+                        2
+                    ],
+                    [
+                        25,
+                        14,
+                        20,
+                        14,
+                        4,
+                        20,
+                        25,
+                        17,
+                        7,
+                        24,
+                        15
+                    ],
+                    [
+                        16,
+                        24,
+                        11,
+                        13,
+                        23,
+                        2,
+                        18,
+                        13,
+                        11,
+                        20,
+                        22
+                    ],
+                    [
+                        13,
+                        24,
+                        21,
+                        15,
+                        1,
+                        6,
+                        2,
+                        12,
+                        11,
+                        23,
+                        20
+                    ],
+                    [
+                        5,
+                        19,
+                        4,
+                        5,
+                        6,
+                        4,
+                        1,
+                        9,
+                        6,
+                        25,
+                        15
+                    ],
+                    [
+                        4,
+                        24,
+                        11,
+                        14,
+                        17,
+                        3,
+                        3,
+                        4,
+                        24,
+                        14,
+                        15
+                    ],
+                    [
+                        15,
+                        13,
+                        23,
+                        25,
+                        24,
+                        22,
+                        4,
+                        3,
+                        11,
+                        1,
+                        10
+                    ],
+                    [
+                        11,
+                        3,
+                        7,
+                        12,
+                        7,
+                        22,
+                        8,
+                        17,
+                        19,
+                        5,
+                        21
+                    ],
+                    [
+                        13,
+                        7,
+                        14,
+                        2,
+                        23,
+                        1,
+                        3,
+                        13,
+                        3,
+                        15,
+                        21
+                    ],
+                    [
+                        22,
+                        13,
+                        23,
+                        12,
+                        16,
+                        11,
+                        17,
+                        14,
+                        6,
+                        19,
+                        3
+                    ],
+                    [
+                        18,
+                        12,
+                        12,
+                        23,
+                        13,
+                        1,
+                        16,
+                        2,
+                        13,
+                        10,
+                        3
+                    ],
+                    [
+                        2,
+                        9,
+                        12,
+                        18,
+                        23,
+                        24,
+                        19,
+                        14,
+                        1,
+                        1,
+                        21
+                    ],
+                    [
+                        1,
+                        2,
+                        17,
+                        22,
+                        14,
+                        14,
+                        21,
+                        19,
+                        1,
+                        21,
+                        16
+                    ],
+                    [
+                        14,
+                        23,
+                        12,
+                        13,
+                        20,
+                        16,
+                        1,
+                        5,
+                        13,
+                        25,
+                        2
+                    ]
+                ],
+                3
+            ],
+            "output": false
+        },
+        {
+            "input": [
+                [
+                    [
+                        5,
+                        19,
+                        18,
+                        7,
+                        3,
+                        23,
+                        2
+                    ],
+                    [
+                        24,
+                        17,
+                        24,
+                        19,
+                        3,
+                        24,
+                        1
+                    ],
+                    [
+                        12,
+                        11,
+                        22,
+                        22,
+                        5,
+                        24,
+                        17
+                    ],
+                    [
+                        7,
+                        12,
+                        1,
+                        16,
+                        2,
+                        16,
+                        21
+                    ],
+                    [
+                        17,
+                        8,
+                        15,
+                        22,
+                        24,
+                        8,
+                        16
+                    ],
+                    [
+                        2,
+                        13,
+                        14,
+                        14,
+                        9,
+                        12,
+                        22
+                    ],
+                    [
+                        16,
+                        18,
+                        24,
+                        19,
+                        18,
+                        2,
+                        19
+                    ],
+                    [
+                        3,
+                        6,
+                        12,
+                        3,
+                        1,
+                        1,
+                        3
+                    ],
+                    [
+                        4,
+                        2,
+                        13,
+                        3,
+                        14,
+                        4,
+                        17
+                    ],
+                    [
+                        16,
+                        3,
+                        1,
+                        25,
+                        10,
+                        6,
+                        21
+                    ]
+                ],
+                25
+            ],
+            "output": false
+        },
+        {
+            "input": [
+                [
+                    [
+                        21,
+                        5,
+                        16,
+                        21,
+                        9,
+                        11,
+                        5,
+                        22,
+                        17,
+                        2,
+                        23,
+                        15,
+                        9,
+                        13,
+                        14,
+                        8,
+                        12,
+                        21,
+                        7,
+                        22,
+                        13,
+                        18,
+                        1
+                    ],
+                    [
+                        13,
+                        11,
+                        3,
+                        7,
+                        20,
+                        16,
+                        13,
+                        10,
+                        24,
+                        23,
+                        15,
+                        17,
+                        21,
+                        24,
+                        19,
+                        22,
+                        2,
+                        3,
+                        25,
+                        3,
+                        21,
+                        24,
+                        23
+                    ],
+                    [
+                        16,
+                        10,
+                        1,
+                        5,
+                        22,
+                        6,
+                        18,
+                        5,
+                        22,
+                        12,
+                        10,
+                        18,
+                        16,
+                        12,
+                        3,
+                        9,
+                        7,
+                        11,
+                        15,
+                        8,
+                        10,
+                        8,
+                        12
+                    ],
+                    [
+                        3,
+                        11,
+                        13,
+                        16,
+                        9,
+                        3,
+                        12,
+                        3,
+                        20,
+                        2,
+                        11,
+                        13,
+                        17,
+                        10,
+                        13,
+                        1,
+                        2,
+                        1,
+                        14,
+                        17,
+                        23,
+                        15,
+                        22
+                    ],
+                    [
+                        19,
+                        24,
+                        17,
+                        6,
+                        3,
+                        5,
+                        2,
+                        11,
+                        13,
+                        9,
+                        24,
+                        19,
+                        23,
+                        13,
+                        20,
+                        13,
+                        1,
+                        15,
+                        17,
+                        10,
+                        25,
+                        25,
+                        3
+                    ],
+                    [
+                        6,
+                        10,
+                        22,
+                        15,
+                        17,
+                        5,
+                        13,
+                        7,
+                        1,
+                        13,
+                        21,
+                        3,
+                        24,
+                        24,
+                        9,
+                        1,
+                        10,
+                        5,
+                        8,
+                        2,
+                        18,
+                        16,
+                        21
+                    ]
+                ],
+                11
+            ],
+            "output": false
+        },
+        {
+            "input": [
+                [
+                    [
+                        12,
+                        3,
+                        5,
+                        13,
+                        16,
+                        20,
+                        16,
+                        3,
+                        11,
+                        5,
+                        11,
+                        19,
+                        20,
+                        17,
+                        21,
+                        6,
+                        14,
+                        8,
+                        14,
+                        7,
+                        20,
+                        17,
+                        25,
+                        18
+                    ]
+                ],
+                28
+            ],
+            "output": false
+        },
+        {
+            "input": [
+                [
+                    [
+                        21,
+                        2,
+                        2,
+                        25,
+                        9,
+                        22,
+                        6,
+                        2,
+                        8,
+                        7,
+                        25,
+                        19,
+                        7,
+                        2,
+                        7,
+                        6,
+                        16,
+                        12,
+                        1,
+                        12,
+                        22,
+                        8,
+                        24,
+                        6
+                    ],
+                    [
+                        3,
+                        2,
+                        10,
+                        3,
+                        20,
+                        13,
+                        13,
+                        16,
+                        11,
+                        23,
+                        9,
+                        24,
+                        16,
+                        13,
+                        5,
+                        20,
+                        21,
+                        11,
+                        13,
+                        24,
+                        20,
+                        18,
+                        20,
+                        15
+                    ],
+                    [
+                        23,
+                        15,
+                        17,
+                        16,
+                        9,
+                        1,
+                        10,
+                        9,
+                        12,
+                        2,
+                        8,
+                        24,
+                        21,
+                        6,
+                        19,
+                        20,
+                        9,
+                        24,
+                        3,
+                        17,
+                        18,
+                        1,
+                        17,
+                        9
+                    ],
+                    [
+                        13,
+                        21,
+                        6,
+                        9,
+                        22,
+                        2,
+                        19,
+                        24,
+                        10,
+                        17,
+                        15,
+                        10,
+                        3,
+                        20,
+                        12,
+                        14,
+                        22,
+                        1,
+                        20,
+                        4,
+                        15,
+                        12,
+                        2,
+                        22
+                    ],
+                    [
+                        20,
+                        7,
+                        6,
+                        12,
+                        10,
+                        15,
+                        5,
+                        18,
+                        19,
+                        20,
+                        4,
+                        2,
+                        14,
+                        2,
+                        8,
+                        18,
+                        7,
+                        2,
+                        1,
+                        15,
+                        7,
+                        2,
+                        22,
+                        2
+                    ],
+                    [
+                        19,
+                        5,
+                        6,
+                        3,
+                        4,
+                        3,
+                        13,
+                        9,
+                        16,
+                        3,
+                        2,
+                        2,
+                        10,
+                        25,
+                        11,
+                        23,
+                        25,
+                        19,
+                        1,
+                        17,
+                        1,
+                        11,
+                        2,
+                        13
+                    ],
+                    [
+                        20,
+                        11,
+                        10,
+                        1,
+                        8,
+                        3,
+                        7,
+                        24,
+                        7,
+                        12,
+                        4,
+                        3,
+                        23,
+                        18,
+                        2,
+                        10,
+                        20,
+                        20,
+                        18,
+                        23,
+                        21,
+                        16,
+                        22,
+                        12
+                    ],
+                    [
+                        23,
+                        6,
+                        1,
+                        16,
+                        21,
+                        6,
+                        15,
+                        7,
+                        13,
+                        22,
+                        2,
+                        22,
+                        17,
+                        15,
+                        8,
+                        21,
+                        10,
+                        16,
+                        16,
+                        21,
+                        17,
+                        18,
+                        8,
+                        7
+                    ],
+                    [
+                        7,
+                        19,
+                        8,
+                        25,
+                        23,
+                        20,
+                        10,
+                        20,
+                        2,
+                        24,
+                        22,
+                        12,
+                        18,
+                        2,
+                        20,
+                        2,
+                        12,
+                        2,
+                        17,
+                        25,
+                        2,
+                        16,
+                        24,
+                        13
+                    ],
+                    [
+                        10,
+                        6,
+                        19,
+                        11,
+                        15,
+                        24,
+                        5,
+                        9,
+                        2,
+                        22,
+                        12,
+                        21,
+                        14,
+                        5,
+                        15,
+                        25,
+                        15,
+                        20,
+                        12,
+                        25,
+                        13,
+                        9,
+                        4,
+                        23
+                    ],
+                    [
+                        5,
+                        7,
+                        17,
+                        22,
+                        25,
+                        19,
+                        5,
+                        13,
+                        15,
+                        25,
+                        3,
+                        25,
+                        4,
+                        7,
+                        17,
+                        13,
+                        21,
+                        21,
+                        11,
+                        23,
+                        16,
+                        24,
+                        8,
+                        14
+                    ]
+                ],
+                49
+            ],
+            "output": false
+        }
+    ],
+    "haskell_template": "areSimilar :: [[Int]] -> Int -> Bool\nareSimilar mat k ",
+    "ocaml_template": "let areSimilar (mat: int list list) (k: int) : bool =  ",
+    "scala_template": "def areSimilar(mat: List[List[Int]],k: Int): Boolean = { \n    \n}",
+    "java_template": "class Solution {\n    public boolean areSimilar(int[][] mat, int k) {\n        \n    }\n}",
+    "python_template": "class Solution(object):\n    def areSimilar(self, mat, k):\n        \"\"\"\n        :type mat: List[List[int]]\n        :type k: int\n        :rtype: bool\n        \"\"\"\n        "
+}

matrix_similarity_after_cyclic_shifts/ocaml_tests/main.ml

@@ -0,0 +1,50 @@
+
+module Main = struct
+    open OUnit2
+
+    (* Program start *)
+
+    (* Program end *)
+
+    (* Test cases *)
+    
+let test1 _ = assert_equal false (areSimilar [[1;2;3];[4;5;6];[7;8;9]] 4)
+
+let test2 _ = assert_equal true (areSimilar [[1;2;1;2];[5;5;5;5];[6;3;6;3]] 2)
+
+let test3 _ = assert_equal true (areSimilar [[2;2];[2;2]] 3)
+
+let test4 _ = assert_equal false (areSimilar [[6; 24; 22; 21; 22; 13; 23; 5; 25; 19; 1; 5; 10]; [2; 22; 6; 14; 8; 14; 5; 12; 24; 9; 19; 6; 9]; [16; 25; 21; 2; 3; 23; 3; 20; 8; 23; 14; 5; 21]; [16; 19; 21; 11; 5; 17; 23; 12; 1; 10; 1; 18; 16]; [11; 11; 7; 24; 15; 13; 12; 21; 15; 11; 10; 13; 3]; [6; 2; 20; 25; 5; 8; 7; 24; 13; 16; 23; 14; 13]; [11; 12; 10; 3; 18; 13; 8; 13; 24; 3; 6; 10; 5]; [4; 2; 18; 3; 23; 4; 24; 14; 7; 11; 13; 23; 1]; [19; 20; 22; 12; 12; 8; 13; 1; 18; 17; 10; 20; 12]; [17; 8; 18; 6; 1; 24; 19; 4; 12; 20; 25; 8; 13]; [2; 21; 7; 17; 15; 25; 6; 4; 12; 6; 11; 12; 13]; [23; 2; 15; 2; 3; 25; 6; 4; 18; 19; 18; 10; 15]; [10; 12; 17; 19; 9; 11; 23; 20; 11; 16; 24; 8; 18]; [7; 1; 5; 2; 10; 22; 8; 23; 16; 13; 19; 6; 9]; [7; 20; 12; 6; 13; 17; 10; 21; 20; 11; 21; 8; 15]; [7; 2; 5; 22; 10; 9; 24; 11; 23; 11; 17; 23; 16]; [22; 23; 20; 18; 11; 5; 20; 24; 5; 24; 15; 9; 8]] 30)
+
+let test5 _ = assert_equal false (areSimilar [[1; 15; 17; 4; 14; 1; 3; 19; 20; 18; 16; 19; 8; 2]; [11; 13; 14; 24; 12; 19; 25; 15; 16; 12; 12; 15; 1; 22]; [24; 5; 23; 25; 17; 19; 2; 1; 14; 20; 11; 6; 16; 16]; [1; 14; 21; 11; 20; 3; 19; 7; 11; 1; 2; 1; 21; 24]; [11; 15; 7; 19; 22; 19; 5; 14; 12; 19; 12; 11; 12; 1]; [23; 24; 18; 2; 4; 17; 22; 16; 12; 24; 20; 11; 23; 16]; [8; 8; 22; 10; 4; 10; 7; 22; 21; 6; 21; 9; 23; 21]; [15; 8; 22; 18; 13; 24; 3; 11; 23; 2; 19; 14; 17; 11]] 11)
+
+let test6 _ = assert_equal false (areSimilar [[1; 14; 3; 11; 7; 16; 2; 22; 21; 23; 6]; [21; 22; 11; 10; 16; 1; 23; 11; 7; 11; 20]; [14; 3; 25; 16; 13; 23; 14; 21; 2; 12; 14]; [2; 3; 18; 25; 21; 5; 15; 19; 4; 10; 22]; [23; 16; 25; 19; 6; 10; 13; 12; 7; 20; 3]; [13; 21; 17; 5; 11; 8; 22; 10; 5; 18; 14]; [18; 2; 12; 24; 12; 11; 4; 7; 24; 18; 2]; [25; 14; 20; 14; 4; 20; 25; 17; 7; 24; 15]; [16; 24; 11; 13; 23; 2; 18; 13; 11; 20; 22]; [13; 24; 21; 15; 1; 6; 2; 12; 11; 23; 20]; [5; 19; 4; 5; 6; 4; 1; 9; 6; 25; 15]; [4; 24; 11; 14; 17; 3; 3; 4; 24; 14; 15]; [15; 13; 23; 25; 24; 22; 4; 3; 11; 1; 10]; [11; 3; 7; 12; 7; 22; 8; 17; 19; 5; 21]; [13; 7; 14; 2; 23; 1; 3; 13; 3; 15; 21]; [22; 13; 23; 12; 16; 11; 17; 14; 6; 19; 3]; [18; 12; 12; 23; 13; 1; 16; 2; 13; 10; 3]; [2; 9; 12; 18; 23; 24; 19; 14; 1; 1; 21]; [1; 2; 17; 22; 14; 14; 21; 19; 1; 21; 16]; [14; 23; 12; 13; 20; 16; 1; 5; 13; 25; 2]] 3)
+
+let test7 _ = assert_equal false (areSimilar [[5; 19; 18; 7; 3; 23; 2]; [24; 17; 24; 19; 3; 24; 1]; [12; 11; 22; 22; 5; 24; 17]; [7; 12; 1; 16; 2; 16; 21]; [17; 8; 15; 22; 24; 8; 16]; [2; 13; 14; 14; 9; 12; 22]; [16; 18; 24; 19; 18; 2; 19]; [3; 6; 12; 3; 1; 1; 3]; [4; 2; 13; 3; 14; 4; 17]; [16; 3; 1; 25; 10; 6; 21]] 25)
+
+let test8 _ = assert_equal false (areSimilar [[21; 5; 16; 21; 9; 11; 5; 22; 17; 2; 23; 15; 9; 13; 14; 8; 12; 21; 7; 22; 13; 18; 1]; [13; 11; 3; 7; 20; 16; 13; 10; 24; 23; 15; 17; 21; 24; 19; 22; 2; 3; 25; 3; 21; 24; 23]; [16; 10; 1; 5; 22; 6; 18; 5; 22; 12; 10; 18; 16; 12; 3; 9; 7; 11; 15; 8; 10; 8; 12]; [3; 11; 13; 16; 9; 3; 12; 3; 20; 2; 11; 13; 17; 10; 13; 1; 2; 1; 14; 17; 23; 15; 22]; [19; 24; 17; 6; 3; 5; 2; 11; 13; 9; 24; 19; 23; 13; 20; 13; 1; 15; 17; 10; 25; 25; 3]; [6; 10; 22; 15; 17; 5; 13; 7; 1; 13; 21; 3; 24; 24; 9; 1; 10; 5; 8; 2; 18; 16; 21]] 11)
+
+let test9 _ = assert_equal false (areSimilar [[12; 3; 5; 13; 16; 20; 16; 3; 11; 5; 11; 19; 20; 17; 21; 6; 14; 8; 14; 7; 20; 17; 25; 18]] 28)
+
+let test10 _ = assert_equal false (areSimilar [[21; 2; 2; 25; 9; 22; 6; 2; 8; 7; 25; 19; 7; 2; 7; 6; 16; 12; 1; 12; 22; 8; 24; 6]; [3; 2; 10; 3; 20; 13; 13; 16; 11; 23; 9; 24; 16; 13; 5; 20; 21; 11; 13; 24; 20; 18; 20; 15]; [23; 15; 17; 16; 9; 1; 10; 9; 12; 2; 8; 24; 21; 6; 19; 20; 9; 24; 3; 17; 18; 1; 17; 9]; [13; 21; 6; 9; 22; 2; 19; 24; 10; 17; 15; 10; 3; 20; 12; 14; 22; 1; 20; 4; 15; 12; 2; 22]; [20; 7; 6; 12; 10; 15; 5; 18; 19; 20; 4; 2; 14; 2; 8; 18; 7; 2; 1; 15; 7; 2; 22; 2]; [19; 5; 6; 3; 4; 3; 13; 9; 16; 3; 2; 2; 10; 25; 11; 23; 25; 19; 1; 17; 1; 11; 2; 13]; [20; 11; 10; 1; 8; 3; 7; 24; 7; 12; 4; 3; 23; 18; 2; 10; 20; 20; 18; 23; 21; 16; 22; 12]; [23; 6; 1; 16; 21; 6; 15; 7; 13; 22; 2; 22; 17; 15; 8; 21; 10; 16; 16; 21; 17; 18; 8; 7]; [7; 19; 8; 25; 23; 20; 10; 20; 2; 24; 22; 12; 18; 2; 20; 2; 12; 2; 17; 25; 2; 16; 24; 13]; [10; 6; 19; 11; 15; 24; 5; 9; 2; 22; 12; 21; 14; 5; 15; 25; 15; 20; 12; 25; 13; 9; 4; 23]; [5; 7; 17; 22; 25; 19; 5; 13; 15; 25; 3; 25; 4; 7; 17; 13; 21; 21; 11; 23; 16; 24; 8; 14]] 49)
+
+
+    (* Grouping test cases *)
+    let suite = "Test Suite for areSimilar" >::: [
+        
+  "test1" >:: test1;
+  "test2" >:: test2;
+  "test3" >:: test3;
+  "test4" >:: test4;
+  "test5" >:: test5;
+  "test6" >:: test6;
+  "test7" >:: test7;
+  "test8" >:: test8;
+  "test9" >:: test9;
+  "test10" >:: test10;
+    ]
+
+
+    (* Running the tests *)
+    let () = run_test_tt_main suite
+end

matrix_similarity_after_cyclic_shifts/scala_tests/MySuite.scala

@@ -0,0 +1,44 @@
+
+class MySuite extends munit.FunSuite {
+  
+  test("test1") {
+    assertEquals(Main.areSimilar(List(List(1,2,3),List(4,5,6),List(7,8,9)),4), false)
+  }
+
+  test("test2") {
+    assertEquals(Main.areSimilar(List(List(1,2,1,2),List(5,5,5,5),List(6,3,6,3)),2), true)
+  }
+
+  test("test3") {
+    assertEquals(Main.areSimilar(List(List(2,2),List(2,2)),3), true)
+  }
+
+  test("test4") {
+    assertEquals(Main.areSimilar(List(List(6, 24, 22, 21, 22, 13, 23, 5, 25, 19, 1, 5, 10), List(2, 22, 6, 14, 8, 14, 5, 12, 24, 9, 19, 6, 9), List(16, 25, 21, 2, 3, 23, 3, 20, 8, 23, 14, 5, 21), List(16, 19, 21, 11, 5, 17, 23, 12, 1, 10, 1, 18, 16), List(11, 11, 7, 24, 15, 13, 12, 21, 15, 11, 10, 13, 3), List(6, 2, 20, 25, 5, 8, 7, 24, 13, 16, 23, 14, 13), List(11, 12, 10, 3, 18, 13, 8, 13, 24, 3, 6, 10, 5), List(4, 2, 18, 3, 23, 4, 24, 14, 7, 11, 13, 23, 1), List(19, 20, 22, 12, 12, 8, 13, 1, 18, 17, 10, 20, 12), List(17, 8, 18, 6, 1, 24, 19, 4, 12, 20, 25, 8, 13), List(2, 21, 7, 17, 15, 25, 6, 4, 12, 6, 11, 12, 13), List(23, 2, 15, 2, 3, 25, 6, 4, 18, 19, 18, 10, 15), List(10, 12, 17, 19, 9, 11, 23, 20, 11, 16, 24, 8, 18), List(7, 1, 5, 2, 10, 22, 8, 23, 16, 13, 19, 6, 9), List(7, 20, 12, 6, 13, 17, 10, 21, 20, 11, 21, 8, 15), List(7, 2, 5, 22, 10, 9, 24, 11, 23, 11, 17, 23, 16), List(22, 23, 20, 18, 11, 5, 20, 24, 5, 24, 15, 9, 8)),30), false)
+  }
+
+  test("test5") {
+    assertEquals(Main.areSimilar(List(List(1, 15, 17, 4, 14, 1, 3, 19, 20, 18, 16, 19, 8, 2), List(11, 13, 14, 24, 12, 19, 25, 15, 16, 12, 12, 15, 1, 22), List(24, 5, 23, 25, 17, 19, 2, 1, 14, 20, 11, 6, 16, 16), List(1, 14, 21, 11, 20, 3, 19, 7, 11, 1, 2, 1, 21, 24), List(11, 15, 7, 19, 22, 19, 5, 14, 12, 19, 12, 11, 12, 1), List(23, 24, 18, 2, 4, 17, 22, 16, 12, 24, 20, 11, 23, 16), List(8, 8, 22, 10, 4, 10, 7, 22, 21, 6, 21, 9, 23, 21), List(15, 8, 22, 18, 13, 24, 3, 11, 23, 2, 19, 14, 17, 11)),11), false)
+  }
+
+  test("test6") {
+    assertEquals(Main.areSimilar(List(List(1, 14, 3, 11, 7, 16, 2, 22, 21, 23, 6), List(21, 22, 11, 10, 16, 1, 23, 11, 7, 11, 20), List(14, 3, 25, 16, 13, 23, 14, 21, 2, 12, 14), List(2, 3, 18, 25, 21, 5, 15, 19, 4, 10, 22), List(23, 16, 25, 19, 6, 10, 13, 12, 7, 20, 3), List(13, 21, 17, 5, 11, 8, 22, 10, 5, 18, 14), List(18, 2, 12, 24, 12, 11, 4, 7, 24, 18, 2), List(25, 14, 20, 14, 4, 20, 25, 17, 7, 24, 15), List(16, 24, 11, 13, 23, 2, 18, 13, 11, 20, 22), List(13, 24, 21, 15, 1, 6, 2, 12, 11, 23, 20), List(5, 19, 4, 5, 6, 4, 1, 9, 6, 25, 15), List(4, 24, 11, 14, 17, 3, 3, 4, 24, 14, 15), List(15, 13, 23, 25, 24, 22, 4, 3, 11, 1, 10), List(11, 3, 7, 12, 7, 22, 8, 17, 19, 5, 21), List(13, 7, 14, 2, 23, 1, 3, 13, 3, 15, 21), List(22, 13, 23, 12, 16, 11, 17, 14, 6, 19, 3), List(18, 12, 12, 23, 13, 1, 16, 2, 13, 10, 3), List(2, 9, 12, 18, 23, 24, 19, 14, 1, 1, 21), List(1, 2, 17, 22, 14, 14, 21, 19, 1, 21, 16), List(14, 23, 12, 13, 20, 16, 1, 5, 13, 25, 2)),3), false)
+  }
+
+  test("test7") {
+    assertEquals(Main.areSimilar(List(List(5, 19, 18, 7, 3, 23, 2), List(24, 17, 24, 19, 3, 24, 1), List(12, 11, 22, 22, 5, 24, 17), List(7, 12, 1, 16, 2, 16, 21), List(17, 8, 15, 22, 24, 8, 16), List(2, 13, 14, 14, 9, 12, 22), List(16, 18, 24, 19, 18, 2, 19), List(3, 6, 12, 3, 1, 1, 3), List(4, 2, 13, 3, 14, 4, 17), List(16, 3, 1, 25, 10, 6, 21)),25), false)
+  }
+
+  test("test8") {
+    assertEquals(Main.areSimilar(List(List(21, 5, 16, 21, 9, 11, 5, 22, 17, 2, 23, 15, 9, 13, 14, 8, 12, 21, 7, 22, 13, 18, 1), List(13, 11, 3, 7, 20, 16, 13, 10, 24, 23, 15, 17, 21, 24, 19, 22, 2, 3, 25, 3, 21, 24, 23), List(16, 10, 1, 5, 22, 6, 18, 5, 22, 12, 10, 18, 16, 12, 3, 9, 7, 11, 15, 8, 10, 8, 12), List(3, 11, 13, 16, 9, 3, 12, 3, 20, 2, 11, 13, 17, 10, 13, 1, 2, 1, 14, 17, 23, 15, 22), List(19, 24, 17, 6, 3, 5, 2, 11, 13, 9, 24, 19, 23, 13, 20, 13, 1, 15, 17, 10, 25, 25, 3), List(6, 10, 22, 15, 17, 5, 13, 7, 1, 13, 21, 3, 24, 24, 9, 1, 10, 5, 8, 2, 18, 16, 21)),11), false)
+  }
+
+  test("test9") {
+    assertEquals(Main.areSimilar(List(List(12, 3, 5, 13, 16, 20, 16, 3, 11, 5, 11, 19, 20, 17, 21, 6, 14, 8, 14, 7, 20, 17, 25, 18)),28), false)
+  }
+
+  test("test10") {
+    assertEquals(Main.areSimilar(List(List(21, 2, 2, 25, 9, 22, 6, 2, 8, 7, 25, 19, 7, 2, 7, 6, 16, 12, 1, 12, 22, 8, 24, 6), List(3, 2, 10, 3, 20, 13, 13, 16, 11, 23, 9, 24, 16, 13, 5, 20, 21, 11, 13, 24, 20, 18, 20, 15), List(23, 15, 17, 16, 9, 1, 10, 9, 12, 2, 8, 24, 21, 6, 19, 20, 9, 24, 3, 17, 18, 1, 17, 9), List(13, 21, 6, 9, 22, 2, 19, 24, 10, 17, 15, 10, 3, 20, 12, 14, 22, 1, 20, 4, 15, 12, 2, 22), List(20, 7, 6, 12, 10, 15, 5, 18, 19, 20, 4, 2, 14, 2, 8, 18, 7, 2, 1, 15, 7, 2, 22, 2), List(19, 5, 6, 3, 4, 3, 13, 9, 16, 3, 2, 2, 10, 25, 11, 23, 25, 19, 1, 17, 1, 11, 2, 13), List(20, 11, 10, 1, 8, 3, 7, 24, 7, 12, 4, 3, 23, 18, 2, 10, 20, 20, 18, 23, 21, 16, 22, 12), List(23, 6, 1, 16, 21, 6, 15, 7, 13, 22, 2, 22, 17, 15, 8, 21, 10, 16, 16, 21, 17, 18, 8, 7), List(7, 19, 8, 25, 23, 20, 10, 20, 2, 24, 22, 12, 18, 2, 20, 2, 12, 2, 17, 25, 2, 16, 24, 13), List(10, 6, 19, 11, 15, 24, 5, 9, 2, 22, 12, 21, 14, 5, 15, 25, 15, 20, 12, 25, 13, 9, 4, 23), List(5, 7, 17, 22, 25, 19, 5, 13, 15, 25, 3, 25, 4, 7, 17, 13, 21, 21, 11, 23, 16, 24, 8, 14)),49), false)
+  }
+
+}

max_pair_sum_in_an_array/haskell_tests/Main.hs

@@ -0,0 +1,27 @@
+
+module Main where
+import Test.HUnit
+
+--Program start
+
+--Program end
+
+-- Test cases
+
+test1 :: Test
+test1 = TestCase (assertEqual "for (maxSum [112,131,411])," (-1) (maxSum [112,131,411]))
+
+test2 :: Test
+test2 = TestCase (assertEqual "for (maxSum [2536,1613,3366,162])," 5902 (maxSum [2536,1613,3366,162]))
+
+test3 :: Test
+test3 = TestCase (assertEqual "for (maxSum [51,71,17,24,42])," 88 (maxSum [51,71,17,24,42]))
+
+
+-- Grouping test cases
+tests :: Test
+tests = TestList [TestLabel "Test1" test1, TestLabel "Test2" test2]
+
+-- Running the tests
+main :: IO Counts
+main = runTestTT tests

max_pair_sum_in_an_array/java_tests/Main.java

@@ -0,0 +1,25 @@
+
+import static org.junit.jupiter.api.Assertions.*;
+import org.junit.jupiter.api.Test;
+import java.util.List;
+import java.util.Arrays;
+import java.util.ArrayList;
+public class Main {
+    //Program start
+    
+    //Program end
+
+    @Test
+public void test1() {
+    assertEquals(-1, maxSum(new ArrayList<>(Arrays.asList(112,131,411))));
+}
+@Test
+public void test2() {
+    assertEquals(5902, maxSum(new ArrayList<>(Arrays.asList(2536,1613,3366,162))));
+}
+@Test
+public void test3() {
+    assertEquals(88, maxSum(new ArrayList<>(Arrays.asList(51,71,17,24,42))));
+}
+
+}

max_pair_sum_in_an_array/meta.json

@@ -0,0 +1,598 @@
+{
+    "id": 2902,
+    "name": "max_pair_sum_in_an_array",
+    "difficulty": "Easy",
+    "link": "https://leetcode.com/problems/max-pair-sum-in-an-array/",
+    "date": "1691280000000",
+    "task_description": "You are given an integer array `nums`. You have to find the **maximum** sum of a pair of numbers from `nums` such that the **largest digit **in both numbers is equal. For example, 2373 is made up of three distinct digits: 2, 3, and 7, where 7 is the largest among them. Return the **maximum** sum or -1 if no such pair exists. **Example 1:** **Input:** nums = [112,131,411] **Output:** -1 **Explanation:** Each numbers largest digit in order is [2,3,4]. **Example 2:** **Input:** nums = [2536,1613,3366,162] **Output:** 5902 **Explanation:** All the numbers have 6 as their largest digit, so the answer is 2536 + 3366 = 5902. **Example 3:** **Input:** nums = [51,71,17,24,42] **Output:** 88 **Explanation:** Each number's largest digit in order is [5,7,7,4,4]. So we have only two possible pairs, 71 + 17 = 88 and 24 + 42 = 66. **Constraints:** `2 <= nums.length <= 100` `1 <= nums[i] <= 104`",
+    "public_test_cases": [
+        {
+            "label": "Example 1",
+            "input": "nums = [112,131,411]",
+            "output": "-1 "
+        },
+        {
+            "label": "Example 2",
+            "input": "nums = [2536,1613,3366,162]",
+            "output": "5902 "
+        },
+        {
+            "label": "Example 3",
+            "input": "nums = [51,71,17,24,42]",
+            "output": "88 "
+        }
+    ],
+    "private_test_cases": [
+        {
+            "input": [
+                5922,
+                5663,
+                6159,
+                9462,
+                4816,
+                4367,
+                6722,
+                7009,
+                772,
+                6853,
+                973,
+                451,
+                2758,
+                7628,
+                7299,
+                7926,
+                6867,
+                6226,
+                43,
+                9667,
+                4856,
+                9411,
+                6437,
+                4421,
+                8975,
+                8424,
+                6831,
+                9115,
+                7796,
+                7183,
+                1295,
+                5184,
+                5277,
+                4578,
+                5683,
+                4688,
+                9703,
+                1870,
+                6290,
+                1215,
+                7113,
+                6067,
+                2970,
+                9535,
+                1678,
+                7707,
+                1082,
+                6279,
+                6614,
+                9058,
+                1842,
+                4746,
+                6609,
+                625,
+                1375,
+                4458,
+                9839,
+                7354,
+                4922,
+                5971,
+                5296,
+                4246,
+                6069,
+                374,
+                153,
+                1820,
+                8044,
+                4552,
+                3442,
+                8024,
+                4949,
+                934,
+                5724,
+                924,
+                9792,
+                8392,
+                1811,
+                5595,
+                9383,
+                9572,
+                4111,
+                839,
+                9542,
+                8510
+            ],
+            "output": 19631
+        },
+        {
+            "input": [
+                9114,
+                840,
+                5229,
+                7107,
+                6001,
+                9192,
+                1334,
+                3717,
+                7873,
+                4232,
+                9669,
+                8733,
+                6403,
+                2530,
+                6532,
+                2024,
+                4364,
+                3430,
+                67,
+                6085,
+                8013,
+                6350,
+                6006,
+                4914,
+                9017,
+                1393,
+                3866
+            ],
+            "output": 18861
+        },
+        {
+            "input": [
+                9177,
+                4017,
+                4954,
+                1018,
+                6193,
+                1472,
+                9034
+            ],
+            "output": 18211
+        },
+        {
+            "input": [
+                7250,
+                5385,
+                1996,
+                2445,
+                5016,
+                7462,
+                5275,
+                7121,
+                9855,
+                7304,
+                8384,
+                1024,
+                3554,
+                8000,
+                7756,
+                4599,
+                3020,
+                1470,
+                3725,
+                8653,
+                8100,
+                2177,
+                2384,
+                2502,
+                7273,
+                347,
+                4273,
+                8292,
+                6256,
+                4541,
+                877,
+                4004,
+                3883,
+                4731,
+                6211,
+                7809,
+                6145,
+                9253,
+                133,
+                1730,
+                3932,
+                3214,
+                4041,
+                8038,
+                41,
+                4585,
+                8236,
+                217,
+                5327,
+                8681,
+                939,
+                817,
+                1996,
+                9615,
+                1020,
+                146,
+                3331,
+                9846,
+                2019
+            ],
+            "output": 19701
+        },
+        {
+            "input": [
+                7514,
+                5023,
+                8849,
+                1247,
+                3102,
+                2105,
+                9012,
+                9775,
+                7202,
+                6872,
+                9304,
+                4713,
+                5262,
+                2409,
+                4259,
+                791,
+                6027,
+                8258,
+                6165,
+                495,
+                8585,
+                8168,
+                3518,
+                4588,
+                9057,
+                3766,
+                8419,
+                64,
+                5217,
+                8812,
+                3609,
+                8897,
+                4748,
+                3557,
+                4479,
+                6376,
+                7708,
+                9973,
+                355,
+                5570,
+                4403,
+                2784,
+                988,
+                2298,
+                3839
+            ],
+            "output": 19748
+        },
+        {
+            "input": [
+                6092,
+                4067,
+                6376,
+                8630,
+                590,
+                9703,
+                1858,
+                5504,
+                7849,
+                4678,
+                8480,
+                47,
+                3660,
+                7643,
+                5610,
+                197,
+                6634,
+                4442,
+                6055,
+                3818,
+                841,
+                3228,
+                670,
+                7199,
+                723,
+                7477,
+                2716,
+                6359,
+                2626,
+                7255,
+                6897,
+                6894,
+                9076,
+                5040,
+                4411,
+                7876,
+                2184,
+                6187,
+                1465,
+                3339,
+                9260,
+                8974,
+                1630,
+                9812,
+                4157,
+                7046,
+                579,
+                3271,
+                2677,
+                5840,
+                1527,
+                2535,
+                2454,
+                9339,
+                9036,
+                4916,
+                579,
+                5454,
+                8484
+            ],
+            "output": 19515
+        },
+        {
+            "input": [
+                4050,
+                1912,
+                3099,
+                3954,
+                9380,
+                5038,
+                5730,
+                2456,
+                4940,
+                2560,
+                9247,
+                4781,
+                2800,
+                3059,
+                9151,
+                6838,
+                3860,
+                869,
+                1432,
+                6785,
+                4786,
+                8309,
+                93,
+                9462,
+                4989,
+                6688,
+                3648,
+                4098,
+                3679,
+                9879,
+                2370,
+                6114,
+                2555,
+                9483,
+                982,
+                3015,
+                9046,
+                1164,
+                3292,
+                1874,
+                234,
+                8766,
+                1925,
+                4045,
+                7917,
+                5649,
+                4028,
+                5120
+            ],
+            "output": 19362
+        },
+        {
+            "input": [
+                7237,
+                8049,
+                5557,
+                6022,
+                7302,
+                9613,
+                330,
+                6978,
+                8884,
+                780,
+                7592,
+                8840,
+                7175,
+                2447,
+                1758,
+                6579,
+                4498,
+                9113,
+                3745,
+                1119,
+                8836,
+                6613,
+                4889,
+                7478,
+                1630,
+                4774,
+                301,
+                702,
+                6146,
+                7012,
+                5021,
+                4378,
+                5419,
+                3585,
+                3979,
+                8548,
+                3391,
+                6742,
+                3289,
+                4361,
+                5625,
+                3876,
+                2033,
+                2597,
+                8224,
+                3587,
+                3683,
+                4788,
+                1213,
+                9007,
+                7547,
+                3800,
+                8684,
+                8630,
+                4388,
+                242,
+                5438
+            ],
+            "output": 18726
+        },
+        {
+            "input": [
+                6353,
+                7488,
+                1738,
+                6770,
+                3605,
+                9297,
+                8795,
+                17,
+                9816,
+                2835,
+                3751,
+                9903,
+                5757,
+                8895,
+                4543,
+                5049,
+                5343,
+                1408,
+                8463,
+                9163,
+                7340,
+                6501,
+                5935,
+                7212,
+                6504,
+                2050,
+                5906,
+                2267,
+                5090,
+                9962,
+                1665,
+                3495,
+                849,
+                9404,
+                7479,
+                8618,
+                5634,
+                6491,
+                4179,
+                7126,
+                9132,
+                2762,
+                8315,
+                2979,
+                1645,
+                7987,
+                9629
+            ],
+            "output": 19865
+        },
+        {
+            "input": [
+                9502,
+                895,
+                9107,
+                47,
+                9994,
+                1896,
+                5076,
+                6437,
+                125,
+                5657,
+                8564,
+                5680,
+                7331,
+                5345,
+                5205,
+                5695,
+                7872,
+                3403,
+                5772,
+                909,
+                49,
+                265,
+                2633,
+                7649,
+                2581,
+                3216,
+                1563,
+                7681,
+                4407,
+                6365,
+                1145,
+                6246,
+                1286,
+                709,
+                3550,
+                5777,
+                4075,
+                8917,
+                6350,
+                4968,
+                2860,
+                2964,
+                1241,
+                2753,
+                7497,
+                1786,
+                2992,
+                335,
+                8817,
+                5136,
+                3475,
+                5071,
+                8433,
+                5349,
+                2242,
+                2328,
+                3691,
+                6293,
+                3350,
+                1638,
+                677,
+                9361,
+                4816,
+                4644,
+                6861,
+                7581,
+                9103,
+                2752,
+                9994,
+                1855,
+                2571,
+                4089,
+                4924,
+                6930,
+                9354,
+                5013,
+                9307,
+                8432,
+                4799,
+                5551,
+                3167,
+                5039,
+                5095
+            ],
+            "output": 19988
+        }
+    ],
+    "haskell_template": "maxSum :: [Int] -> Int\nmaxSum nums ",
+    "ocaml_template": "let maxSum (nums: int list) : int =  ",
+    "scala_template": "def maxSum(nums: List[Int]): Int = { \n    \n}",
+    "java_template": "public static int maxSum(List<Integer> nums) {\n\n}",
+    "python_template": "class Solution(object):\n    def maxSum(self, nums):\n        \"\"\"\n        :type nums: List[int]\n        :rtype: int\n        \"\"\"\n        "
+}

max_pair_sum_in_an_array/ocaml_tests/main.ml

@@ -0,0 +1,29 @@
+
+module Main = struct
+    open OUnit2
+
+    (* Program start *)
+
+    (* Program end *)
+
+    (* Test cases *)
+    
+let test1 _ = assert_equal (-1) (maxSum [112;131;411])
+
+let test2 _ = assert_equal 5902 (maxSum [2536;1613;3366;162])
+
+let test3 _ = assert_equal 88 (maxSum [51;71;17;24;42])
+
+
+    (* Grouping test cases *)
+    let suite = "Test Suite for maxSum" >::: [
+        
+  "test1" >:: test1;
+  "test2" >:: test2;
+  "test3" >:: test3;
+    ]
+
+
+    (* Running the tests *)
+    let () = run_test_tt_main suite
+end

max_pair_sum_in_an_array/scala_tests/MySuite.scala

@@ -0,0 +1,16 @@
+
+class MySuite extends munit.FunSuite {
+  
+  test("test1") {
+    assertEquals(Main.maxSum(List(112,131,411)), -1)
+  }
+
+  test("test2") {
+    assertEquals(Main.maxSum(List(2536,1613,3366,162)), 5902)
+  }
+
+  test("test3") {
+    assertEquals(Main.maxSum(List(51,71,17,24,42)), 88)
+  }
+
+}

max_sum_of_a_pair_with_equal_sum_of_digits/haskell_tests/Main.hs

@@ -0,0 +1,24 @@
+
+module Main where
+import Test.HUnit
+
+--Program start
+
+--Program end
+
+-- Test cases
+
+test1 :: Test
+test1 = TestCase (assertEqual "for (maximumSum [18,43,36,13,7])," 54 (maximumSum [18,43,36,13,7]))
+
+test2 :: Test
+test2 = TestCase (assertEqual "for (maximumSum [10,12,19,14])," (-1) (maximumSum [10,12,19,14]))
+
+
+-- Grouping test cases
+tests :: Test
+tests = TestList [TestLabel "Test1" test1]
+
+-- Running the tests
+main :: IO Counts
+main = runTestTT tests

max_sum_of_a_pair_with_equal_sum_of_digits/java_tests/Main.java

@@ -0,0 +1,21 @@
+
+import static org.junit.jupiter.api.Assertions.*;
+import org.junit.jupiter.api.Test;
+import java.util.List;
+import java.util.Arrays;
+import java.util.ArrayList;
+public class Main {
+    //Program start
+    
+    //Program end
+
+    @Test
+public void test1() {
+    assertEquals(54, maximumSum(new ArrayList<>(Arrays.asList(18,43,36,13,7))));
+}
+@Test
+public void test2() {
+    assertEquals(-1, maximumSum(new ArrayList<>(Arrays.asList(10,12,19,14))));
+}
+
+}

max_sum_of_a_pair_with_equal_sum_of_digits/meta.json

@@ -0,0 +1,3 @@
+version https://git-lfs.github.com/spec/v1
+oid sha256:52e93d04e8d646ecfb3f6195f07b528fe39cbd037de16659d92d2bf21a798cf5
+size 12127390

max_sum_of_a_pair_with_equal_sum_of_digits/ocaml_tests/main.ml

@@ -0,0 +1,26 @@
+
+module Main = struct
+    open OUnit2
+
+    (* Program start *)
+
+    (* Program end *)
+
+    (* Test cases *)
+    
+let test1 _ = assert_equal 54 (maximumSum [18;43;36;13;7])
+
+let test2 _ = assert_equal (-1) (maximumSum [10;12;19;14])
+
+
+    (* Grouping test cases *)
+    let suite = "Test Suite for maximumSum" >::: [
+        
+  "test1" >:: test1;
+  "test2" >:: test2;
+    ]
+
+
+    (* Running the tests *)
+    let () = run_test_tt_main suite
+end

max_sum_of_a_pair_with_equal_sum_of_digits/scala_tests/MySuite.scala

@@ -0,0 +1,12 @@
+
+class MySuite extends munit.FunSuite {
+  
+  test("test1") {
+    assertEquals(Main.maximumSum(List(18,43,36,13,7)), 54)
+  }
+
+  test("test2") {
+    assertEquals(Main.maximumSum(List(10,12,19,14)), -1)
+  }
+
+}

maximal_score_after_applying_k_operations/haskell_tests/Main.hs

@@ -0,0 +1,24 @@
+
+module Main where
+import Test.HUnit
+
+--Program start
+
+--Program end
+
+-- Test cases
+
+test1 :: Test
+test1 = TestCase (assertEqual "for (maxKelements [10,10,10,10,10] 5)," 50 (maxKelements [10,10,10,10,10] 5))
+
+test2 :: Test
+test2 = TestCase (assertEqual "for (maxKelements [1,10,3,3,3] 3)," 17 (maxKelements [1,10,3,3,3] 3))
+
+
+-- Grouping test cases
+tests :: Test
+tests = TestList [TestLabel "Test1" test1]
+
+-- Running the tests
+main :: IO Counts
+main = runTestTT tests

maximal_score_after_applying_k_operations/java_tests/Main.java

@@ -0,0 +1,21 @@
+
+import static org.junit.jupiter.api.Assertions.*;
+import org.junit.jupiter.api.Test;
+import java.util.List;
+import java.util.Arrays;
+import java.util.ArrayList;
+public class Main {
+    //Program start
+    
+    //Program end
+
+    @Test
+public void test1() {
+    assertEquals(50, maxKelements(new ArrayList<>(Arrays.asList(10,10,10,10,10)), 5));
+}
+@Test
+public void test2() {
+    assertEquals(17, maxKelements(new ArrayList<>(Arrays.asList(1,10,3,3,3)), 3));
+}
+
+}

maximal_score_after_applying_k_operations/meta.json

@@ -0,0 +1,3 @@
+version https://git-lfs.github.com/spec/v1
+oid sha256:0d82f3ba32de6e3fd42406b4657ffd00da2ffe52e090d2bf43699d369edd3286
+size 20201237

maximal_score_after_applying_k_operations/ocaml_tests/main.ml

@@ -0,0 +1,26 @@
+
+module Main = struct
+    open OUnit2
+
+    (* Program start *)
+
+    (* Program end *)
+
+    (* Test cases *)
+    
+let test1 _ = assert_equal 50 (maxKelements [10;10;10;10;10] 5)
+
+let test2 _ = assert_equal 17 (maxKelements [1;10;3;3;3] 3)
+
+
+    (* Grouping test cases *)
+    let suite = "Test Suite for maxKelements" >::: [
+        
+  "test1" >:: test1;
+  "test2" >:: test2;
+    ]
+
+
+    (* Running the tests *)
+    let () = run_test_tt_main suite
+end

maximal_score_after_applying_k_operations/scala_tests/MySuite.scala

@@ -0,0 +1,12 @@
+
+class MySuite extends munit.FunSuite {
+  
+  test("test1") {
+    assertEquals(Main.maxKelements(List(10,10,10,10,10),5), 50)
+  }
+
+  test("test2") {
+    assertEquals(Main.maxKelements(List(1,10,3,3,3),3), 17)
+  }
+
+}

maximize_amount_after_two_days_of_conversions/java_tests/Main.java

@@ -0,0 +1,25 @@
+
+import static org.junit.jupiter.api.Assertions.*;
+import org.junit.jupiter.api.Test;
+import java.util.List;
+import java.util.Arrays;
+import java.util.ArrayList;
+public class Main {
+    //Program start
+    
+    //Program end
+
+    @Test
+public void test1() {
+    assertEquals(720.00000, maxAmount("EUR", new ArrayList<>(Arrays.asList(new ArrayList<>(Arrays.asList("EUR","USD")),new ArrayList<>(Arrays.asList("USD","JPY")))), new ArrayList<>(Arrays.asList(2.0,3.0)), new ArrayList<>(Arrays.asList(new ArrayList<>(Arrays.asList("JPY","USD")),new ArrayList<>(Arrays.asList("USD","CHF")),new ArrayList<>(Arrays.asList("CHF","EUR")))), new ArrayList<>(Arrays.asList(4.0,5.0,6.0))));
+}
+@Test
+public void test2() {
+    assertEquals(1.50000, maxAmount("NGN", new ArrayList<>(Arrays.asList(new ArrayList<>(Arrays.asList("NGN","EUR")))) , rates1 = new ArrayList<>(Arrays.asList(9.0)) , pairs2 = new ArrayList<>(Arrays.asList(new ArrayList<>(Arrays.asList("NGN","EUR")))) , rates2 = new ArrayList<>(Arrays.asList(6.0)), new ArrayList<>(Arrays.asList(9.0)) , pairs2 = new ArrayList<>(Arrays.asList(new ArrayList<>(Arrays.asList("NGN","EUR")))) , rates2 = new ArrayList<>(Arrays.asList(6.0)), new ArrayList<>(Arrays.asList(new ArrayList<>(Arrays.asList("NGN","EUR")))) , rates2 = new ArrayList<>(Arrays.asList(6.0)), new ArrayList<>(Arrays.asList(6.0))));
+}
+@Test
+public void test3() {
+    assertEquals(1.00000, maxAmount("USD", new ArrayList<>(Arrays.asList(new ArrayList<>(Arrays.asList("USD","EUR")))), new ArrayList<>(Arrays.asList(1.0)), new ArrayList<>(Arrays.asList(new ArrayList<>(Arrays.asList("EUR","JPY")))), new ArrayList<>(Arrays.asList(10.0))));
+}
+
+}

maximize_area_of_square_hole_in_grid/haskell_tests/Main.hs

@@ -0,0 +1,45 @@
+
+module Main where
+import Test.HUnit
+
+--Program start
+
+--Program end
+
+-- Test cases
+
+test1 :: Test
+test1 = TestCase (assertEqual "for (maximizeSquareHoleArea 2 1 [2,3] [2])," 4 (maximizeSquareHoleArea 2 1 [2,3] [2]))
+
+test2 :: Test
+test2 = TestCase (assertEqual "for (maximizeSquareHoleArea 1 1 [2] [2])," 4 (maximizeSquareHoleArea 1 1 [2] [2]))
+
+test3 :: Test
+test3 = TestCase (assertEqual "for (maximizeSquareHoleArea 2 3 [2,3] [2,4])," 4 (maximizeSquareHoleArea 2 3 [2,3] [2,4]))
+
+test4 :: Test
+test4 = TestCase (assertEqual "for (maximizeSquareHoleArea 824467728 221817438 [56096705, 57870720, 69469937, 111791310, 129788017, 224924663, 244126653, 373088654, 478648892, 479737344, 484027317, 577078428, 613845263, 623404704, 652011224, 693982805, 726122581, 757518028, 774930667, 788601394] [2188056, 45814255, 51635174, 95034604, 121130097, 126531814, 179968387, 186279251, 193100682, 204173076])," 4 (maximizeSquareHoleArea 824467728 221817438 [56096705, 57870720, 69469937, 111791310, 129788017, 224924663, 244126653, 373088654, 478648892, 479737344, 484027317, 577078428, 613845263, 623404704, 652011224, 693982805, 726122581, 757518028, 774930667, 788601394] [2188056, 45814255, 51635174, 95034604, 121130097, 126531814, 179968387, 186279251, 193100682, 204173076]))
+
+test5 :: Test
+test5 = TestCase (assertEqual "for (maximizeSquareHoleArea 648154527 195491926 [6430521, 7662717, 14849099, 26729809, 34176525, 41416403, 43987631, 48927292, 59693806, 62867826, 63453627, 64973441, 73601229, 79276448, 84680728, 85005753, 89143319, 104246247, 112714767, 122033194, 134082507, 138491454, 150121923, 153922492, 177333276, 182168611, 186177986, 187117991, 193176285, 213168822, 217262633, 247009037, 252072557, 277050717, 277682614, 279480841, 295854348, 297703110, 302050964, 307032990, 308251895, 318537633, 329614972, 333618784, 334944731, 357626935, 360357188, 364551661, 400905292, 425738119, 427251943, 427438495, 430124900, 437443272, 452394867, 454476726, 456980047, 496329465, 503394056, 504896085, 508835065, 515695951, 522010615, 545056106, 550060412, 557832075, 566679909, 572459454, 579926387, 583147436, 585416538, 598188067, 600334621, 605754453, 619694351, 622515687, 625846917, 626010943, 638107878] [2321378, 4728768, 11190795, 22081869, 25588634, 25895890, 26934109, 27020593, 28711634, 36829047, 37341986, 43605991, 52537708, 54499808, 55275646, 55565717, 60970108, 66532120, 67215985, 67255256, 82268913, 86949955, 94715373, 100371042, 106605467, 108763282, 113409434, 127318992, 131467381, 134614906, 135710242, 137155445, 146012774, 151819645, 156567230, 158046183, 165292480, 174238526, 174665425, 182107718, 187191249, 190269183, 191586393, 195268811])," 4 (maximizeSquareHoleArea 648154527 195491926 [6430521, 7662717, 14849099, 26729809, 34176525, 41416403, 43987631, 48927292, 59693806, 62867826, 63453627, 64973441, 73601229, 79276448, 84680728, 85005753, 89143319, 104246247, 112714767, 122033194, 134082507, 138491454, 150121923, 153922492, 177333276, 182168611, 186177986, 187117991, 193176285, 213168822, 217262633, 247009037, 252072557, 277050717, 277682614, 279480841, 295854348, 297703110, 302050964, 307032990, 308251895, 318537633, 329614972, 333618784, 334944731, 357626935, 360357188, 364551661, 400905292, 425738119, 427251943, 427438495, 430124900, 437443272, 452394867, 454476726, 456980047, 496329465, 503394056, 504896085, 508835065, 515695951, 522010615, 545056106, 550060412, 557832075, 566679909, 572459454, 579926387, 583147436, 585416538, 598188067, 600334621, 605754453, 619694351, 622515687, 625846917, 626010943, 638107878] [2321378, 4728768, 11190795, 22081869, 25588634, 25895890, 26934109, 27020593, 28711634, 36829047, 37341986, 43605991, 52537708, 54499808, 55275646, 55565717, 60970108, 66532120, 67215985, 67255256, 82268913, 86949955, 94715373, 100371042, 106605467, 108763282, 113409434, 127318992, 131467381, 134614906, 135710242, 137155445, 146012774, 151819645, 156567230, 158046183, 165292480, 174238526, 174665425, 182107718, 187191249, 190269183, 191586393, 195268811]))
+
+test6 :: Test
+test6 = TestCase (assertEqual "for (maximizeSquareHoleArea 359468690 454270785 [9255764, 24817170, 25231024, 27200073, 28502084, 30110803, 47545895, 47617085, 48087899, 54345546, 64571339, 64984123, 65051604, 71733376, 72494846, 72763165, 82645381, 84167603, 94685994, 103297900, 104328402, 105153943, 111823293, 113998979, 118529352, 126747199, 128521183, 135973339, 158755954, 159571144, 162096085, 163884034, 167403114, 167720107, 176964725, 189841821, 189996188, 198243950, 204907082, 210715397, 221047178, 223805726, 228824290, 234893651, 238188320, 243455459, 264846760, 268016355, 270518804, 281466902, 284021975, 286681657, 300789237, 315737786, 316266985, 316842811, 318929493, 324730998, 325541997, 326134223, 326219219, 330067048, 347680557, 348107549, 356791227] [1105420, 4044057, 8630912, 22127180, 25837680, 27701285, 27946376, 29169029, 43992204, 52302911, 57516458, 61643051, 64182307, 65151218, 66550856, 67273320, 67615834, 69269946, 75192723, 78541115, 82610966, 89362508, 95678065, 102859077, 115137604, 123368976, 124273371, 137877339, 139897548, 154130398, 162158098, 163605277, 165377492, 165768141, 166601071, 167177757, 170582125, 174631670, 182126841, 182611780, 184009291, 185748646, 191138260, 195662206, 221814748, 225792188, 227159530, 228525447, 230702381, 234957023, 242658998, 252730009, 255561334, 266549076, 281555005, 282974308, 283708726, 292738584, 296253221, 296452284, 297245463, 299062426, 302607262, 303773409, 305780559, 306911066, 311599333, 312863707, 322409664, 322904148, 326480333, 328466490, 333910294, 336128668, 339246192, 339623380, 341166057, 342449389, 350741848, 351345909, 356277864, 360840019, 369213988, 374040779, 375613431, 385253070, 400932178, 410063788, 410124851, 412709754, 412948402, 419490314, 425943348, 425957843, 427922342, 450474869, 451981789])," 4 (maximizeSquareHoleArea 359468690 454270785 [9255764, 24817170, 25231024, 27200073, 28502084, 30110803, 47545895, 47617085, 48087899, 54345546, 64571339, 64984123, 65051604, 71733376, 72494846, 72763165, 82645381, 84167603, 94685994, 103297900, 104328402, 105153943, 111823293, 113998979, 118529352, 126747199, 128521183, 135973339, 158755954, 159571144, 162096085, 163884034, 167403114, 167720107, 176964725, 189841821, 189996188, 198243950, 204907082, 210715397, 221047178, 223805726, 228824290, 234893651, 238188320, 243455459, 264846760, 268016355, 270518804, 281466902, 284021975, 286681657, 300789237, 315737786, 316266985, 316842811, 318929493, 324730998, 325541997, 326134223, 326219219, 330067048, 347680557, 348107549, 356791227] [1105420, 4044057, 8630912, 22127180, 25837680, 27701285, 27946376, 29169029, 43992204, 52302911, 57516458, 61643051, 64182307, 65151218, 66550856, 67273320, 67615834, 69269946, 75192723, 78541115, 82610966, 89362508, 95678065, 102859077, 115137604, 123368976, 124273371, 137877339, 139897548, 154130398, 162158098, 163605277, 165377492, 165768141, 166601071, 167177757, 170582125, 174631670, 182126841, 182611780, 184009291, 185748646, 191138260, 195662206, 221814748, 225792188, 227159530, 228525447, 230702381, 234957023, 242658998, 252730009, 255561334, 266549076, 281555005, 282974308, 283708726, 292738584, 296253221, 296452284, 297245463, 299062426, 302607262, 303773409, 305780559, 306911066, 311599333, 312863707, 322409664, 322904148, 326480333, 328466490, 333910294, 336128668, 339246192, 339623380, 341166057, 342449389, 350741848, 351345909, 356277864, 360840019, 369213988, 374040779, 375613431, 385253070, 400932178, 410063788, 410124851, 412709754, 412948402, 419490314, 425943348, 425957843, 427922342, 450474869, 451981789]))
+
+test7 :: Test
+test7 = TestCase (assertEqual "for (maximizeSquareHoleArea 513845407 404729930 [9498806, 24352148, 26405388, 27651898, 29120890, 35580523, 35935007, 40101019, 41878929, 43875275, 47492182, 48765489, 49947516, 57203412, 70691276, 84689459, 93044660, 93240277, 116478336, 117804161, 121374583, 126526290, 127250131, 128954259, 140270029, 144382281, 151411099, 162023831, 169333919, 176901198, 177477309, 178153918, 200329379, 219309632, 222215304, 237300715, 238051959, 239700914, 244909518, 245695307, 256516573, 264532508, 274540881, 275257189, 275409284, 296767318, 299294449, 310014321, 310311984, 328990919, 332181119, 334885781, 336122402, 336540450, 343272953, 347359863, 357763119, 360735233, 361829604, 363988889, 364297422, 370095593, 372431502, 379878259, 395231596, 397228371, 432486147, 439270075, 451931045, 457121274, 461011188, 462758866, 471790725, 488482448, 502796998] [7671344, 42918529, 51213337, 53077756, 68507963, 79720886, 88498372, 94878359, 94989617, 96947040, 104440141, 120481914, 129237944, 129263763, 132196848, 132855888, 138269318, 140843085, 142137325, 144215133, 146746379, 149060324, 149754883, 153353075, 175860592, 185487225, 185623139, 188465466, 192858754, 193099577, 224300323, 226031151, 229378231, 229492038, 237501591, 245632691, 256378619, 263450073, 273647763, 280845842, 297022618, 298382686, 299668390, 307900589, 308020315, 334951794, 339915399, 351620655, 356959767, 366914867, 386510686, 386724344, 388224650, 390589082, 392646173, 394447827])," 4 (maximizeSquareHoleArea 513845407 404729930 [9498806, 24352148, 26405388, 27651898, 29120890, 35580523, 35935007, 40101019, 41878929, 43875275, 47492182, 48765489, 49947516, 57203412, 70691276, 84689459, 93044660, 93240277, 116478336, 117804161, 121374583, 126526290, 127250131, 128954259, 140270029, 144382281, 151411099, 162023831, 169333919, 176901198, 177477309, 178153918, 200329379, 219309632, 222215304, 237300715, 238051959, 239700914, 244909518, 245695307, 256516573, 264532508, 274540881, 275257189, 275409284, 296767318, 299294449, 310014321, 310311984, 328990919, 332181119, 334885781, 336122402, 336540450, 343272953, 347359863, 357763119, 360735233, 361829604, 363988889, 364297422, 370095593, 372431502, 379878259, 395231596, 397228371, 432486147, 439270075, 451931045, 457121274, 461011188, 462758866, 471790725, 488482448, 502796998] [7671344, 42918529, 51213337, 53077756, 68507963, 79720886, 88498372, 94878359, 94989617, 96947040, 104440141, 120481914, 129237944, 129263763, 132196848, 132855888, 138269318, 140843085, 142137325, 144215133, 146746379, 149060324, 149754883, 153353075, 175860592, 185487225, 185623139, 188465466, 192858754, 193099577, 224300323, 226031151, 229378231, 229492038, 237501591, 245632691, 256378619, 263450073, 273647763, 280845842, 297022618, 298382686, 299668390, 307900589, 308020315, 334951794, 339915399, 351620655, 356959767, 366914867, 386510686, 386724344, 388224650, 390589082, 392646173, 394447827]))
+
+test8 :: Test
+test8 = TestCase (assertEqual "for (maximizeSquareHoleArea 540203719 864386158 [18159674, 54458115, 62778378, 105777903, 131818737, 194080940, 244038247, 262050056, 286206787, 337137656, 367602942, 423073030, 448920818, 497900945, 501590248] [35697500, 40873154, 55587178, 70212840, 83049615, 104605908, 117210403, 142204973, 164821392, 170338629, 178466862, 225008410, 249713156, 274641087, 367085254, 437026354, 443960721, 469543004, 484630123, 495488252, 550562101, 568598551, 582853569, 606216360, 631280423, 660866337, 664702679, 665739751, 673375438, 689103748, 706193654, 709677611, 718350801, 735649368, 738289218, 788099121, 816988546, 855161537])," 4 (maximizeSquareHoleArea 540203719 864386158 [18159674, 54458115, 62778378, 105777903, 131818737, 194080940, 244038247, 262050056, 286206787, 337137656, 367602942, 423073030, 448920818, 497900945, 501590248] [35697500, 40873154, 55587178, 70212840, 83049615, 104605908, 117210403, 142204973, 164821392, 170338629, 178466862, 225008410, 249713156, 274641087, 367085254, 437026354, 443960721, 469543004, 484630123, 495488252, 550562101, 568598551, 582853569, 606216360, 631280423, 660866337, 664702679, 665739751, 673375438, 689103748, 706193654, 709677611, 718350801, 735649368, 738289218, 788099121, 816988546, 855161537]))
+
+test9 :: Test
+test9 = TestCase (assertEqual "for (maximizeSquareHoleArea 306351915 170728625 [5247734, 6079061, 9237115, 10210344, 18735942, 18801043, 31704472, 34374350, 37786580, 41329920, 52952414, 57841187, 59142238, 62765260, 69131402, 70371442, 70968505, 80531876, 80618403, 81987540, 83198640, 83451609, 86899465, 90117298, 94888971, 95000438, 108057111, 127535258, 128667837, 138755740, 142209698, 143701434, 147781485, 151796694, 153181137, 154457854, 154515138, 154578684, 157238033, 158110818, 158240020, 161801225, 162627294, 164088970, 164878347, 165278789, 169186408, 190248161, 192440465, 204436985, 207904201, 209956636, 211796619, 214406669, 219811640, 219975623, 220408551, 220653169, 220679563, 226638124, 228225203, 231397055, 233246494, 238298802, 239433853, 241737251, 241889954, 243026394, 243570863, 254465607, 254953716, 259241983, 260615116, 267478250, 267590678, 272683721, 274618475, 276297393, 279494171, 280297886, 287172606, 288190298, 292236599, 292902931, 300414435, 303413932, 304593687] [20269528, 26663327, 48521999, 124096886])," 4 (maximizeSquareHoleArea 306351915 170728625 [5247734, 6079061, 9237115, 10210344, 18735942, 18801043, 31704472, 34374350, 37786580, 41329920, 52952414, 57841187, 59142238, 62765260, 69131402, 70371442, 70968505, 80531876, 80618403, 81987540, 83198640, 83451609, 86899465, 90117298, 94888971, 95000438, 108057111, 127535258, 128667837, 138755740, 142209698, 143701434, 147781485, 151796694, 153181137, 154457854, 154515138, 154578684, 157238033, 158110818, 158240020, 161801225, 162627294, 164088970, 164878347, 165278789, 169186408, 190248161, 192440465, 204436985, 207904201, 209956636, 211796619, 214406669, 219811640, 219975623, 220408551, 220653169, 220679563, 226638124, 228225203, 231397055, 233246494, 238298802, 239433853, 241737251, 241889954, 243026394, 243570863, 254465607, 254953716, 259241983, 260615116, 267478250, 267590678, 272683721, 274618475, 276297393, 279494171, 280297886, 287172606, 288190298, 292236599, 292902931, 300414435, 303413932, 304593687] [20269528, 26663327, 48521999, 124096886]))
+
+
+-- Grouping test cases
+tests :: Test
+tests = TestList [TestLabel "Test1" test1, TestLabel "Test2" test2, TestLabel "Test3" test3, TestLabel "Test4" test4, TestLabel "Test5" test5, TestLabel "Test6" test6, TestLabel "Test7" test7, TestLabel "Test8" test8, TestLabel "Test9" test9]
+
+-- Running the tests
+main :: IO Counts
+main = runTestTT tests

maximize_area_of_square_hole_in_grid/java_tests/Main.java

@@ -0,0 +1,25 @@
+
+import static org.junit.jupiter.api.Assertions.*;
+import org.junit.jupiter.api.Test;
+import java.util.List;
+import java.util.Arrays;
+import java.util.ArrayList;
+public class Main {
+    //Program start
+    
+    //Program end
+
+    @Test
+public void test1() {
+    assertEquals(4, maximizeSquareHoleArea(2, 1, new ArrayList<>(Arrays.asList(2,3)), new ArrayList<>(Arrays.asList(2))));
+}
+@Test
+public void test2() {
+    assertEquals(4, maximizeSquareHoleArea(1, 1, new ArrayList<>(Arrays.asList(2)), new ArrayList<>(Arrays.asList(2))));
+}
+@Test
+public void test3() {
+    assertEquals(4, maximizeSquareHoleArea(2, 3, new ArrayList<>(Arrays.asList(2,3)), new ArrayList<>(Arrays.asList(2,4))));
+}
+
+}

maximize_area_of_square_hole_in_grid/meta.json

@@ -0,0 +1,819 @@
+{
+    "id": 3214,
+    "name": "maximize_area_of_square_hole_in_grid",
+    "difficulty": "Medium",
+    "link": "https://leetcode.com/problems/maximize-area-of-square-hole-in-grid/",
+    "date": "2023-11-11 00:00:00",
+    "task_description": "You are given the two integers, `n` and `m` and two integer arrays, `hBars` and `vBars`. The grid has `n + 2` horizontal and `m + 2` vertical bars, creating 1 x 1 unit cells. The bars are indexed starting from `1`. You can **remove** some of the bars in `hBars` from horizontal bars and some of the bars in `vBars` from vertical bars. Note that other bars are fixed and cannot be removed. Return an integer denoting the **maximum area** of a _square-shaped_ hole in the grid, after removing some bars (possibly none). **Example 1:** **Input: **n = 2, m = 1, hBars = [2,3], vBars = [2] **Output: **4 **Explanation:** The left image shows the initial grid formed by the bars. The horizontal bars are `[1,2,3,4]`, and the vertical bars are `[1,2,3]`. One way to get the maximum square-shaped hole is by removing horizontal bar 2 and vertical bar 2. **Example 2:** **Input: **n = 1, m = 1, hBars = [2], vBars = [2] **Output: **4 **Explanation:** To get the maximum square-shaped hole, we remove horizontal bar 2 and vertical bar 2. **Example 3:** **Input: **n = 2, m = 3, hBars = [2,3], vBars = [2,4] **Output: **4 **Explanation:** One way to get the maximum square-shaped hole is by removing horizontal bar 3, and vertical bar 4. **Constraints:** `1 <= n <= 109` `1 <= m <= 109` `1 <= hBars.length <= 100` `2 <= hBars[i] <= n + 1` `1 <= vBars.length <= 100` `2 <= vBars[i] <= m + 1` All values in `hBars` are distinct. All values in `vBars` are distinct.",
+    "public_test_cases": [
+        {
+            "label": "Example 1",
+            "input": "n = 2, m = 1, hBars = [2,3], vBars = [2]",
+            "output": "4 "
+        },
+        {
+            "label": "Example 2",
+            "input": "n = 1, m = 1, hBars = [2], vBars = [2]",
+            "output": "4 "
+        },
+        {
+            "label": "Example 3",
+            "input": "n = 2, m = 3, hBars = [2,3], vBars = [2,4]",
+            "output": "4 "
+        }
+    ],
+    "private_test_cases": [
+        {
+            "input": [
+                824467728,
+                221817438,
+                [
+                    56096705,
+                    57870720,
+                    69469937,
+                    111791310,
+                    129788017,
+                    224924663,
+                    244126653,
+                    373088654,
+                    478648892,
+                    479737344,
+                    484027317,
+                    577078428,
+                    613845263,
+                    623404704,
+                    652011224,
+                    693982805,
+                    726122581,
+                    757518028,
+                    774930667,
+                    788601394
+                ],
+                [
+                    2188056,
+                    45814255,
+                    51635174,
+                    95034604,
+                    121130097,
+                    126531814,
+                    179968387,
+                    186279251,
+                    193100682,
+                    204173076
+                ]
+            ],
+            "output": 4
+        },
+        {
+            "input": [
+                648154527,
+                195491926,
+                [
+                    6430521,
+                    7662717,
+                    14849099,
+                    26729809,
+                    34176525,
+                    41416403,
+                    43987631,
+                    48927292,
+                    59693806,
+                    62867826,
+                    63453627,
+                    64973441,
+                    73601229,
+                    79276448,
+                    84680728,
+                    85005753,
+                    89143319,
+                    104246247,
+                    112714767,
+                    122033194,
+                    134082507,
+                    138491454,
+                    150121923,
+                    153922492,
+                    177333276,
+                    182168611,
+                    186177986,
+                    187117991,
+                    193176285,
+                    213168822,
+                    217262633,
+                    247009037,
+                    252072557,
+                    277050717,
+                    277682614,
+                    279480841,
+                    295854348,
+                    297703110,
+                    302050964,
+                    307032990,
+                    308251895,
+                    318537633,
+                    329614972,
+                    333618784,
+                    334944731,
+                    357626935,
+                    360357188,
+                    364551661,
+                    400905292,
+                    425738119,
+                    427251943,
+                    427438495,
+                    430124900,
+                    437443272,
+                    452394867,
+                    454476726,
+                    456980047,
+                    496329465,
+                    503394056,
+                    504896085,
+                    508835065,
+                    515695951,
+                    522010615,
+                    545056106,
+                    550060412,
+                    557832075,
+                    566679909,
+                    572459454,
+                    579926387,
+                    583147436,
+                    585416538,
+                    598188067,
+                    600334621,
+                    605754453,
+                    619694351,
+                    622515687,
+                    625846917,
+                    626010943,
+                    638107878
+                ],
+                [
+                    2321378,
+                    4728768,
+                    11190795,
+                    22081869,
+                    25588634,
+                    25895890,
+                    26934109,
+                    27020593,
+                    28711634,
+                    36829047,
+                    37341986,
+                    43605991,
+                    52537708,
+                    54499808,
+                    55275646,
+                    55565717,
+                    60970108,
+                    66532120,
+                    67215985,
+                    67255256,
+                    82268913,
+                    86949955,
+                    94715373,
+                    100371042,
+                    106605467,
+                    108763282,
+                    113409434,
+                    127318992,
+                    131467381,
+                    134614906,
+                    135710242,
+                    137155445,
+                    146012774,
+                    151819645,
+                    156567230,
+                    158046183,
+                    165292480,
+                    174238526,
+                    174665425,
+                    182107718,
+                    187191249,
+                    190269183,
+                    191586393,
+                    195268811
+                ]
+            ],
+            "output": 4
+        },
+        {
+            "input": [
+                359468690,
+                454270785,
+                [
+                    9255764,
+                    24817170,
+                    25231024,
+                    27200073,
+                    28502084,
+                    30110803,
+                    47545895,
+                    47617085,
+                    48087899,
+                    54345546,
+                    64571339,
+                    64984123,
+                    65051604,
+                    71733376,
+                    72494846,
+                    72763165,
+                    82645381,
+                    84167603,
+                    94685994,
+                    103297900,
+                    104328402,
+                    105153943,
+                    111823293,
+                    113998979,
+                    118529352,
+                    126747199,
+                    128521183,
+                    135973339,
+                    158755954,
+                    159571144,
+                    162096085,
+                    163884034,
+                    167403114,
+                    167720107,
+                    176964725,
+                    189841821,
+                    189996188,
+                    198243950,
+                    204907082,
+                    210715397,
+                    221047178,
+                    223805726,
+                    228824290,
+                    234893651,
+                    238188320,
+                    243455459,
+                    264846760,
+                    268016355,
+                    270518804,
+                    281466902,
+                    284021975,
+                    286681657,
+                    300789237,
+                    315737786,
+                    316266985,
+                    316842811,
+                    318929493,
+                    324730998,
+                    325541997,
+                    326134223,
+                    326219219,
+                    330067048,
+                    347680557,
+                    348107549,
+                    356791227
+                ],
+                [
+                    1105420,
+                    4044057,
+                    8630912,
+                    22127180,
+                    25837680,
+                    27701285,
+                    27946376,
+                    29169029,
+                    43992204,
+                    52302911,
+                    57516458,
+                    61643051,
+                    64182307,
+                    65151218,
+                    66550856,
+                    67273320,
+                    67615834,
+                    69269946,
+                    75192723,
+                    78541115,
+                    82610966,
+                    89362508,
+                    95678065,
+                    102859077,
+                    115137604,
+                    123368976,
+                    124273371,
+                    137877339,
+                    139897548,
+                    154130398,
+                    162158098,
+                    163605277,
+                    165377492,
+                    165768141,
+                    166601071,
+                    167177757,
+                    170582125,
+                    174631670,
+                    182126841,
+                    182611780,
+                    184009291,
+                    185748646,
+                    191138260,
+                    195662206,
+                    221814748,
+                    225792188,
+                    227159530,
+                    228525447,
+                    230702381,
+                    234957023,
+                    242658998,
+                    252730009,
+                    255561334,
+                    266549076,
+                    281555005,
+                    282974308,
+                    283708726,
+                    292738584,
+                    296253221,
+                    296452284,
+                    297245463,
+                    299062426,
+                    302607262,
+                    303773409,
+                    305780559,
+                    306911066,
+                    311599333,
+                    312863707,
+                    322409664,
+                    322904148,
+                    326480333,
+                    328466490,
+                    333910294,
+                    336128668,
+                    339246192,
+                    339623380,
+                    341166057,
+                    342449389,
+                    350741848,
+                    351345909,
+                    356277864,
+                    360840019,
+                    369213988,
+                    374040779,
+                    375613431,
+                    385253070,
+                    400932178,
+                    410063788,
+                    410124851,
+                    412709754,
+                    412948402,
+                    419490314,
+                    425943348,
+                    425957843,
+                    427922342,
+                    450474869,
+                    451981789
+                ]
+            ],
+            "output": 4
+        },
+        {
+            "input": [
+                513845407,
+                404729930,
+                [
+                    9498806,
+                    24352148,
+                    26405388,
+                    27651898,
+                    29120890,
+                    35580523,
+                    35935007,
+                    40101019,
+                    41878929,
+                    43875275,
+                    47492182,
+                    48765489,
+                    49947516,
+                    57203412,
+                    70691276,
+                    84689459,
+                    93044660,
+                    93240277,
+                    116478336,
+                    117804161,
+                    121374583,
+                    126526290,
+                    127250131,
+                    128954259,
+                    140270029,
+                    144382281,
+                    151411099,
+                    162023831,
+                    169333919,
+                    176901198,
+                    177477309,
+                    178153918,
+                    200329379,
+                    219309632,
+                    222215304,
+                    237300715,
+                    238051959,
+                    239700914,
+                    244909518,
+                    245695307,
+                    256516573,
+                    264532508,
+                    274540881,
+                    275257189,
+                    275409284,
+                    296767318,
+                    299294449,
+                    310014321,
+                    310311984,
+                    328990919,
+                    332181119,
+                    334885781,
+                    336122402,
+                    336540450,
+                    343272953,
+                    347359863,
+                    357763119,
+                    360735233,
+                    361829604,
+                    363988889,
+                    364297422,
+                    370095593,
+                    372431502,
+                    379878259,
+                    395231596,
+                    397228371,
+                    432486147,
+                    439270075,
+                    451931045,
+                    457121274,
+                    461011188,
+                    462758866,
+                    471790725,
+                    488482448,
+                    502796998
+                ],
+                [
+                    7671344,
+                    42918529,
+                    51213337,
+                    53077756,
+                    68507963,
+                    79720886,
+                    88498372,
+                    94878359,
+                    94989617,
+                    96947040,
+                    104440141,
+                    120481914,
+                    129237944,
+                    129263763,
+                    132196848,
+                    132855888,
+                    138269318,
+                    140843085,
+                    142137325,
+                    144215133,
+                    146746379,
+                    149060324,
+                    149754883,
+                    153353075,
+                    175860592,
+                    185487225,
+                    185623139,
+                    188465466,
+                    192858754,
+                    193099577,
+                    224300323,
+                    226031151,
+                    229378231,
+                    229492038,
+                    237501591,
+                    245632691,
+                    256378619,
+                    263450073,
+                    273647763,
+                    280845842,
+                    297022618,
+                    298382686,
+                    299668390,
+                    307900589,
+                    308020315,
+                    334951794,
+                    339915399,
+                    351620655,
+                    356959767,
+                    366914867,
+                    386510686,
+                    386724344,
+                    388224650,
+                    390589082,
+                    392646173,
+                    394447827
+                ]
+            ],
+            "output": 4
+        },
+        {
+            "input": [
+                540203719,
+                864386158,
+                [
+                    18159674,
+                    54458115,
+                    62778378,
+                    105777903,
+                    131818737,
+                    194080940,
+                    244038247,
+                    262050056,
+                    286206787,
+                    337137656,
+                    367602942,
+                    423073030,
+                    448920818,
+                    497900945,
+                    501590248
+                ],
+                [
+                    35697500,
+                    40873154,
+                    55587178,
+                    70212840,
+                    83049615,
+                    104605908,
+                    117210403,
+                    142204973,
+                    164821392,
+                    170338629,
+                    178466862,
+                    225008410,
+                    249713156,
+                    274641087,
+                    367085254,
+                    437026354,
+                    443960721,
+                    469543004,
+                    484630123,
+                    495488252,
+                    550562101,
+                    568598551,
+                    582853569,
+                    606216360,
+                    631280423,
+                    660866337,
+                    664702679,
+                    665739751,
+                    673375438,
+                    689103748,
+                    706193654,
+                    709677611,
+                    718350801,
+                    735649368,
+                    738289218,
+                    788099121,
+                    816988546,
+                    855161537
+                ]
+            ],
+            "output": 4
+        },
+        {
+            "input": [
+                306351915,
+                170728625,
+                [
+                    5247734,
+                    6079061,
+                    9237115,
+                    10210344,
+                    18735942,
+                    18801043,
+                    31704472,
+                    34374350,
+                    37786580,
+                    41329920,
+                    52952414,
+                    57841187,
+                    59142238,
+                    62765260,
+                    69131402,
+                    70371442,
+                    70968505,
+                    80531876,
+                    80618403,
+                    81987540,
+                    83198640,
+                    83451609,
+                    86899465,
+                    90117298,
+                    94888971,
+                    95000438,
+                    108057111,
+                    127535258,
+                    128667837,
+                    138755740,
+                    142209698,
+                    143701434,
+                    147781485,
+                    151796694,
+                    153181137,
+                    154457854,
+                    154515138,
+                    154578684,
+                    157238033,
+                    158110818,
+                    158240020,
+                    161801225,
+                    162627294,
+                    164088970,
+                    164878347,
+                    165278789,
+                    169186408,
+                    190248161,
+                    192440465,
+                    204436985,
+                    207904201,
+                    209956636,
+                    211796619,
+                    214406669,
+                    219811640,
+                    219975623,
+                    220408551,
+                    220653169,
+                    220679563,
+                    226638124,
+                    228225203,
+                    231397055,
+                    233246494,
+                    238298802,
+                    239433853,
+                    241737251,
+                    241889954,
+                    243026394,
+                    243570863,
+                    254465607,
+                    254953716,
+                    259241983,
+                    260615116,
+                    267478250,
+                    267590678,
+                    272683721,
+                    274618475,
+                    276297393,
+                    279494171,
+                    280297886,
+                    287172606,
+                    288190298,
+                    292236599,
+                    292902931,
+                    300414435,
+                    303413932,
+                    304593687
+                ],
+                [
+                    20269528,
+                    26663327,
+                    48521999,
+                    124096886
+                ]
+            ],
+            "output": 4
+        },
+        {
+            "input": [
+                805192008,
+                165109117,
+                [
+                    20057484,
+                    28290147,
+                    32933723,
+                    34305321,
+                    50789706,
+                    50823443,
+                    68848320,
+                    92688044,
+                    106621839,
+                    116486269,
+                    118588482,
+                    124114394,
+                    130816098,
+                    132593082,
+                    154465792,
+                    167306766,
+                    182772969,
+                    185170570,
+                    198382016,
+                    199918217,
+                    225996706,
+                    228188108,
+                    233647455,
+                    247694290,
+                    258887511,
+                    275141064,
+                    275306640,
+                    283077890,
+                    284743921,
+                    306083375,
+                    308850285,
+                    313735400,
+                    323006815,
+                    324297852,
+                    325945505,
+                    326842761,
+                    331277253,
+                    336994732,
+                    350039008,
+                    355339911,
+                    369811096,
+                    377052576,
+                    385885146,
+                    392166100,
+                    398773942,
+                    399753059,
+                    401964979,
+                    405977146,
+                    410165865,
+                    414040233,
+                    415174842,
+                    429289798,
+                    444277839,
+                    448558613,
+                    457343914,
+                    463599676,
+                    466799017,
+                    473488531,
+                    479421481,
+                    483636956,
+                    501550619,
+                    507514260,
+                    521386312,
+                    522587724,
+                    526211576,
+                    534206604,
+                    551723393,
+                    556415670,
+                    558270328,
+                    577844992,
+                    578054043,
+                    580847724,
+                    585076921,
+                    593002912,
+                    612516677,
+                    623590745,
+                    631589721,
+                    647124371,
+                    662553525,
+                    664079167,
+                    681662487,
+                    682773978,
+                    683716203,
+                    688162739,
+                    694216445,
+                    699086583,
+                    701412509,
+                    722219403,
+                    746154582,
+                    765304876,
+                    776851631,
+                    785660967,
+                    794734581,
+                    803863116
+                ],
+                [
+                    2946789,
+                    5627036,
+                    7965376,
+                    8996838,
+                    15424016,
+                    26854011,
+                    33278201,
+                    42502586,
+                    47895262,
+                    63629772,
+                    78012281,
+                    81896630,
+                    87118991,
+                    91043692,
+                    96773289,
+                    102053048,
+                    103649158,
+                    105033297,
+                    117665219,
+                    130616843,
+                    135109615,
+                    137494076,
+                    144742924,
+                    151984224,
+                    154296782,
+                    158086599
+                ]
+            ],
+            "output": 4
+        }
+    ],
+    "haskell_template": "maximizeSquareHoleArea :: Int -> Int -> [Int] -> [Int] -> Int\nmaximizeSquareHoleArea n m hBars vBars ",
+    "ocaml_template": "let maximizeSquareHoleArea (n: int) (m: int) (hBars: int list) (vBars: int list) : int =  ",
+    "scala_template": "def maximizeSquareHoleArea(n: Int,m: Int,hBars: List[Int],vBars: List[Int]): Int = { \n    \n}",
+    "java_template": "class Solution {\n    public int maximizeSquareHoleArea(int n, int m, int[] hBars, int[] vBars) {\n        \n    }\n}",
+    "python_template": "class Solution(object):\n    def maximizeSquareHoleArea(self, n, m, hBars, vBars):\n        \"\"\"\n        :type n: int\n        :type m: int\n        :type hBars: List[int]\n        :type vBars: List[int]\n        :rtype: int\n        \"\"\"\n        "
+}

maximize_area_of_square_hole_in_grid/ocaml_tests/main.ml

@@ -0,0 +1,50 @@
+
+module Main = struct
+    open OUnit2
+
+    (* Program start *)
+
+    (* Program end *)
+
+    (* Test cases *)
+    
+let test1 _ = assert_equal 4 (maximizeSquareHoleArea 2 1 [2;3] [2])
+
+let test2 _ = assert_equal 4 (maximizeSquareHoleArea 1 1 [2] [2])
+
+let test3 _ = assert_equal 4 (maximizeSquareHoleArea 2 3 [2;3] [2;4])
+
+let test4 _ = assert_equal 4 (maximizeSquareHoleArea 824467728 221817438 [56096705; 57870720; 69469937; 111791310; 129788017; 224924663; 244126653; 373088654; 478648892; 479737344; 484027317; 577078428; 613845263; 623404704; 652011224; 693982805; 726122581; 757518028; 774930667; 788601394] [2188056; 45814255; 51635174; 95034604; 121130097; 126531814; 179968387; 186279251; 193100682; 204173076])
+
+let test5 _ = assert_equal 4 (maximizeSquareHoleArea 648154527 195491926 [6430521; 7662717; 14849099; 26729809; 34176525; 41416403; 43987631; 48927292; 59693806; 62867826; 63453627; 64973441; 73601229; 79276448; 84680728; 85005753; 89143319; 104246247; 112714767; 122033194; 134082507; 138491454; 150121923; 153922492; 177333276; 182168611; 186177986; 187117991; 193176285; 213168822; 217262633; 247009037; 252072557; 277050717; 277682614; 279480841; 295854348; 297703110; 302050964; 307032990; 308251895; 318537633; 329614972; 333618784; 334944731; 357626935; 360357188; 364551661; 400905292; 425738119; 427251943; 427438495; 430124900; 437443272; 452394867; 454476726; 456980047; 496329465; 503394056; 504896085; 508835065; 515695951; 522010615; 545056106; 550060412; 557832075; 566679909; 572459454; 579926387; 583147436; 585416538; 598188067; 600334621; 605754453; 619694351; 622515687; 625846917; 626010943; 638107878] [2321378; 4728768; 11190795; 22081869; 25588634; 25895890; 26934109; 27020593; 28711634; 36829047; 37341986; 43605991; 52537708; 54499808; 55275646; 55565717; 60970108; 66532120; 67215985; 67255256; 82268913; 86949955; 94715373; 100371042; 106605467; 108763282; 113409434; 127318992; 131467381; 134614906; 135710242; 137155445; 146012774; 151819645; 156567230; 158046183; 165292480; 174238526; 174665425; 182107718; 187191249; 190269183; 191586393; 195268811])
+
+let test6 _ = assert_equal 4 (maximizeSquareHoleArea 359468690 454270785 [9255764; 24817170; 25231024; 27200073; 28502084; 30110803; 47545895; 47617085; 48087899; 54345546; 64571339; 64984123; 65051604; 71733376; 72494846; 72763165; 82645381; 84167603; 94685994; 103297900; 104328402; 105153943; 111823293; 113998979; 118529352; 126747199; 128521183; 135973339; 158755954; 159571144; 162096085; 163884034; 167403114; 167720107; 176964725; 189841821; 189996188; 198243950; 204907082; 210715397; 221047178; 223805726; 228824290; 234893651; 238188320; 243455459; 264846760; 268016355; 270518804; 281466902; 284021975; 286681657; 300789237; 315737786; 316266985; 316842811; 318929493; 324730998; 325541997; 326134223; 326219219; 330067048; 347680557; 348107549; 356791227] [1105420; 4044057; 8630912; 22127180; 25837680; 27701285; 27946376; 29169029; 43992204; 52302911; 57516458; 61643051; 64182307; 65151218; 66550856; 67273320; 67615834; 69269946; 75192723; 78541115; 82610966; 89362508; 95678065; 102859077; 115137604; 123368976; 124273371; 137877339; 139897548; 154130398; 162158098; 163605277; 165377492; 165768141; 166601071; 167177757; 170582125; 174631670; 182126841; 182611780; 184009291; 185748646; 191138260; 195662206; 221814748; 225792188; 227159530; 228525447; 230702381; 234957023; 242658998; 252730009; 255561334; 266549076; 281555005; 282974308; 283708726; 292738584; 296253221; 296452284; 297245463; 299062426; 302607262; 303773409; 305780559; 306911066; 311599333; 312863707; 322409664; 322904148; 326480333; 328466490; 333910294; 336128668; 339246192; 339623380; 341166057; 342449389; 350741848; 351345909; 356277864; 360840019; 369213988; 374040779; 375613431; 385253070; 400932178; 410063788; 410124851; 412709754; 412948402; 419490314; 425943348; 425957843; 427922342; 450474869; 451981789])
+
+let test7 _ = assert_equal 4 (maximizeSquareHoleArea 513845407 404729930 [9498806; 24352148; 26405388; 27651898; 29120890; 35580523; 35935007; 40101019; 41878929; 43875275; 47492182; 48765489; 49947516; 57203412; 70691276; 84689459; 93044660; 93240277; 116478336; 117804161; 121374583; 126526290; 127250131; 128954259; 140270029; 144382281; 151411099; 162023831; 169333919; 176901198; 177477309; 178153918; 200329379; 219309632; 222215304; 237300715; 238051959; 239700914; 244909518; 245695307; 256516573; 264532508; 274540881; 275257189; 275409284; 296767318; 299294449; 310014321; 310311984; 328990919; 332181119; 334885781; 336122402; 336540450; 343272953; 347359863; 357763119; 360735233; 361829604; 363988889; 364297422; 370095593; 372431502; 379878259; 395231596; 397228371; 432486147; 439270075; 451931045; 457121274; 461011188; 462758866; 471790725; 488482448; 502796998] [7671344; 42918529; 51213337; 53077756; 68507963; 79720886; 88498372; 94878359; 94989617; 96947040; 104440141; 120481914; 129237944; 129263763; 132196848; 132855888; 138269318; 140843085; 142137325; 144215133; 146746379; 149060324; 149754883; 153353075; 175860592; 185487225; 185623139; 188465466; 192858754; 193099577; 224300323; 226031151; 229378231; 229492038; 237501591; 245632691; 256378619; 263450073; 273647763; 280845842; 297022618; 298382686; 299668390; 307900589; 308020315; 334951794; 339915399; 351620655; 356959767; 366914867; 386510686; 386724344; 388224650; 390589082; 392646173; 394447827])
+
+let test8 _ = assert_equal 4 (maximizeSquareHoleArea 540203719 864386158 [18159674; 54458115; 62778378; 105777903; 131818737; 194080940; 244038247; 262050056; 286206787; 337137656; 367602942; 423073030; 448920818; 497900945; 501590248] [35697500; 40873154; 55587178; 70212840; 83049615; 104605908; 117210403; 142204973; 164821392; 170338629; 178466862; 225008410; 249713156; 274641087; 367085254; 437026354; 443960721; 469543004; 484630123; 495488252; 550562101; 568598551; 582853569; 606216360; 631280423; 660866337; 664702679; 665739751; 673375438; 689103748; 706193654; 709677611; 718350801; 735649368; 738289218; 788099121; 816988546; 855161537])
+
+let test9 _ = assert_equal 4 (maximizeSquareHoleArea 306351915 170728625 [5247734; 6079061; 9237115; 10210344; 18735942; 18801043; 31704472; 34374350; 37786580; 41329920; 52952414; 57841187; 59142238; 62765260; 69131402; 70371442; 70968505; 80531876; 80618403; 81987540; 83198640; 83451609; 86899465; 90117298; 94888971; 95000438; 108057111; 127535258; 128667837; 138755740; 142209698; 143701434; 147781485; 151796694; 153181137; 154457854; 154515138; 154578684; 157238033; 158110818; 158240020; 161801225; 162627294; 164088970; 164878347; 165278789; 169186408; 190248161; 192440465; 204436985; 207904201; 209956636; 211796619; 214406669; 219811640; 219975623; 220408551; 220653169; 220679563; 226638124; 228225203; 231397055; 233246494; 238298802; 239433853; 241737251; 241889954; 243026394; 243570863; 254465607; 254953716; 259241983; 260615116; 267478250; 267590678; 272683721; 274618475; 276297393; 279494171; 280297886; 287172606; 288190298; 292236599; 292902931; 300414435; 303413932; 304593687] [20269528; 26663327; 48521999; 124096886])
+
+let test10 _ = assert_equal 4 (maximizeSquareHoleArea 805192008 165109117 [20057484; 28290147; 32933723; 34305321; 50789706; 50823443; 68848320; 92688044; 106621839; 116486269; 118588482; 124114394; 130816098; 132593082; 154465792; 167306766; 182772969; 185170570; 198382016; 199918217; 225996706; 228188108; 233647455; 247694290; 258887511; 275141064; 275306640; 283077890; 284743921; 306083375; 308850285; 313735400; 323006815; 324297852; 325945505; 326842761; 331277253; 336994732; 350039008; 355339911; 369811096; 377052576; 385885146; 392166100; 398773942; 399753059; 401964979; 405977146; 410165865; 414040233; 415174842; 429289798; 444277839; 448558613; 457343914; 463599676; 466799017; 473488531; 479421481; 483636956; 501550619; 507514260; 521386312; 522587724; 526211576; 534206604; 551723393; 556415670; 558270328; 577844992; 578054043; 580847724; 585076921; 593002912; 612516677; 623590745; 631589721; 647124371; 662553525; 664079167; 681662487; 682773978; 683716203; 688162739; 694216445; 699086583; 701412509; 722219403; 746154582; 765304876; 776851631; 785660967; 794734581; 803863116] [2946789; 5627036; 7965376; 8996838; 15424016; 26854011; 33278201; 42502586; 47895262; 63629772; 78012281; 81896630; 87118991; 91043692; 96773289; 102053048; 103649158; 105033297; 117665219; 130616843; 135109615; 137494076; 144742924; 151984224; 154296782; 158086599])
+
+
+    (* Grouping test cases *)
+    let suite = "Test Suite for maximizeSquareHoleArea" >::: [
+        
+  "test1" >:: test1;
+  "test2" >:: test2;
+  "test3" >:: test3;
+  "test4" >:: test4;
+  "test5" >:: test5;
+  "test6" >:: test6;
+  "test7" >:: test7;
+  "test8" >:: test8;
+  "test9" >:: test9;
+  "test10" >:: test10;
+    ]
+
+
+    (* Running the tests *)
+    let () = run_test_tt_main suite
+end

maximize_area_of_square_hole_in_grid/scala_tests/MySuite.scala

@@ -0,0 +1,44 @@
+
+class MySuite extends munit.FunSuite {
+  
+  test("test1") {
+    assertEquals(Main.maximizeSquareHoleArea(2,1,List(2,3),List(2)), 4)
+  }
+
+  test("test2") {
+    assertEquals(Main.maximizeSquareHoleArea(1,1,List(2),List(2)), 4)
+  }
+
+  test("test3") {
+    assertEquals(Main.maximizeSquareHoleArea(2,3,List(2,3),List(2,4)), 4)
+  }
+
+  test("test4") {
+    assertEquals(Main.maximizeSquareHoleArea(824467728,221817438,List(56096705, 57870720, 69469937, 111791310, 129788017, 224924663, 244126653, 373088654, 478648892, 479737344, 484027317, 577078428, 613845263, 623404704, 652011224, 693982805, 726122581, 757518028, 774930667, 788601394),List(2188056, 45814255, 51635174, 95034604, 121130097, 126531814, 179968387, 186279251, 193100682, 204173076)), 4)
+  }
+
+  test("test5") {
+    assertEquals(Main.maximizeSquareHoleArea(648154527,195491926,List(6430521, 7662717, 14849099, 26729809, 34176525, 41416403, 43987631, 48927292, 59693806, 62867826, 63453627, 64973441, 73601229, 79276448, 84680728, 85005753, 89143319, 104246247, 112714767, 122033194, 134082507, 138491454, 150121923, 153922492, 177333276, 182168611, 186177986, 187117991, 193176285, 213168822, 217262633, 247009037, 252072557, 277050717, 277682614, 279480841, 295854348, 297703110, 302050964, 307032990, 308251895, 318537633, 329614972, 333618784, 334944731, 357626935, 360357188, 364551661, 400905292, 425738119, 427251943, 427438495, 430124900, 437443272, 452394867, 454476726, 456980047, 496329465, 503394056, 504896085, 508835065, 515695951, 522010615, 545056106, 550060412, 557832075, 566679909, 572459454, 579926387, 583147436, 585416538, 598188067, 600334621, 605754453, 619694351, 622515687, 625846917, 626010943, 638107878),List(2321378, 4728768, 11190795, 22081869, 25588634, 25895890, 26934109, 27020593, 28711634, 36829047, 37341986, 43605991, 52537708, 54499808, 55275646, 55565717, 60970108, 66532120, 67215985, 67255256, 82268913, 86949955, 94715373, 100371042, 106605467, 108763282, 113409434, 127318992, 131467381, 134614906, 135710242, 137155445, 146012774, 151819645, 156567230, 158046183, 165292480, 174238526, 174665425, 182107718, 187191249, 190269183, 191586393, 195268811)), 4)
+  }
+
+  test("test6") {
+    assertEquals(Main.maximizeSquareHoleArea(359468690,454270785,List(9255764, 24817170, 25231024, 27200073, 28502084, 30110803, 47545895, 47617085, 48087899, 54345546, 64571339, 64984123, 65051604, 71733376, 72494846, 72763165, 82645381, 84167603, 94685994, 103297900, 104328402, 105153943, 111823293, 113998979, 118529352, 126747199, 128521183, 135973339, 158755954, 159571144, 162096085, 163884034, 167403114, 167720107, 176964725, 189841821, 189996188, 198243950, 204907082, 210715397, 221047178, 223805726, 228824290, 234893651, 238188320, 243455459, 264846760, 268016355, 270518804, 281466902, 284021975, 286681657, 300789237, 315737786, 316266985, 316842811, 318929493, 324730998, 325541997, 326134223, 326219219, 330067048, 347680557, 348107549, 356791227),List(1105420, 4044057, 8630912, 22127180, 25837680, 27701285, 27946376, 29169029, 43992204, 52302911, 57516458, 61643051, 64182307, 65151218, 66550856, 67273320, 67615834, 69269946, 75192723, 78541115, 82610966, 89362508, 95678065, 102859077, 115137604, 123368976, 124273371, 137877339, 139897548, 154130398, 162158098, 163605277, 165377492, 165768141, 166601071, 167177757, 170582125, 174631670, 182126841, 182611780, 184009291, 185748646, 191138260, 195662206, 221814748, 225792188, 227159530, 228525447, 230702381, 234957023, 242658998, 252730009, 255561334, 266549076, 281555005, 282974308, 283708726, 292738584, 296253221, 296452284, 297245463, 299062426, 302607262, 303773409, 305780559, 306911066, 311599333, 312863707, 322409664, 322904148, 326480333, 328466490, 333910294, 336128668, 339246192, 339623380, 341166057, 342449389, 350741848, 351345909, 356277864, 360840019, 369213988, 374040779, 375613431, 385253070, 400932178, 410063788, 410124851, 412709754, 412948402, 419490314, 425943348, 425957843, 427922342, 450474869, 451981789)), 4)
+  }
+
+  test("test7") {
+    assertEquals(Main.maximizeSquareHoleArea(513845407,404729930,List(9498806, 24352148, 26405388, 27651898, 29120890, 35580523, 35935007, 40101019, 41878929, 43875275, 47492182, 48765489, 49947516, 57203412, 70691276, 84689459, 93044660, 93240277, 116478336, 117804161, 121374583, 126526290, 127250131, 128954259, 140270029, 144382281, 151411099, 162023831, 169333919, 176901198, 177477309, 178153918, 200329379, 219309632, 222215304, 237300715, 238051959, 239700914, 244909518, 245695307, 256516573, 264532508, 274540881, 275257189, 275409284, 296767318, 299294449, 310014321, 310311984, 328990919, 332181119, 334885781, 336122402, 336540450, 343272953, 347359863, 357763119, 360735233, 361829604, 363988889, 364297422, 370095593, 372431502, 379878259, 395231596, 397228371, 432486147, 439270075, 451931045, 457121274, 461011188, 462758866, 471790725, 488482448, 502796998),List(7671344, 42918529, 51213337, 53077756, 68507963, 79720886, 88498372, 94878359, 94989617, 96947040, 104440141, 120481914, 129237944, 129263763, 132196848, 132855888, 138269318, 140843085, 142137325, 144215133, 146746379, 149060324, 149754883, 153353075, 175860592, 185487225, 185623139, 188465466, 192858754, 193099577, 224300323, 226031151, 229378231, 229492038, 237501591, 245632691, 256378619, 263450073, 273647763, 280845842, 297022618, 298382686, 299668390, 307900589, 308020315, 334951794, 339915399, 351620655, 356959767, 366914867, 386510686, 386724344, 388224650, 390589082, 392646173, 394447827)), 4)
+  }
+
+  test("test8") {
+    assertEquals(Main.maximizeSquareHoleArea(540203719,864386158,List(18159674, 54458115, 62778378, 105777903, 131818737, 194080940, 244038247, 262050056, 286206787, 337137656, 367602942, 423073030, 448920818, 497900945, 501590248),List(35697500, 40873154, 55587178, 70212840, 83049615, 104605908, 117210403, 142204973, 164821392, 170338629, 178466862, 225008410, 249713156, 274641087, 367085254, 437026354, 443960721, 469543004, 484630123, 495488252, 550562101, 568598551, 582853569, 606216360, 631280423, 660866337, 664702679, 665739751, 673375438, 689103748, 706193654, 709677611, 718350801, 735649368, 738289218, 788099121, 816988546, 855161537)), 4)
+  }
+
+  test("test9") {
+    assertEquals(Main.maximizeSquareHoleArea(306351915,170728625,List(5247734, 6079061, 9237115, 10210344, 18735942, 18801043, 31704472, 34374350, 37786580, 41329920, 52952414, 57841187, 59142238, 62765260, 69131402, 70371442, 70968505, 80531876, 80618403, 81987540, 83198640, 83451609, 86899465, 90117298, 94888971, 95000438, 108057111, 127535258, 128667837, 138755740, 142209698, 143701434, 147781485, 151796694, 153181137, 154457854, 154515138, 154578684, 157238033, 158110818, 158240020, 161801225, 162627294, 164088970, 164878347, 165278789, 169186408, 190248161, 192440465, 204436985, 207904201, 209956636, 211796619, 214406669, 219811640, 219975623, 220408551, 220653169, 220679563, 226638124, 228225203, 231397055, 233246494, 238298802, 239433853, 241737251, 241889954, 243026394, 243570863, 254465607, 254953716, 259241983, 260615116, 267478250, 267590678, 272683721, 274618475, 276297393, 279494171, 280297886, 287172606, 288190298, 292236599, 292902931, 300414435, 303413932, 304593687),List(20269528, 26663327, 48521999, 124096886)), 4)
+  }
+
+  test("test10") {
+    assertEquals(Main.maximizeSquareHoleArea(805192008,165109117,List(20057484, 28290147, 32933723, 34305321, 50789706, 50823443, 68848320, 92688044, 106621839, 116486269, 118588482, 124114394, 130816098, 132593082, 154465792, 167306766, 182772969, 185170570, 198382016, 199918217, 225996706, 228188108, 233647455, 247694290, 258887511, 275141064, 275306640, 283077890, 284743921, 306083375, 308850285, 313735400, 323006815, 324297852, 325945505, 326842761, 331277253, 336994732, 350039008, 355339911, 369811096, 377052576, 385885146, 392166100, 398773942, 399753059, 401964979, 405977146, 410165865, 414040233, 415174842, 429289798, 444277839, 448558613, 457343914, 463599676, 466799017, 473488531, 479421481, 483636956, 501550619, 507514260, 521386312, 522587724, 526211576, 534206604, 551723393, 556415670, 558270328, 577844992, 578054043, 580847724, 585076921, 593002912, 612516677, 623590745, 631589721, 647124371, 662553525, 664079167, 681662487, 682773978, 683716203, 688162739, 694216445, 699086583, 701412509, 722219403, 746154582, 765304876, 776851631, 785660967, 794734581, 803863116),List(2946789, 5627036, 7965376, 8996838, 15424016, 26854011, 33278201, 42502586, 47895262, 63629772, 78012281, 81896630, 87118991, 91043692, 96773289, 102053048, 103649158, 105033297, 117665219, 130616843, 135109615, 137494076, 144742924, 151984224, 154296782, 158086599)), 4)
+  }
+
+}

maximize_consecutive_elements_in_an_array_after_modification/java_tests/Main.java

@@ -0,0 +1,20 @@
+
+import static org.junit.jupiter.api.Assertions.*;
+import org.junit.jupiter.api.Test;
+import java.util.List;
+import java.util.Arrays;
+public class Main {
+    //Program start
+
+    //Program end
+
+    @Test
+public void test1() {
+    assertEquals(3, maxSelectedElements(Arrays.asList(2,1,5,1,1)));
+}
+@Test
+public void test2() {
+    assertEquals(1, maxSelectedElements(Arrays.asList(1,4,7,10)));
+}
+
+}