uid stringlengths 6 10 | seq_fragment stringlengths 5 1.39k | annotation stringclasses 1
value | interpro_label int64 0 288 | correct_ipr stringclasses 259
values | correct_letter stringclasses 4
values | distractor_source stringclasses 3
values | option_a_ipr stringclasses 351
values | option_a_desc stringclasses 351
values | option_b_ipr stringclasses 335
values | option_b_desc stringclasses 335
values | option_c_ipr stringclasses 348
values | option_c_desc stringclasses 348
values | option_d_ipr stringclasses 339
values | option_d_desc stringclasses 339
values |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
O77737 | VKQALREAGDEFELR | Motif | 67 | IPR020728 | B | pool | IPR034233 | Nucleolin, RNA recognition motif 2 | IPR020728 | Apoptosis regulator, Bcl-2, BH3 motif, conserved site | IPR034856 | RBM12, RNA recognition motif 4 | IPR041993 | G-patch domain and KOW motifs-containing protein, KOW 1 |
P52272 | YRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSRGCAVVEFKMEESMKKAAEVLNKHSLSGRPLKVKEDPD | Motif | 5 | IPR000504 | B | pool | IPR056791 | Mcm10, C-terminal zinc binding motif | IPR000504 | RNA recognition motif domain | IPR006643 | Zasp-like motif | IPR013646 | Obg-like GTPase YGR210-like, G4 motif-containing domain |
P52272 | STVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKDGKSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDER | Motif | 5 | IPR000504 | B | pool | IPR056791 | Mcm10, C-terminal zinc binding motif | IPR000504 | RNA recognition motif domain | IPR006643 | Zasp-like motif | IPR013646 | Obg-like GTPase YGR210-like, G4 motif-containing domain |
P52272 | CQIFVRNLPFDFTWKMLKDKFNECGHVLYADIKMENGKSKGCGVVKFESPEVAERACRMMNGMKLSGREIDVRIDRN | Motif | 5 | IPR000504 | B | pool | IPR056791 | Mcm10, C-terminal zinc binding motif | IPR000504 | RNA recognition motif domain | IPR006643 | Zasp-like motif | IPR013646 | Obg-like GTPase YGR210-like, G4 motif-containing domain |
Q6YZW2 | RSVYVGNVHPNVTESLLIEVFQSSGLVERCKLIRKEKSSFGFVDYYDRRSAALAIMTLHGRHICGQAIKVNWAYA | Motif | 5 | IPR000504 | D | pool | IPR037372 | Tripartite motif-containing protein 66, B-box type 1 zinc finger | IPR026179 | SLAIN motif-containing protein | IPR048559 | Disabled homolog 1/2, sulfatide-binding motif | IPR000504 | RNA recognition motif domain |
Q6YZW2 | FHIFVGDLSSEVNDATLYACFSAYPSCSDARVMWDNKTGRSRGYGFVSFRNQQEAETAITEMTGKWLGSRQIRCNWATK | Motif | 5 | IPR000504 | D | pool | IPR037372 | Tripartite motif-containing protein 66, B-box type 1 zinc finger | IPR026179 | SLAIN motif-containing protein | IPR048559 | Disabled homolog 1/2, sulfatide-binding motif | IPR000504 | RNA recognition motif domain |
Q6YZW2 | TTVYVGNLGHEVNRDELHRHFYNLGVGAIEEVRVQQDKGFGFVRYSNHGEAALAIQMANGLVVRGKPIKCSWGNK | Motif | 5 | IPR000504 | D | pool | IPR037372 | Tripartite motif-containing protein 66, B-box type 1 zinc finger | IPR026179 | SLAIN motif-containing protein | IPR048559 | Disabled homolog 1/2, sulfatide-binding motif | IPR000504 | RNA recognition motif domain |
Q1ZXC2 | SLYVGDLAADVNEIILNELFSKVGRNAIASIHVCRDSNTLRSLGYAYVNFFNNHDAERALDTLNYTLVHGKPCRIMWSYRDP | Motif | 146 | IPR034364 | D | hierarchy | IPR034843 | IGF2BP2, RNA recognition motif 1 | IPR034203 | RBM45, RNA recognition motif 1 | IPR034990 | hnRNPM, RNA recognition motif 3 | IPR034364 | PABP, RNA recognition motif 1 |
Q9LIE6 | SQFYNNNQTFFTTSTTASTAVTTTTAGDTTSIDSRLSPETGRVTKPTRRRSRASRRTPTTLLNTDTSNFRAMVQQYTGGPSAMAFGSGNTTSAFSLTSSSDPSAGSSQQAPWQYNFQPHAPLQPPQRPYMFSLNNVNPVVGYSNMNNPNTMVSGVFGTVDGSGGGGSA | Motif | 237 | IPR039609 | B | pool | IPR028671 | Syntaxin-2, SNARE motif | IPR039609 | VQ motif-containing protein 15/22 | IPR041994 | G-patch domain and KOW motifs-containing protein, KOW 2 | IPR034125 | RBM6, RNA recognition motif 2 |
O22137 | HKEFETGELVAKHLILQAGYNPSSYVLLSNMYASFGMWKDVRRVRTMMKERKIEKIPGCSWIE | Motif | 272 | IPR046848 | B | pool | IPR049059 | NAD-glutamate dehydrogenase, helical motif 1 | IPR046848 | E motif | IPR034371 | UHMK1, RNA recognition motif | IPR034932 | BRAP2, RNA recognition motif |
Q9LME6 | KRKRGRPRKIRNP | Motif | 56 | IPR017956 | A | pool | IPR017956 | AT hook, DNA-binding motif | IPR034146 | snRNP35, RNA recognition motif | IPR034278 | RBM3/CIRBP, RNA recognition motif | IPR019582 | RNA recognition motif, spliceosomal PrP8 |
Q9LME6 | KRKRGRPPKNKEE | Motif | 56 | IPR017956 | A | pool | IPR017956 | AT hook, DNA-binding motif | IPR034146 | snRNP35, RNA recognition motif | IPR034278 | RBM3/CIRBP, RNA recognition motif | IPR019582 | RNA recognition motif, spliceosomal PrP8 |
Q9CA73 | HGNVELGEEVQRRIFELDRDHVGDYVALSNIYASKGMWDEKSKMRDRVRKRRMPGKSWIE | Motif | 272 | IPR046848 | C | pool | IPR029369 | Domain of unknown function with conserved HDNR motif | IPR005108 | HELP motif | IPR046848 | E motif | IPR034191 | MARF1, RNA recognition motif 2 |
A6Q8H2 | DTVLKINGVGPKVGLAICST | Motif | 12 | IPR003583 | A | pool | IPR003583 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR031379 | CLLAC-motif containing domain | IPR005108 | HELP motif | IPR039184 | Sterile alpha and TIR motif-containing protein 1 |
A6Q8H2 | SMLKRVPGIGPKAASRILVE | Motif | 12 | IPR003583 | A | pool | IPR003583 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR031379 | CLLAC-motif containing domain | IPR005108 | HELP motif | IPR039184 | Sterile alpha and TIR motif-containing protein 1 |
A1A5R7 | STIYAGPFSKDCNVGSLKKVFSSLGPVQSITLVLETYRPYFSIQYELLEAAQLAIETMNGTILEGSCIRVHRLLT | Motif | 5 | IPR000504 | D | pool | IPR045848 | YKT6, SNARE motif | IPR031379 | CLLAC-motif containing domain | IPR040813 | Small RNA 2'-O-methyltransferase Hen1, La-motif C-terminal domain | IPR000504 | RNA recognition motif domain |
A1A5R7 | GTIYVAGIGETFKEHLLEQSNLFPDLEAVILPKELKSRKQKNYCFLKFKTFNSAQVALEVLKGKDWKLKGRNALTS | Motif | 5 | IPR000504 | D | pool | IPR045848 | YKT6, SNARE motif | IPR031379 | CLLAC-motif containing domain | IPR040813 | Small RNA 2'-O-methyltransferase Hen1, La-motif C-terminal domain | IPR000504 | RNA recognition motif domain |
Q56A08 | GHRVMVVLGPHAGKVGLLRSRDRAQSHALVQLRRENQVVELHYNAICQYMG | Motif | 253 | IPR041994 | B | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR041994 | G-patch domain and KOW motifs-containing protein, KOW 2 | IPR007166 | Class III signal peptide motif | IPR034451 | RNA-binding protein 27, RNA recognition motif |
Q4R4T6 | GNFADLGLEPRVLHALQEVAPEVVQPTTVQS | Motif | 49 | IPR014014 | D | pool | IPR010177 | Doubled CXXCH motif | IPR034979 | UPF3B, RNA recognition motif-like domain | IPR043937 | Golgin subfamily A , C-terminal binding motif | IPR014014 | RNA helicase, DEAD-box type, Q motif |
B3DWU2 | RLIFGLGIPHIGQKASEDLARYFGTMDKLSHATEEELLNLPFIGEIMARSIVNYFRKEANRR | Motif | 248 | IPR041663 | C | pool | IPR034823 | CID8-like protein, RNA recognition motif 1 | IPR024744 | Putative cyclic diguanylate phosphodiesterase, CSS motif-containing domain | IPR041663 | DisA/LigA, helix-hairpin-helix motif | IPR016611 | Mitochondrial intermembrane space cysteine motif-containing protein Mix14 |
Q10RI7 | AAFEDLKLTPELLKGLHDEMGFSRPSKIQA | Motif | 49 | IPR014014 | A | pool | IPR014014 | RNA helicase, DEAD-box type, Q motif | IPR000233 | Cadherin, Y-type LIR-motif | IPR012943 | Centrosomin, N-terminal motif 1 | IPR034536 | RBM15B, RNA recognition motif 3 |
A6ZSX1 | ESFSELNLVPELIQACKNLNYSKPTPIQS | Motif | 49 | IPR014014 | C | pool | IPR033110 | ROD1, RNA recognition motif 4 | IPR047942 | Ribonucleoprotein PTB-binding 2, RNA recognition motif 3 | IPR014014 | RNA helicase, DEAD-box type, Q motif | IPR034467 | Set1A, RNA recognition motif |
Q6ICX4 | PNRILLVTIHHMLYPITVDVLHQVFSPYGFVEKLVTFQKSAGFQALIQYQVQQCAASARTALQGRNIYDGCCQLDIQFSNLEELQVNY | Motif | 184 | IPR034796 | D | hierarchy | IPR034472 | RBM15, RNA recognition motif 2 | IPR034564 | U2 small nuclear ribonucleoprotein B'', RNA recognition motif 1 | IPR034211 | PUF60, RNA recognition motif 2 | IPR034796 | PTBPH3, RNA recognition motif 2 |
O43795 | RLEDLATLIQKIYRGWKCRTHFL | Motif | 1 | IPR000048 | C | pool | IPR033110 | ROD1, RNA recognition motif 4 | IPR006914 | VENN motif-containing domain | IPR000048 | IQ motif, EF-hand binding site | IPR034637 | Negative elongation factor E, RNA recognition motif |
O43795 | LMKKSQIVIAAWYRRYAQQKRYQ | Motif | 1 | IPR000048 | C | pool | IPR033110 | ROD1, RNA recognition motif 4 | IPR006914 | VENN motif-containing domain | IPR000048 | IQ motif, EF-hand binding site | IPR034637 | Negative elongation factor E, RNA recognition motif |
O43795 | QTKSSALVIQSYIRGWKARKILR | Motif | 1 | IPR000048 | C | pool | IPR033110 | ROD1, RNA recognition motif 4 | IPR006914 | VENN motif-containing domain | IPR000048 | IQ motif, EF-hand binding site | IPR034637 | Negative elongation factor E, RNA recognition motif |
O43795 | RCKEAVTTIAAYWHGTQARRELR | Motif | 1 | IPR000048 | C | pool | IPR033110 | ROD1, RNA recognition motif 4 | IPR006914 | VENN motif-containing domain | IPR000048 | IQ motif, EF-hand binding site | IPR034637 | Negative elongation factor E, RNA recognition motif |
O43795 | RNKHAIAVIWAYWLGSKARRELK | Motif | 1 | IPR000048 | C | pool | IPR033110 | ROD1, RNA recognition motif 4 | IPR006914 | VENN motif-containing domain | IPR000048 | IQ motif, EF-hand binding site | IPR034637 | Negative elongation factor E, RNA recognition motif |
O43795 | RRKHAVAVIWAYWLGLKVRREYR | Motif | 1 | IPR000048 | C | pool | IPR033110 | ROD1, RNA recognition motif 4 | IPR006914 | VENN motif-containing domain | IPR000048 | IQ motif, EF-hand binding site | IPR034637 | Negative elongation factor E, RNA recognition motif |
O70305 | VRKSTLNPNAKEFNPRS | Motif | 36 | IPR009818 | B | pool | IPR025527 | HUWE1/REV1, ubiquitin-binding motif | IPR009818 | PAM2 motif | IPR034591 | RBM12, RNA recognition motif 1 | IPR034564 | U2 small nuclear ribonucleoprotein B'', RNA recognition motif 1 |
Q9SVP7 | IHSFYVGDQNHPLADEIHEYFQDLTKR | Motif | 273 | IPR046849 | A | pool | IPR046849 | E2 motif | IPR045668 | FHF complex subunit HOOK-interacting protein, KELAA motif | IPR024929 | Nucleolar GTP-binding protein 2, circularly permuted GTPase motif | IPR029460 | DNA polymerase, helix-hairpin-helix motif |
Q56XI1 | HSQLDVAEFCAKKLIEIEPENSGTYILLSNMYASQGRWADVAELRKLMKTRLVRKSPGCSWTE | Motif | 272 | IPR046848 | B | pool | IPR039612 | VQ motif-containing protein 5/9/14 | IPR046848 | E motif | IPR034808 | Nop4, RNA recognition motif 3 | IPR019441 | FMP27/BLTP2/Hobbit, GFWDK motif-containing RBG unit |
Q9SZ70 | HARDFQLHLQQQQQHQQQHQQQQQQQFFLHHHQQPQRNLDQDHEQQGGSILNRSIKMDREETSDNMDNIANTNSGSEGKEMSLHGGEGGSGGGGSGEQMTRRPRGRPAGSKNKPKAPIIITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVCVMSGTGSVTNVTIRQPGSPPGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLEEDEMQTPVQGGGGGGGGGGGMGSPPMMGQQQAMAAMAAAQGLPPNLLGSVQLPPPQQNDQQYWSTGRP... | Motif | 50 | IPR014476 | A | pool | IPR014476 | AT-hook motif nuclear-localized protein 15-29 | IPR034930 | Matrin-3, RNA recognition motif 2 | IPR024759 | UvrB, YAD/RRR-motif-containing domain | IPR034260 | Yme2, RNA recognition motif |
A5CEJ4 | NMLQSVSGIGTKMALHILSN | Motif | 12 | IPR003583 | A | pool | IPR003583 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR046331 | GPALPP motifs-containing protein 1-like | IPR034992 | RNA-binding protein 10, RNA recognition motif 2 | IPR012943 | Centrosomin, N-terminal motif 1 |
A5CEJ4 | HQLKAISGVGPKLIDRLMIE | Motif | 12 | IPR003583 | A | pool | IPR003583 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR046331 | GPALPP motifs-containing protein 1-like | IPR034992 | RNA-binding protein 10, RNA recognition motif 2 | IPR012943 | Centrosomin, N-terminal motif 1 |
O60506 | QPSVGTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTFCTKEAAQEAVKLYNNHEIRSGKHIGVCISV | Motif | 172 | IPR034544 | C | hierarchy | IPR034419 | Probable RNA-binding protein 19, RNA recognition motif 3 | IPR034856 | RBM12, RNA recognition motif 4 | IPR034544 | Heterogeneous nuclear ribonucleoprotein Q, RNA recognition motif 1 | IPR034552 | p54nrb, RNA recognition motif 1 |
A6UDW8 | GVKVLPVDINHSDWDALLEGEGQFRKESVDPRHADMREVIKTRKAVRLGFRLVKGLKQADMGALVACRGEGYRSVHDLWFRSGLSRSVLERLADADAFRSLGLDRRA | Motif | 91 | IPR029460 | A | pool | IPR029460 | DNA polymerase, helix-hairpin-helix motif | IPR046793 | Cysteine protease ATG4, F-type LIR motif | IPR034914 | HuB, RNA recognition motif 3 | IPR038713 | Terminase small subunit, N-terminal DNA-binding domain, HTH motif superfamily |
Q6LA55 | GLKARVDNFTIDLHQRSEKHEVKNKANLGRKHQEATSMKVHLAEIDFKTIDLRAISASFDEGALDNSDSIPANVLDEEEKECFSFKNVDGPANWVDIDDYHEADWLLPQQNEKCSIYPLAFSPRFTYYRHTKCHRRNEKNEKEIIPDTCRFGDEFTHRCLMPSRENPKAVQYELLQKRRKELEEFMSSEQERIGFLKSQLESNNDSEEVRQEYEELTKRIVTLSDHYRLLEYLLKDESSCSQASQCSENGQVDLSYASLSESVHAFNNRFVAHNVQVKWNNFIRNAVMSYVHEVERVRGFAYYMSQKAIVFLRDLEKRTE... | Motif | 63 | IPR019449 | D | pool | IPR018892 | Retro-transposon transporting motif | IPR018334 | ArsR-type transcription regulator, HTH motif | IPR006914 | VENN motif-containing domain | IPR019449 | FMP27, WPPW motif-containing RBG unit |
Q9HEQ9 | FRVFVGRLSTSTKKSEIRSLFETVGTVRKVTIPFRRVRRGTRLVPSGIAFVTFNNQEDVDKAIETLNGKTLDDREIVVQKARP | Motif | 5 | IPR000504 | A | pool | IPR000504 | RNA recognition motif domain | IPR041994 | G-patch domain and KOW motifs-containing protein, KOW 2 | IPR015348 | Clathrin, heavy chain, linker, core motif | IPR040330 | LYR motif-containing protein 1 |
Q9HEQ9 | NSIYVSGLSVTLTNEGLKEMFDAYNPTRARIAVRSLPPYIIRRIKLRGEQRRGRGFGFVSFANAEDQSRAIEEMNGKQVGDLTLVVKSAVF | Motif | 5 | IPR000504 | A | pool | IPR000504 | RNA recognition motif domain | IPR041994 | G-patch domain and KOW motifs-containing protein, KOW 2 | IPR015348 | Clathrin, heavy chain, linker, core motif | IPR040330 | LYR motif-containing protein 1 |
Q9LNP2 | HKNVDIAEGIASQLSVLEPERTGSYMLLSNIYSAGGRWEESANVRALAKKKDLKKVSGSSWIE | Motif | 272 | IPR046848 | B | pool | IPR026179 | SLAIN motif-containing protein | IPR046848 | E motif | IPR000233 | Cadherin, Y-type LIR-motif | IPR034777 | Nop12, RNA recognition motif 1 |
Q04688 | DVKPVLNWVLDSKFKREQIRLKIPEAANEWTHAHVTYWLEWAVKQFELVGINMSDWQMNGQELCAMTHEEFNQKLPRDPGNIFWTHLQLLKECNFVS | Motif | 48 | IPR013761 | B | pool | IPR012899 | LTXXQ motif family protein | IPR013761 | Sterile alpha motif/pointed domain superfamily | IPR034264 | RBM48, RNA recognition motif | IPR037695 | IQ motif and ubiquitin-like domain-containing protein |
Q8SWQ4 | FVEGEFNNVKGVFIDQSYPLRIQCTNCGSPHEKSVVLSEDSVGEGDFGEKVNLSITCRCCRRIMTLKILKLKEGREVKKHLLPTNFEDEFKEVWLSDMQKSRFLVSRIETNGAEVTSIESCILNLVSNQDVLFTNVNFED | Motif | 32 | IPR008584 | C | pool | IPR018892 | Retro-transposon transporting motif | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 | IPR008584 | CXXC motif containing zinc binding protein, eukaryotic | IPR005108 | HELP motif |
Q4JXR6 | PGASAVIRCEDKHDGDIEYAGVNKAMAVEETNIYLFGKPRALARRRMGVAVATAENIDQARQRAEEAAGYIEV | Motif | 42 | IPR011054 | B | pool | IPR048559 | Disabled homolog 1/2, sulfatide-binding motif | IPR011054 | Rudiment single hybrid motif | IPR045844 | Ist3-like, RNA recognition motif | IPR034910 | LARP7, RNA recognition motif 2 |
Q12926 | GTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKTHK | Motif | 208 | IPR034914 | B | hierarchy | IPR034918 | HuD, RNA recognition motif 3 | IPR034914 | HuB, RNA recognition motif 3 | IPR034990 | hnRNPM, RNA recognition motif 3 | IPR034467 | Set1A, RNA recognition motif |
Q9FNN2 | RKSEFVRIITRALYSLGYDKTGAMLEEESGISL | Motif | 21 | IPR006594 | A | pool | IPR006594 | LIS1 homology motif | IPR034229 | eIF4H, RNA recognition motif | IPR047942 | Ribonucleoprotein PTB-binding 2, RNA recognition motif 3 | IPR010181 | CGCAxxGCC motif |
A6L5G8 | RRAMNIDGLGPETVDQFYQE | Motif | 12 | IPR003583 | B | pool | IPR033490 | Leucine-rich PPR motif-containing protein | IPR003583 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR034150 | SF3B6, RNA recognition motif | IPR034793 | PTBPH1/PTBPH2, RNA recognition motif 2 |
A6L5G8 | SDIINLERMGEKSAENIIKG | Motif | 12 | IPR003583 | B | pool | IPR033490 | Leucine-rich PPR motif-containing protein | IPR003583 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR034150 | SF3B6, RNA recognition motif | IPR034793 | PTBPH1/PTBPH2, RNA recognition motif 2 |
A6L5G8 | DNLIHVDEIGEKIAQSILLY | Motif | 12 | IPR003583 | B | pool | IPR033490 | Leucine-rich PPR motif-containing protein | IPR003583 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR034150 | SF3B6, RNA recognition motif | IPR034793 | PTBPH1/PTBPH2, RNA recognition motif 2 |
P50653 | KSSSEQLDSQTYPKLAAPSENPVEYFAHVEPGMFNTIVAKYNNGM | Motif | 39 | IPR010514 | A | pool | IPR010514 | COX aromatic rich motif | IPR043937 | Golgin subfamily A , C-terminal binding motif | IPR045347 | HIND motif | IPR056791 | Mcm10, C-terminal zinc binding motif |
P0C7M6 | KRVKAAGQIQAWWRGVLVRRTLL | Motif | 1 | IPR000048 | C | pool | IPR006643 | Zasp-like motif | IPR024744 | Putative cyclic diguanylate phosphodiesterase, CSS motif-containing domain | IPR000048 | IQ motif, EF-hand binding site | IPR006594 | LIS1 homology motif |
P0C7M6 | IQEQATVKLQSCIRMWQCRQCYR | Motif | 1 | IPR000048 | C | pool | IPR006643 | Zasp-like motif | IPR024744 | Putative cyclic diguanylate phosphodiesterase, CSS motif-containing domain | IPR000048 | IQ motif, EF-hand binding site | IPR006594 | LIS1 homology motif |
P37838 | PKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIALENTKDLKIDGRKVAVDFAVQKNRW | Motif | 188 | IPR034806 | B | hierarchy | IPR034914 | HuB, RNA recognition motif 3 | IPR034806 | Nop4, RNA recognition motif 2 | IPR034915 | HuC, RNA recognition motif 3 | IPR034411 | Heterogeneous nuclear ribonucleoprotein R, RNA recognition motif 2 |
Q80VG1 | PSPSPEVQDTRRPSSRNPSTWTVEDVVRFVKDADPEALGPHVELFRKHEIDGNALLLLRSDMIMKYLGLKLGPALKLCYHIDKLKQAK | Motif | 48 | IPR013761 | D | pool | IPR040330 | LYR motif-containing protein 1 | IPR020728 | Apoptosis regulator, Bcl-2, BH3 motif, conserved site | IPR043058 | KRIT, N-terminal NPxY motif-rich domain superfamily | IPR013761 | Sterile alpha motif/pointed domain superfamily |
Q8CIE4 | ALELRGLPPEIPDELITLYFENHRRSGGGLLLSWQRLGCGGVLIFQDPADAKRVLAQAEHRLHGVRLSLRP | Motif | 162 | IPR034464 | B | pool | IPR000233 | Cadherin, Y-type LIR-motif | IPR034464 | PARP-10, RNA recognition motif 1 and 2 | IPR034924 | TNRC6A, RNA recognition motif | IPR034880 | La-related protein 6, RNA recognition motif |
P62284 | RYLWATVTIQRHWRAYLRRKQDQ | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | MLKSSSLIIQAMFRRWKQRKMQL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KEEKSAIVIQSWYRMHKQLRKYV | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | YVRSCVVIIQKRFRCFQAQRLYK | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | RKRESILTIQKYYRAYLKGKIER | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | RPIRAACVIQSYWRMRQDRVRFL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | NLKKNIIKLQAHVRKHQQLQKYK | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KIKKAAVIIQTHFQAYIFARKVL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KTRSAVIVLQSAYRGMQARKMYI | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | HILTSVIKIQSYYRAYVSKKEFL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | SLKNATIKLQSIVKMKQTRKQYV | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | QMRESCIKLQAFVRGYLVRKQIR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | LQRKAVISLQSYFRMRKARQYYL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KMYKAVIIIQNYYHSYKAQVNQR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | RVKKAATCLQAAYRGYKVRQLIK | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | QQSVAAVKIQSAFRGYSKRVKYL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | SVLQSIIKIQRWYRAYKTLYDIRTRFL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KAKAAVISLQSAYRGWKVRKQIR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | REHQAAMKIQSAFRMAKAQKQFR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | LFKTAALVIQQHLRAWIAGRKQR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | ELRHSVLMLQSMWKGKTLRRDLQ | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | RQHTCAVIIQSYYRMHVQQKKWK | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | IMKEAALLIQKYYRACRIGREQH | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | ETKAAVLTLQSAYRGMKVRKRIK | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | ACNTAAITIQSKYRAYKTKKKYA | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | AYRASAIIIQRWYRGIKITNHQY | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | NLKKTAIKIQAVYRGIRVRRHIQ | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | HMHRAATFIKAMFKMHQPRIRYH | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | TMRKATIVIQVRYRAYHQGKMQR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KILKAVNILQANFRGVRVRRTLR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KLRIAATLIQSNYRRYRQQTYFN | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KLRHSVIYIQALFRGMKARRHLK | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | TMHIAATLIQRRFRALMLRRRFL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | RLQNAAIKIQSSYRRWMIRKKMR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | EMHRAAAFIQATFRMHRVHMRYH | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | RQRYSAVILQAAFRGMKTRRHLK | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | SAILIQSRFRSLLVRRRFI | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | QLRKAAITIQSSYRRLMVKKKLQ | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | EMHRAAVLIQATFRMHRTHITFQ | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | TWKHASILIQQHYRTYRASKLQR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KQWHSAVIIQAAYRGMKARQLLR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | EKHKAAIIIQSTYRMYRQYCLYQ | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | EQHQTSIIIQKHCKAFKIKKHYL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | VHTQAVICIQSYYRGFKVRRDIQ | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | NMHLAATRIQSFYRMHRAKVHYQ | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.