diff --git "a/data/extracted_text/circulars.json" "b/data/extracted_text/circulars.json" new file mode 100644--- /dev/null +++ "b/data/extracted_text/circulars.json" @@ -0,0 +1,10532 @@ +[ + { + "document_id": "circulars__Concession Rules (General Rules for Concession).pdf", + "document_name": "Concession Rules (General Rules for Concession).pdf", + "document_path": "circulars/Concession Rules (General Rules for Concession).pdf", + "doc_category": "circular", + "rule_type": "passenger_concessions", + "priority": 2, + "authority": "Indian Railways", + "description": "General rules governing passenger fare concessions", + "is_static": false, + "effective_year": null, + "page_number": 1, + "text": "GENERAL RULES FOR CONCESSION\nThe detailed rules, procedures, entitlement, purposes, etc for grant of concession are contained under different serial numbers in IRCA \nCoaching Tariff, Part I (Vol. II) which can be purchased from the General Secretary, I.R.C.A., Chelmsford Road, New Delhi. For any \ncomplaints or clarifications, the General Manager or the Chief Commercial Superintendent of the concerned Zonal Railway Administration \nshould be approached. The important general rules for concession, in reference to the above mentioned Tariff, are as under: \n \n1.(a)All concessional fares shall be calculated on the basis of fares for Mail/Express trains irrespective of the type of train , i.e. Mail or \nExpress or Passenger, by which the passenger travels. \n \n(b)Concession shall not be granted for any journey the cost of which is borne by the Central or State Government or a local authority or a \nStatutory body or a Corporation or a Government Undertaking or a University. \n \nHowever, the students participating in the tournaments held or recognized by the schools or universities will be eligible to th e concession. \n \n(c)Concession shall be admissible only in respect of basic fares. No concession is admissible in respect of other charges, viz. superfast \nsucharge, reservation fee, etc. However, in cases where concession has been allowed in Rajdhani/Shatabdi/Jan Shatabdi trains, t he \nconcession shall be admissible in the total charges (including catering) of these trains. \n \n(d)The concessions will be admissible subject to the minimum distance of 300 Kms, except in the case of students, blind, orthop aedically \nhandicapped/paraplegic persons, TB and Cancer patients, Kidney patients, non-infectious leprosy patients, mentally retarded persons, \nthalassamia major disease patients, Heart, Hemophilia Patients, War Widows, Widows of IPKF, Widows of martyrs of operation Vija y \n1999 (Kargil), Widows of defence personnel killed in action against terrorists & extremists, National Awardee Teachers, Shram A wardee \nIndustrial Workers, Widows of Policemen killed in action against terrorists & extremists, Senior Citizens, Allopathic Doctors, parents \naccompanying the National Bravery Awardee child, Police Medal Awardees, Dronacharya Awardees coaches, sportsmen, Unemployed \nYouths for attending interviews for jobs, and their escorts, wherever admissible under the rules, in whose case the above menti oned \ndistance restriction will not apply. However, the distance restrictions otherwise applicable to general public for travel in ea ch individual \ntrain will apply for issue of concessional tickets also. \n \n2.Only one type of concession is admissible at a time at the choice of passenger and no person is allowed two or more concessio ns \nsimultaneously. \n \n3.(a) Break of journey en-route shall not be allowed on a concession ticket for a journey for a specific purpose viz. a student travelling \nto/from an examination Centre, a Cancer patient travelling to/from a hospital, a professor travelling to/from a Conference, etc . It is allowed \nonly where a break of journey is a natural event. \n \n(b)Passengers breaking their journey are required to have their ticket endorsed from the Station Master where journey is broken. \n \n(c)Passengers terminating journey en route, must surrender their ticket at the station where the journey is terminated. Refund for the \nuntravelled portion on such tickets will not be allowed. \n \n4.Except Senior Citizens, concession on Indian Railway will be admissible on production of the requisite certificate from the c oncerned \nPerson/Organization in India and the documents issued by persons/organizations in other countries shall not be valid for the pu rpose of \nconcession. \n \n5.In the case of Senior citizens, no proof of age is required at the time of purchasing tickets. Concession tickets are issued on demand \nmade through the option in reservation form. However, they are required to carry some documentary proof showing their age or da te of \nbirth and produce it if demanded by some Railway Official during the journey. Any document issued by any Government Institution / \nAgency/Local Body, like Identity Card, Ration Card, Driving Licence, Pass Port, Educational certificate, certificate from \nPanchayat/Corporation/ Municipality, or any other authentic & recognised document, is acceptable for this purpose. The Pass Por t issued \nby foreign countries is also valid. \n \n6.The holder of a concession ticket is not permitted to change the ticket to a higher class even by paying the difference of ac tual fares. \nHowever, the categories of persons eligible for concession in first class (and not in AC 2-tier) can purchase tickets for AC 2-tier sleeper \nalso on payment of the first class concessional fare plus difference of actual fares of AC 2-tier sleeper & first class. \n \n7.Save as otherwise specifically provided, concession is not admissible in season tickets, circular journey tickets and prestig ious trains \nlike Rajdhani Express, Shatabdi Express, etc. which have separate all inclusive fare structure. Concession is admissible to any one in \nGarib Rath Express trains. \n \n8.In case where concessional Single/Return Journey Tickets or Season tickets or Circular journey tickets are to be issued for two or more \npersons, the concessional fare shall be calculated separately for each person. \n \n9.All the concessions are to be granted across the counters at Stations/ Reservation Offices/Booking Offices only. If some pers\non enters \nthe train without ticket or without proper ticket or extends journey on concession ticket or changes the concession to higher class, etc., he \nshall not be granted any concession in train, even if he is otherwise eligible for it under the rules.", + "extraction_method": "text" + }, + { + "document_id": "circulars__IRCTC Tatkal Booking FAQ.pdf", + "document_name": "IRCTC Tatkal Booking FAQ.pdf", + "document_path": "circulars/IRCTC Tatkal Booking FAQ.pdf", + "doc_category": "circular", + "rule_type": "tatkal", + "priority": 3, + "authority": "IRCTC", + "description": "Frequently asked questions related to Tatkal ticket booking", + "is_static": false, + "effective_year": null, + "page_number": 1, + "text": "Tatkal Booking \n1. What are the various classes of travel available in Tatkal? \n2. Can I select ladies or general quota along with tatkal quota? \n3. How can I use the internet reservation facility to book Tatkal quota? \n4. What are the concessions available in Tatkal scheme? \n5. How much extra should I pay for my ticket? \n6. When I can book a tatkal I-ticket and e-ticket ? \n7. Can I book tatkal ticket from all locations? \n8. What are the rules for cancellation? \n9. How can I get in touch with IRCTC? \n \n \n \n \n1. What are the various classes of travel available in Tatkal? \nA. Tatkal bookings are allowed in all classes except First AC and Executive class. \n \n \n \n2. Can I select ladies or general quota along with tatkal quota? \nA. Ladies and general quota cannot be opted for along with Tatkal quota. \n \n \n \n3. How can I use the internet reservation facility to book Tatkal quota? \nA. On Book Ticket enquiry box displayed on Home page, Please select Tatkal option from Quota \ndropdown. For some trains/class/locations Tatkal quota may not be available. Please chec k the \navailability before proceeding further. \n \n \n \n4. What are the concessions available in Tatkal scheme? \nA. No concession is allowed in Tatkal Booking. \n \n \n \n5. How much extra should I pay for my ticket? \nA. Tatkal charges per passenger in addition to normal ticket. \n \nThe Tatkal Charges have been fixed as a percentage of fare at the rate of 10% of basic fare for \nsecond class and 30% of basic fare for all other classes subject to minimum and maximum as \ngiven in the table below: -", + "extraction_method": "text" + }, + { + "document_id": "circulars__IRCTC Tatkal Booking FAQ.pdf", + "document_name": "IRCTC Tatkal Booking FAQ.pdf", + "document_path": "circulars/IRCTC Tatkal Booking FAQ.pdf", + "doc_category": "circular", + "rule_type": "tatkal", + "priority": 3, + "authority": "IRCTC", + "description": "Frequently asked questions related to Tatkal ticket booking", + "is_static": false, + "effective_year": null, + "page_number": 2, + "text": "Class of Travel Minimum Tatkal Charges Maximum Tatkal Charges \n \n(in Rs.) \n \n(in Rs.) \n \n \n \n Second (sitting) 10 15 \n \n Sleeper 100 200 \n \n AC Chair Car 125 225 \n \n AC 3 Tier 300 400 \n \n AC 2 Tier 400 500 \n \n Executive 400 500 \n \n \n \n \n \n \n6.When I can book a tatkal E-ticket? \n \nA. Tatkal E-ticket can be booked for selected trains one day in advance excluding date of journey from \nthe train originating station. It can be booked on the opening day from 10:00 hrs for AC class \n(2A/3A/CC/EC/3E) and at 11:00 hrs for Non - AC class(SL/FC/2S). e.g. if train is to depart from originating \nstation on 2nd August, for AC class Tatkal Booking will commence at 10:00 AM and for Non AC class will \nCommence at 11:00 AM on 1st August. \n \n \n \n7.Can I book tatkal ticket from all locations? \n \nA. Tatkal tickets will be issued for actual distance of travel, instead of end-to-end, subject to the distance \nrestriction applicable to the train. The same Tatkal berth/seat may be booked in multi ple legs till \npreparation of charts. For some trains/class/locations Tatkal quota may not be available. Please check \nthe availability before booking. \n \n \n \n8. What are the rules for cancellation? \n \nA. No refund will be granted on cancellation of confirmed Tatk al tickets. For contingent \ncancellation & waitlisted Tatkal ticket cancellations, charges will be deducted as per existing \nRailway rules. \n \n \n9. How can I get in touch with IRCTC? \n \nA. You can reach us at: \nhttps://equery.irctc.co.in and \n24 X 7 Customer Support at 08044647999 /08035734999 (Language: Hindi and English)", + "extraction_method": "text" + }, + { + "document_id": "circulars__IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "document_name": "IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "document_path": "circulars/IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "doc_category": "circular", + "rule_type": "tatkal", + "priority": 3, + "authority": "IRCTC", + "description": "User guide explaining Tatkal ticket booking process", + "is_static": false, + "effective_year": null, + "page_number": 1, + "text": "User Guide: Tatkal Ticket Booking \n \n• Register as an individual. Registration is FREE. \n \n Login by entering your User name and Password. \n \n Provide your desired From - To station, Date of Journey and Class of travel.", + "extraction_method": "text" + }, + { + "document_id": "circulars__IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "document_name": "IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "document_path": "circulars/IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "doc_category": "circular", + "rule_type": "tatkal", + "priority": 3, + "authority": "IRCTC", + "description": "User guide explaining Tatkal ticket booking process", + "is_static": false, + "effective_year": null, + "page_number": 2, + "text": " Select Tatkal option in the Quota dropdown. \n In case, you do not have any fixed date of journey, select “Flexible with Date” option. \n The Advance Reservation Period (ARP) of Tatkal scheme is reduced from two days to one day \nexcluding the day of journey from the train originating station. For example, if train is to depart from \nthe originating station on the second of the month, the Tatkal quota booking for that particular \ntrain will open at 10:00 hrs for AC class (1A/2A/3A/CC/EC/EA/3E) and at 11:00 hrs for \nNon- AC class (SL/FC/2S) on the first of the month from originating station. \n \n The next page displays the list of trains available for the selected route. \n If you wish to know the route and the timings, click on the train schedule link. \n To select the train from the train list, click on the type of class available in the selected train. The \nQuota option is available at right side of the above train list. \n The fare displayed is for a single adult Passenger. \n If you wish to select other train, click on another train.", + "extraction_method": "text" + }, + { + "document_id": "circulars__IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "document_name": "IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "document_path": "circulars/IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "doc_category": "circular", + "rule_type": "tatkal", + "priority": 3, + "authority": "IRCTC", + "description": "User guide explaining Tatkal ticket booking process", + "is_static": false, + "effective_year": null, + "page_number": 3, + "text": " To book Tatkal ticket in the selected train, click on “Book Now” button. \n Maximum of 4 (four) passengers per PNR can be booked on Tatkal e-tickets \n Passenger reservation page appears; check whether the train name, station names, class and \njourney date displayed at the left side of the page are same as desired by you. \n Enter the Names of the Passengers, Age, Gender, Berth Preference and Food Choice for each \npassenger. The maximum length of names should be restricted to 16 characters. \n Senior citizen concession is not allowed in Tatkal Quota. \n Click on “Consider for Auto Upgradation” for automatic class upgradation after charting. \n Enter the verification code \n Enter the Passenger mobile number to receive the booking and cancellation free SMS. • \n Click on Continue button. \n To change any details related to Train-Class, Quota, “Back” button may be used.", + "extraction_method": "text" + }, + { + "document_id": "circulars__IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "document_name": "IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "document_path": "circulars/IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "doc_category": "circular", + "rule_type": "tatkal", + "priority": 3, + "authority": "IRCTC", + "description": "User guide explaining Tatkal ticket booking process", + "is_static": false, + "effective_year": null, + "page_number": 4, + "text": " The ticket details, Total fare (including GST & Convenience Fee) and availability of berths at the \nparticular time appear on the screen. \n To change any details related to Passengers, Back button may be used. \n After checking all details, click on Continue button for Payment process.", + "extraction_method": "text" + }, + { + "document_id": "circulars__IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "document_name": "IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "document_path": "circulars/IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "doc_category": "circular", + "rule_type": "tatkal", + "priority": 3, + "authority": "IRCTC", + "description": "User guide explaining Tatkal ticket booking process", + "is_static": false, + "effective_year": null, + "page_number": 5, + "text": " All payment options are grouped under specific categories (viz. Credit cards, Net banking, \nWallets and Multiple payment service etc. \n Select the desired payment option from the displayed Payment Gateway menus. \n Click on \"Pay & Book\" button for redirection to selected Bank website.", + "extraction_method": "text" + }, + { + "document_id": "circulars__IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "document_name": "IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "document_path": "circulars/IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "doc_category": "circular", + "rule_type": "tatkal", + "priority": 3, + "authority": "IRCTC", + "description": "User guide explaining Tatkal ticket booking process", + "is_static": false, + "effective_year": null, + "page_number": 6, + "text": " After successful payment and booking of accommodations, Ticket Confirmation Page will \nappear. \n \n \n Virtual reservation message (VRM) in the form of SMS will be sent on Mobile Number (as \nprovided in the Passenger reservation form). \n Booking confirmation mail will be sent on Email ID (registered with IRCTC User ID). To print \nElectronic Reservation Slip (ERS), “Print Ticket” button may be used. \n To book ticket for Return/Onward Journey, “Book Return/Onward Ticket” button may be used. \nUsing this option will retain the details of Passengers as provided in the current ticket. \n To book another ticket, “Book Another Ticket” button may be used. \n The customer can subsequently also print Electronic Reservation Slip from the link under “My \nAccount >> My Transactions >> Booked Ticket History”.", + "extraction_method": "text" + }, + { + "document_id": "circulars__IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "document_name": "IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "document_path": "circulars/IRCTC User Guide_ Tatkal Ticket Booking (IRCTC).pdf", + "doc_category": "circular", + "rule_type": "tatkal", + "priority": 3, + "authority": "IRCTC", + "description": "User guide explaining Tatkal ticket booking process", + "is_static": false, + "effective_year": null, + "page_number": 7, + "text": "", + "extraction_method": "text" + }, + { + "document_id": "circulars__IRCTC – Rules & Regulations (For Agents).pdf", + "document_name": "IRCTC – Rules & Regulations (For Agents).pdf", + "document_path": "circulars/IRCTC – Rules & Regulations (For Agents).pdf", + "doc_category": "circular", + "rule_type": "agent_rules", + "priority": 2, + "authority": "IRCTC", + "description": "Rules and regulations applicable to IRCTC agents", + "is_static": false, + "effective_year": null, + "page_number": 1, + "text": "Rules & Regulations for Reserved Rail e-Ticketing Service Providers \n(PSPs/RSPs) \nA. Do’s for Service providers \n \nI. Mandates for Registration \ni. Retail Service Provider is registered with IRCTC by the Principal Service Provider and \nRSP Id is issued by IRCTC for booking of e- Tickets only. \n \nii. Verification of Aadhar No. of RSP is mandatory at the time of registration of RSP for \nbooking reserved rail e-tickets for customers. \n \niii. PAN No. is also mandatory for registration of RSP. \n \niv. Authentication of RSP is done for every login by sending OTP (One Time Password) to the \nregistered Mobile Number of RSP. \n \nv. Onus of responsibility lies on the PSP to prevent sharing of Ids by RSP. \n \nvi. RSPs are required to give the correct address, Unique Mobile No. and Unique e-mail id & \nPAN No. for registration with IRCTC. \n \nvii. Change of address should be intimated to IRCTC immediately along with the original \ncertificate issued by PSP. \n \nviii. IRCTC’s rules & regulations are to be read properly & followed strictly. Ignorance of the \nsame cannot be considered as a valid reason. The Principal Service Provider (PSP)/ RSP \nmust be fully aware of the extant rules. \n \nix. RSPs should verify the ids provided to them. If by mistake, id of another RSP is issued to \nthem they should immediately inform their PSP. \n \nx. RSPs should keep a sign board outside their agency in which IRCTC’s logo can be \ndisplayed. IRCTC’s logo (Soft copy) will be sent by e-mail on request by the PSP/RSP. Sign \nBoard should include: display of rules & regulations, IRCTC service charges, agent services \ncharges, payment gateway charges etc. \n \nxi. PSP should issue to all its RSPs a Certificate of Authorisation for booking rail e -tickets to \nthe customer. \n \nxii. Certificate of Authorization issued by PSP should be prominently displayed at the RSP \noutlet/Agency/Counter/Centre. \n \nxiii. PSPs/ RSPs should practice good business ethics. \n \n \nII. Mandates for Booking \ni. Tickets should be booked only when the customer approaches the RSP.", + "extraction_method": "text" + }, + { + "document_id": "circulars__IRCTC – Rules & Regulations (For Agents).pdf", + "document_name": "IRCTC – Rules & Regulations (For Agents).pdf", + "document_path": "circulars/IRCTC – Rules & Regulations (For Agents).pdf", + "doc_category": "circular", + "rule_type": "agent_rules", + "priority": 2, + "authority": "IRCTC", + "description": "Rules and regulations applicable to IRCTC agents", + "is_static": false, + "effective_year": null, + "page_number": 2, + "text": "ii. The RSP must ensure that the transaction (Booking or cancellation) is done with the \ncomplete knowledge and acceptance of the customer. \n \niii. It is mandatory for all RSPs to maintain the written/ electronic requests of the \ncustomer and also keep a copy of the ID proof from the customers for both booking \n& cancellation of the tickets at the RSP outlet for a period of six months. These \nrequests are to be preserved for a period of six months. The details of the customer \nshould be provided to IRCTC as and when required. In the absence of written request \nand/or ID proof, a penalty of Rs. 5,000/- + Taxes per case will be imposed. \n \niv. Mobile number of the customer or one of the passenger(s) while booking the ticket is \nmandatory. Mobile number o f the passenger(s) must be indicated correctly on the \nERS. RSP should ensure that mobile number of passenger has been correctly filled \nin. In case of violation of the same a penalty of Rs. 5,000/ - + Taxes per case will \nbe imposed. \n \nv. The ERS issued by all the PSPs/ RSPs should be strictly in the formas prescribed by \nIRCTC. ERS issued by the PSP/ RSP should contain name and full address contact \ndetails of the same RSP who issued the ERS along with the name of the PSP. \n \nvi. RSPs must issue Invoice on their own stationary for the amount collected from the \ncustomers. \n \nvii. The Invoice should contain details like Railway Fare, IRCTC’s service charges, \nagent's service charges, payment gateway charge. (The applicable Tax is included \nin the Agents Service Charges and the same should be shown separately in the \nInvoice). \n \nviii. Service charges of Agent are applicable only during booking transaction. There is \nno service charge to RSPs for cancellation transactions. \n \nIII. Mandates for Cancellation/Refund of Tickets \ni. RSP should cancel the ticket, only on request of the customer. \n \nii. When the RSP cancels a customer’s ticket on his request, an OTP SMS will be sent \nto the passenger mobile No. The passenger will share the OTP with the RSP and \nthe RSP will then refund the cancellation amount to the customer. \n \niii. When RSP cancels the ticket, refund will be processed and the cancellation amount \nwill be credited to the same account through which the ticket was booked, based on \ncorrect OTP inputs. \n \niv. The cancellation refund amount will not be processed for those cancelled tickets \nwhich were booked/cancelled by RSPs, if correct OTP/OTP is not received. \n \nIV. Mandates for Filing TDR/Refund \ni. It is mandatory for the RSPs to obtain a written request from the customers before TDR \ncases are filed with the Railways.", + "extraction_method": "text" + }, + { + "document_id": "circulars__IRCTC – Rules & Regulations (For Agents).pdf", + "document_name": "IRCTC – Rules & Regulations (For Agents).pdf", + "document_path": "circulars/IRCTC – Rules & Regulations (For Agents).pdf", + "doc_category": "circular", + "rule_type": "agent_rules", + "priority": 2, + "authority": "IRCTC", + "description": "Rules and regulations applicable to IRCTC agents", + "is_static": false, + "effective_year": null, + "page_number": 3, + "text": "ii. In the absence of written request/soft copy of the customer for filing TDR Claim, a \npenalty of Rs. 5000/- + Taxes per case will be imposed. \n \niii. If cash cards are used, it is pertinent to retain the exhausted cards for refunds, if any. \n \niv. RSP must refund the money as per cancellation rules to the customer immediately in all \ncases. \nv. In case of refund of e - tickets which could not be cancelled on website and TDR has been \nfilled, the agent must inform the customer about the TDR refund process, take contact details \n& remit the refund to the customer as and when it is credited in the RSP’s account. \n \nvi. TDR refund status can be checked by PSP/RSP from online Web interface provided to PSP. \nIn case of any issue on TDR Status, PSP mail to tdrprocess@irctc.co.in for checking the TDR \nrefund status. \n \nvii. The PSP should refund the TDR claim amount to the RSP within 3 working days after the \nsame is received from IRCTC. \n \nviii. The RSP should refund the TDR claim amoun t to the customer within 5 working days after \nthe same is received from its PSP. \n \nix. Whenever the TDR refund amount which is credited back in the agent’s account used for \nticket booking could not be refunded to the customer due to various reasons, the refund \namount must be returned back to IRCTC after 5 working days. PSP should set a mechanism \nfor this purpose. \n \nx. If the TDR Claim amount is not refunded to the customer within the prescribed time limit \nand the same is not returned to IRCTC, it will be tre ated as non refund to customer and \npenalty shall be imposed as per the provisions mentioned hereunder. \n \nxi. Along with the refund, the refund details must be provided to the customer during \ncancellation. \n \nV. Mandates for the PSP \ni. PSP should register their Outle ts/Centres/counters/Agency who have basic minimum \nInfrastructure like Internet connection and own office with sufficient space for the customers \nto visit and book Reserved Rail E-tickets. \nii. PSP should ensure proper credential verification before appointing RSP and keep a record of \nthese documents and should be able to provide them to IRCTC as and when required. KYC of \nthe RSP is the responsibility of the PSP. \n \niii. It will be obligatory on the part of the PSP to control the activities of their RSP. The PSP will \nbe equally liable for all civil and criminal liabilities of their RSP. \n \niv. PSPs with or without web services should keep a close watch on the conduct of their RSPs & \nin case of receipt of complaint against any RSP by the customers then the agent ID should be \nsuspended immediately, under intimation to IRCTC.", + "extraction_method": "text" + }, + { + "document_id": "circulars__IRCTC – Rules & Regulations (For Agents).pdf", + "document_name": "IRCTC – Rules & Regulations (For Agents).pdf", + "document_path": "circulars/IRCTC – Rules & Regulations (For Agents).pdf", + "doc_category": "circular", + "rule_type": "agent_rules", + "priority": 2, + "authority": "IRCTC", + "description": "Rules and regulations applicable to IRCTC agents", + "is_static": false, + "effective_year": null, + "page_number": 4, + "text": "v. PSP must monitor each RSPs activity. PSPs will have to conduct decoy checks as indicated in \nthe Policy against each slab every month. Penalty of Rs.5000/ - multiplied by number of \nshortfall of decoy checks in a month will be imposed on PSPs. \n \nvi. PSP must make changes in front end software on the portal for a provision to store mobile \nnumber of any one of the desiring passenger(s) travelling on e-ticket and strictly ensure that \nwhile filling of requisition slip for booking e-ticket, RSPs obtain and feed the mobile number \nof passenger for sending SMS alerts in all cases wherever the mobile number is available. \n \nvii. Compliance has to be ensured from the PSPs in this regard and watch should be kept for any \nfake number/ repeat number/ dysfunctional number being fed when booking/ cancellation \nis done by RSP. \n \nviii. PSPs should educate their RSPs regarding rules and regulations of IRCTC or about ticket \nbooking software (in case of web services agents) etc. \n \nix. PSP can deactivate the RSPs who are found to be non-transacting (Not booked e-tickets) for \nperiod of six months \n \nx. PSP should ensure complete sharing of information & full cooperation with IRCTC. \n \nxi. All mails / references made by IRCTC in RSPs matter should be replied ba ck within 5 (five) \nworking days. \n \nxii. Request for additional registrations will be considered at the discretion of the competent \nauthority. \n \nxiii. Contract Renewal of the PSP will be extended annually subject to payment of applicable \nAnnual Maintenance Charges and no pending dues/ penalties due to complaints against their \nrespective RSPs. Request for renewal of contract should be made by PSP along with the \npayment of applicable Annual Maintenance Charges (AMC) at least 15 (Fifteen) working days \nbefore the date of expiry of the contract every year. In case the renewal of contract is not \napproved by Competent Authority by the date of expiry of contract, the services will be \nautomatically suspended till all the renewal formalities are completed and subject to no \npending dues/penalties. \n \nB. Don’ts for the Service providers \n \n1. No advertisement in any form whether in print or press media is to be issued without prior \npermission from IRCTC in writing. \n2. Collection of extra charges in any form whether for cancellation of the ticket or checking the \navailability status from the customers forbidden. \n \n3. Booking of I- tickets or counter tickets is prohibited & punishable with minimum punishment \nof immediate deactivation of the user id. \n \n4. Sharing of access credentials to web services an d engagement with any other third party in \nany manner whatsoever to sell e -tickets by any mode or manner including a e -commerce \nplatform operating through a website or Smartphone application or tablet application is \nstrictly prohibited. Transfer/Sharing o f RSP ID given to RSPs by IRCTC is prohibited and \nIRCTC will initiate action against the agent group if found guilty in such matters.", + "extraction_method": "text" + }, + { + "document_id": "circulars__IRCTC – Rules & Regulations (For Agents).pdf", + "document_name": "IRCTC – Rules & Regulations (For Agents).pdf", + "document_path": "circulars/IRCTC – Rules & Regulations (For Agents).pdf", + "doc_category": "circular", + "rule_type": "agent_rules", + "priority": 2, + "authority": "IRCTC", + "description": "Rules and regulations applicable to IRCTC agents", + "is_static": false, + "effective_year": null, + "page_number": 5, + "text": "5. RSPs should not any other wrong ID or through Personal User ID. RSPs should book tickets \nusing only IRCTC provided agent ids. RSPs if found to be using wrong id/Personal User Ids \nfor commercial gains, then their ids will be deactivated immediately as well as punitive/Legal \naction will be taken against them. \n \n6. Transfer & re-sale of Tickets is punishable under Indian Railway Rules under Sec.142. \n \n7. RSPs are prohibited to print Reservation Application Forms with IRCTC Logo on top. \n \n8. Popularizing the organizations name as authorized Railway Agents is strictly prohibited. The \nRSPs are “IRCTC authorized E- Ticketing agents”. \n \n9. IRCTC’s logo should not be used in Visiting Cards, Letterheads, and Pamphlets or in any other \nforms unless approved by IRCTC. \n \n10. Session management by the B2B PSP should be taken care of. \n \n11. Booking of benami e- tickets is strictly prohibited (anybody doing so will be prosecuted). \n \n12. Blocking of accommodation by giving fictitious names in any train is strictly prohibited As \nper the Indian Railways Act -1989 blocking of accommodation is a criminal offence and is \npunishable. \n \n13. Modification/Alteration/Tampering the Electronic Reservation Slip (ERS) is strictly \nprohibited. Any such act will be considered as a criminal activity and is punishable u/s 420 \nof the Indian Penal code, if brought to the notice of IRCTC. \n \n14. Software tampering is strictly prohibited. An y activity restricted by IRCTC like \nunauthorized branding, Tatkal Robot Facility, saving booking form either at server or at \nclient machine or allowing Tatkal form to be opened before stipulated Tatkal time or during \nthe banned time period, use of technolo gy for gaining unfair advantage in Ticket booking, \nTechnical problems like making changes without proper testing, etc. \n \n15. Cancellation of the tickets without the knowledge and request of the customer is prohibited \nand penalty can be imposed/prompt action can be taken. \n \n16. Do not sell e -tickets booked through personal IDs for commercial purpose in any manner, \nwhatsoever.", + "extraction_method": "text" + }, + { + "document_id": "circulars__IRCTC – Rules & Regulations (For Agents).pdf", + "document_name": "IRCTC – Rules & Regulations (For Agents).pdf", + "document_path": "circulars/IRCTC – Rules & Regulations (For Agents).pdf", + "doc_category": "circular", + "rule_type": "agent_rules", + "priority": 2, + "authority": "IRCTC", + "description": "Rules and regulations applicable to IRCTC agents", + "is_static": false, + "effective_year": null, + "page_number": 6, + "text": "C. Penalty Provisions \n \n1. All fraudulent activities like Overcharging, booking tickets through personal user id’s, \ncreating multiple Personal us er id’s, Sharing of access credentials/RSP ID, \nBooking/cancellation of e -tickets in connivance with middle men/Third party, \nbesides other irregularities, will be dealt strictly. Punitive action will be taken for \nany misconduct/Irregularities/Non -compliance of the terms and conditions by \ninvoking clauses 4.9 read with 19 (Internet Café Agreement) and 20 (B2B Agreement). \n2. The penalties for Irregularities/Misconduct/Non-Compliance of PSPs/RSPs will be as \nunder: \n \nS.No Nature of Irregularities Penalty Provision \n(1) Major Irregularities \ni. Software Tampering : Any activity restricted by IRCTC \nlike Cases such as: \na) Sharing of Access credentials, White Labelling, \nunauthorized branding, Tatkal Robot Facility, saving \nbooking form either at server or at client machine or \nallowing Tatkal form to be opened before stipulated \nTatkal time or during the banned time period, use of \ntechnology for gaining unfair advantage in Ticket \nbooking, Technical problems like making cha nges \nwithout proper testing etc. \n \nMisuse of IRCTC Website/IRCTC Rail Connect Mobile \nApp: Any activity restricted by IRCTC like cases such as: \nb) Modify, copy, distribute, transmit, display, \nperform, reproduce, publish, license, create derivative \nwork forms, transfer or sell any information from IRCTC \nWebsite/ IRCTC Rail Connect Mobile App. Sale of Illegal \nScripting/ Automated Software Tools by PSP to its RSPs \nor any individuals for gaining advantage of booking \ntickets through IRCTC Platform using personal User \nIDs. \n \n \na) A penalty Rs.25 lakh + Taxes will \nbe imposed per case on PSP and \nthe services of PSP will be \nsuspended for three months. \nAnd \nCases involving cyber act \nviolations will be reported to \nCyber Crime Police as well as \nRPF (Railway Protection Force). \n \n \n \nb) A penalty Rs.10 lakh + Taxes will \nbe imposed per case on PSP and \nthe services of PSP will be \nsuspended for 3 month. \nAnd \nCases involving cyber act \nviolations will be reported to \nCyber Crime Police as well as \nRPF (Railway Protection Force). \nii. Un-authorised access – Cases such as : Sharing of \naccess credentials to web services, Sharing of RSP ID, \nEngagement with any other third party in any manner \nwhatsoever to sell e -tickets by any mode or manner \nincluding a e -commerce platform operating through a \nwebsite or Smartphone ap plication or tablet application, \nUnauthorized Sale/Transfer of Agency, etc. \nA penalty of Rs.20,000/ - + Taxes \nper case, of a complaint, will be \nimposed on PSP and the RSP ID of \nsuch outlet will be permanently \ndeactivated \nAnd \nCases involving cyber act violations \nwill be reported to Cyber Crime \nPolice as well as RPF \niii. Point of sale fraud – Cases such as : Overcharging, non -\npayment of refunds like TDR refund claims, non-refund of \ncancellation amount within the stipulated period, charging \nof cancellation charges, False TDR Claim. \n1. A penalty of Rs.20,000/ - + Taxes \nper case, of a complaint, and \n2. A penalty of double the amount of \nsuch overcharging/non -payment \n+ Taxes will be imposed on PSP.", + "extraction_method": "text" + }, + { + "document_id": "circulars__IRCTC – Rules & Regulations (For Agents).pdf", + "document_name": "IRCTC – Rules & Regulations (For Agents).pdf", + "document_path": "circulars/IRCTC – Rules & Regulations (For Agents).pdf", + "doc_category": "circular", + "rule_type": "agent_rules", + "priority": 2, + "authority": "IRCTC", + "description": "Rules and regulations applicable to IRCTC agents", + "is_static": false, + "effective_year": null, + "page_number": 7, + "text": "3. The RSP ID of such outlet will be \npermanently deactivated. \nAnd \n4. Case will also be referred to RPF \nif found indulged in touting \nactivity using personal ID. \niv. Non compliance of Booking/cancellation mandates – \nCases such as : Faking as a normal user and booking on \nwebsite using multiple personal user Ids for commercial \ngains, Manipulation of ERS, sale of I tickets/Counter tickets, \nBooking of benami tickets, Transfer or resale of tickets, \nblocking accommodation giving fictitious names, \ncancellation of ticket without the knowledge of customer, \nNon filin g of TDR on request of Customer, \nBooking/cancellation of tickets in connivance with \nmiddlemen/Third party. Booking request/collection of \npayment from Unauthorized web based platform. \nA penalty of Rs.20,000/ - + Taxes \nper case, of a complaint, will be \nimposed on PSP and the RSP ID of \nsuch outlet will be permanently \ndeactivated \nAnd \nCase will also be referred to RPF if \nfound indulged in touting activity \nusing personal ID \n(2) Minor Irregularities \ni. Cases such as: \na) Any RSP outlet, if found without proper display of sign \nboard indicating the IRCTC instructions viz Service \ncharges, Payment gateway charges, without \nregistration certificate being displayed; \nb) Non issuance of money receipt by RSP; \nc) RSP Address Mismatch; \nd) Any advertisement in print or press medi a without \nprior permission from IRCTC in writing; \ne) Misuse of IRCTC LOGO with out prior permission from \nIRCTC. \n \n1. In the first instance, a penalty of \nRs.5,000/- + Taxes per case, of a \ncomplaint, will be imposed on PSP \nwith a warning to RSP. \nAnd \n2. In the second instance, a penalty \nof Rs.5,000/- + Taxes per case, of a \ncomplaint, will be imposed on PSP \nand RSP ID will be permanently \ndeactivated. \n ii. Cases such as; \na) In the absence of written request/Electronic \nrequest of customer for booking/cancellation of e-\nticket. \nb) If correct Mobile No. of one of the passengers is not \nmentioned at the time of booking \nA penalty of Rs.5,000/- + Taxes per \ncase, of a complaint, will be imposed \non PSP. \n(3) Other provisions \ni If complaints are received and proved against 5 different \nRSPs of PSPs in 01 month \nA show cause notice will be issued to \nPSP. \nii If between 6 -10 complaints are received and proved \nagainst different RSPs of a PSPs in 01 month \nServices of PSP will be suspended for \n01 month. \niii If between 11 -15 complaints are received and proved \nagainst different RSPs of a PSP in 01 months \nServices of PSP will be suspended for \n03 months. If two such incidences are \nreported, the PSP will be permanently \ndeactivated. \n \niv If more than 20 complaints are received and proved \nagainst different RSPs of a PSP in 01 month \nServices of the PSP will be suspended \nfor 06 months. If two such incidences \nare reported, the PSPs will be \npermanently deactivated.", + "extraction_method": "text" + }, + { + "document_id": "circulars__IRCTC – Rules & Regulations (For Agents).pdf", + "document_name": "IRCTC – Rules & Regulations (For Agents).pdf", + "document_path": "circulars/IRCTC – Rules & Regulations (For Agents).pdf", + "doc_category": "circular", + "rule_type": "agent_rules", + "priority": 2, + "authority": "IRCTC", + "description": "Rules and regulations applicable to IRCTC agents", + "is_static": false, + "effective_year": null, + "page_number": 8, + "text": "However, i) the number of instances for imposing penalty will be co unted based on date of \noccurrence of incidence as against date of reporting. \nii)The complaints arising out of bookings made through PSPs IDs will only be counted for penal \naction against PSPs \niii) The complaints arising out of bookings made through Personal IDs will be taken up through RPF \nunder Railway Act for touting activity. Such complaints for tickets booked on personal ID will not \nbe counted for the purpose of suspending PSPs on the criteria of number of complaints \n \n \n(4) For irregularities committed by RSP, necessary action will be taken against respective \nPSP also in addition to whatever action (like deactivation of RSP as decided by \ncompetent authority) taken against RSP. However, in case of criminal activity of RSP, \nnecessary action will be taken by IRCTC through RPF against RSP. \n \n \n(5) Process of Complaint case: \ni. Once a complaint is received, explanation will be called from the PSP of the RSP who \nis involved in the complaint. \nii. Once the irregularity is established, a show cause notice is issued giving 5 d ays time \nto reply. 3 days time is awarded for payment of penalty. \niii. If penalty imposed is not received within the stipulated period the same will be \ndebited from RDS account of the PSP or if no RDS account is maintained, the services \nof PSP will be made offline till such time the amount is received from the PSP. \niv. The Competent Authority can however, take appropriate higher action against the \nerring PSP/ RSP, if deemed necessary including termination in the first or any \ninstance in accordance with the provisions of the Agreement. \nv. Any other complaint, other than those mentioned above, is received against RSP/PSP \nin violation of IRCTC/Indian Railways rules and regulations, action will be initiated as \nper the decision of the competent authority case by case. \n \n*****", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 1, + "text": "RAILWAY ESTABLISHMENT RULES\nChapter No:-1 INTRODUCTION\nThe Ministry of Railways (Railway Board) is functioning under Railway Minister as \nCabinet rank and he is associated with two Deputy Minister of Railway and Minister of \nStates of Railway.\nThe Railway Board is the Chief Administrative and Executive Body assisting the \nMinister of Railways.\nQue.:- When was the Railway Board formed and who are the main body?\n Ans.: The railway Board was formed on 18 / 02 /1905\nThe Main Body :-\n1. Chairman of Railway Board.\n2 Financial Commissioner Railways.\n3 Railway Board Members:\na) Traffic.\nb) Staff .\nc) Mechanical Engineering.\nd) Civil Engineering.\ne) Electrical Engineering.\n Que.:- What are the Attached offices of Railway Board?\n1. The Research Design and Standard Organization \n (RDSO).\n2. Office of the Railway Liaison Officer with Directorate General of Supplies and Disposal. \n3. Railway Recruitment Board.\n4. Railway Staff College, Varodara.\n5. Indian Railway Institute of Civil Engineering, Pune.\n6. The Institution of Railway Signal & Telecommunication Engineers, Secunderabad.\n7. Indian Railway Institute of Electrical Engineering, \n Nasik.\nThe Railway Recruitment Boards are located in\nMumbai, Kolkata ,Chennai, Allahabad, Muzaffarpur , Gauhati, Danapur,Bhopal and \nChandigarh.\nRDSO is located in Lucknow..\nQue.:- How many zones are working under Railway Board?\nAns: - There are 15 zones are working under Railway Board. The particular are as follows.\n Sr. No. Name of Zones HQ.\n1. Southern Railways Chennai\n2. Central Railway Mumbai.CSTM\n3. Western Railway Mumbai(Charchgate)\n4. Eastern Railway Kolkata", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 2, + "text": "5 Northern Railway New Delhi\n \n Sr. No. Name of Zones HQ.\n6 North Eastern Railway Gorakhpur\n7 North East Frontier Rly Maligaon (Gauhati)\n8 South Eastern Railway Kolkata\n9 South Central Railway Secunderabad\n10 North Central Railway Alahabad\n 11 North Western Railway Jaipur\n12 South Western Railway Bangalore\n13 West Central Railway Jabalpur\n14 East Central Railway Hajipur\n15 East Cost Railway Bhubaneshwar.\n \nIn order to discharge the Administrative function, each Zone up to Sr. no.9 is having a \nGeneral Manager. Two additional General Managers, Senior Dy. General Managers, Dy. \nGeneral Managers , Chief Public Relations Officer, Chief Planning Officer and Heads of \nDepartment for the following functions: \na) Operating -- Chief Operating Manager..\nb) Engineering -- Chief Engineer.\nc) Electrical—Chief Electrical Engineer.\nd) S & T—Chief Signal & Telecommunication Engineer.\ne) Mechanical—Chief Mechanical Engineer.\nf) Accounts—Financial Adviser and Chief Account Officer.\ng) Personnel-- Chief Personnel Officer.\nh) Stores --Controller of Stores.\ni) Medical --Chief Medical Officer.\nj) Security--Chief Security Commissioner. \nQue.:-What are the productive units and other organization working directly under \nrailway board?\nAns.—Production Units:\n1. Chittaranjan Locomotive works for manufacturing of Electric Locomotives. (CLW-\nKolkata)\n2. Diesel locomotive works, Varanasi, manufacturing\n Diesel locomotives. (DLW)\n3. Integral Coach Factory at Perambur (Chennai) for\n manufacturing of Coaches, Electric multiple Units and goods stock.\n4 Wheel and Axle Plant at Banglore for manufacturing\naxles.\n5. Diesel Component Works at Ptiala. (DCW)\n6. Rail Coach Factory at Kapurthala. (RCF)\n7. Railway Electrification, Allahabad. (CORE)\n Other Organization: \n1. Metro Railway at Calcutta.\n2. Metropolitan Transport Projects, Mumbai Mass Rapid Transport System (MRTS) \nDelhi, Madras\n3 Indian Railway Construction Company (IRCOM)\n 2\n2", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 3, + "text": "4. Rail India Technical and Economic Services.\n Commissioner of Railway Safety:\n It is an independent organization known as ‘Commissioner of Railway Safety’ \nfunctioning under the control of Ministry of Tourism and Civil Aviation.\nCommissioners of Railway Safety.\n1 CCRS- Lucknow.\n2 CRS - Central Circle Mumbai.\n3 CRS- Western Circle Mumbai.\n4.CRS - Eastern Circle Kolkata.\n5 CRS - Northen Circle ,Delhi.\n6 CRS - Southern Circle,Banglore.\n Duties of Commissioner of Railway Safety:\n1. Inspection of New Railway lines.\n2. Periodical inspection of Open Lines\n3. Approval of New Work for commissioning.\n4. Investigation into accidents.\n5. General Advice on matters connects train operation.\nChapter 2. LEAVE RULES\nQue. What are the types of leave rules.\nAns:- 1.Company Leave Rules. 2.Fundamental Leave Rules. 3.State Railway Leave \nRule 4.Liberalised leave Rules,1949 Or Central Pay Commission Leave Rules.\n Presently Liberalized leave Rules are only applicable. \n Leave cannot be clamed as of right and leave of any kind may be refused or revoked \nby the authority component to grant it.\nQue.6 What are the kinds of leave?\nAns. Kinds of Leaves.\n1. Leave on average pay .\n2. Leave on half average pay.\n3. Commuted Leave.\n4. Leave not due.\n5. Extraordinary Leaves.\n6. Maternity Leave.\n7. Paternity Leave\n8. Study Leave.\n9 Hospital Leave\n10 Special Disability Leave\n11. Leave Preparatory to Retirement.\n12. Leave Enacashment.\n13. Casual Leave\n14. Spl.Casual Leave\n15. Compensatory Casual Leave\n 16.Leave to Special Class Apprentices.\n17. Leave to Apprentice Mechanics.\n18. Leave to Trade Apprentices.\n 3\n3", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 4, + "text": "19. Leave to Other Apprentice.\n20. Extraordinary Leave to Apprentices.\n21. Leave to Workshop Staff.\n22 Leave to Running Staff.\n1) Average Leave.\nNo any Railway servant shall be granted leave of any kind for a continuous period of \nfive years. Minimum leave of 180 days can be granted at a time at a time. Total number of \naverage leave per year is 30 days Teaching staff of Railway School shall not be entitled for \naverage leave. Maximum number of 300 days leave can be accumulated.\n2)Leave on Half Average Pay . \n A Railway servant can availed 20 days leave per year on Half-Average pay, that to be \nproducing medical certificate.\n3) Leave without pay (leave not due).\n4) Extra Ordinary Leave.\n5) Maternity leave: A female servant including Apprentices with less than two serving \nchildren may be granted maternity leave for 135 days. This leave is eligible for those who are \nmis-carriage including abortion.\n6) Paternity Leave: This leave is granted to Rly.servant including Apprentice with less than \ntwo serving children for 15 days during the confinement of his wife (or) before 135 days \nfrom the date of delivery.\n [RBI's No. E((P & A ) 1 / 97 /CPC /LE-6-dt. 8. 4. 99.]\n7) Casual leave: Casual Leave is admissible to Rly. Staff in all groups. The C/Leave is \ngranted to enable them to attend to sudden unforeseen needs / requirements. It is not treated \nas absent from duty and his pay is not terminated. If a Rly. Servant joined in Rly. in the \nmiddle of the year, he entitled to the full quantum of casual leave. There is no restriction to \nsanction full quantum of casual leave to those joining services in the second half of the year.\n e.g. Example. If the Rly. Servant joined in Rly. service in the month of December, he \nwill be entitled to take full of quantum of C / L \n [RB’s L.No. E(G) 56 LE 2 /91/3 of dt.5.10.56 ] \n Casual leave, which was not availed in the calendar year , will lapse.\n 8) Extraordinary Leave: The Extraordinary Leave may be granted in to different occasions. \n(a)When no other leave is admissible.\n(b)When other leave is admissible. The Rly. Servant should give in writing for the \ngranting of Extra ordinary leave. This leave is permissible only for Permanent staff. Extra \nordinary leave on any one occasion in excess of the following limits.\n3month without certificate. Staff who had completed 3 years of service can avail 6 \nmonths, which will be recommended by Med. certificate.\n18-month leave who had completed one-year service for the following reasons.\nTB on any part of the body by a qualified TB specialist.\nLeprosy in a recognized leprosy institute recognized by state administrative medical \nofficer concerned.\nCancer or mental illness in an institute.\n9) Maternity Leave: -A female Rly. Servant those who are having less than two serving \nchildren can be granted maternity leave of 135 days w.e.f. 7.10.97. This also applicable to \nApprentice Rly. servant also.\n [RB’s L.No. E((P & A ) 1 / 94 /CPC /LE-6-dt.10.11.97].\n 4\n4", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 5, + "text": "Maternity Leave also granted to female servant for the case of miscarriage includes \nabortion, only after producing Medical Certificate from Medical Officer. The total leave to \nbe granted should not excess 45 days.\n [RB’s L.No. E(P&A ) 1 / 94 /CPC /LE-6-dt.12.9.94].\nMoreover Maternity leave also can be combined with leave of any kind. The above said \nmaternity leave can not be debited against the leave account. Maternity leave also be granted \nto female Rly. servant of temporary status. [R.B.’s L.No. E((P & A ) 1 / 90 /CPC /LE-\n9-dt.25.6.91] Female Rly. Servant (even unmarried) also is granted maternity leave. \nFemale Rly. Servant who had married a widower, such widower had children of former wife \nwho was expired is also eligible for maternity leave who is having two serving children. First \nwife’s children of the widower can not be taken into account for the female servant who had \nmarried a widower.\n [RB’s L.No. E((P & A ) 1 / 98 /CPC /LEL-dt.5.10.99.]\n10) Hospital Leave : hospital leave can granted to Group C and D staff while under \ntreatment for illness of injuries if such illness or injury is directly due to risk incurred in the \ntime of official duties. This leave may be granted after submission of Medical Certificate \nfrom an authorized Medical authority. He may be granted leave not more than 120 days of \naverage pay and the remaining pirod may be given on half pay salary. Divisional \nRly.Managers are empowered to relax provision in individual cases meriting sanction of \nhospital leave beyond 120 days. General Manager is empowered to grant hospital leave \n(unlimited ) to any no of days.\nInjured Rly. Servant injured on duty during 1985-93 where hospital leave was not \ngranted beyond 120 days on full pay may be reviewed by the Administration and accordingly \nHospital leave may be regularized by General Manager. The Hospital full average pay during \nthe period 1985-93(old Cases) may be regularized after getting personnel sanction of the \nG.M. with concurrence of the FA & CAO be debited against leave account. Hospital leave \nwhich may granted by GM is unlimited and cannot be debited against leave account. \nHospital leave may be granted to the Rly. Servant who remains absents from duty for \nAmputation and Replacement of Artificial limbs or for obtaining spare limb.\nAny Rly.servent who the Workman Compensation Act applies, the amount of leave \nsalary payable during hospital leave shall be reduce by the amount of compensation payable \nunder Sec.4 (1) (d). Compensation payable under cause (b) or (c) of Sec. 4(1), then hospital \nleaves salary to paid in full amount.\n11) Special Disability Leave: The competent authority has to grant special disability leave to \nRly. Servant whether temporary or permanent who is disabled by injury on duty. The period \nof such special leave should be certified by the Authorized Medical Attendents, and this leave \nshould not be beyond 24 month in respect of one disability and this period will be counted as \nDuty. This leave can be combine with any leave. Leave salary during such leave shall for the \n120 days of any kind, be equal to leave salary while on leave on average pay and and for the \nremaining period of any such leave, be equal to leave salary during Half Pay leave , provided \nthe Rly. servant may at his option, may be allowed leave salary as for the period exceeding \n120 days and without even the period of such leave shall be debited to his Half Pay Leave \naccount. This provision be applied to Temporary servant also -who was injured on duty or \nbecomes illness during the performance of Duty.\n12) Leave Preparatory to Retirement: When a Railway servant is not interested of \nencashment of leave on average pay at his account at the time of Retirement can be \npermitted by the competent Authority to take leave preparatory to retirement to the extent of \nAverage which should not exceed of 240 days together with Half Pay leave and this leave \nshould be up to the date of Retirement including to the date of retirement .\n 5\n5", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 6, + "text": "13) Leave Encashment: An Encashment of leave Is one of the retirement benefits granted \nby the Government to their retiring employees. Under these scheme the benefit of \nencashment of unutilized leave on average pay, at the credit of employee at the time of \nretirement, shall be admissible subject to a maximum limit of 300 days w.e.f. 1.7.97 in \nrespect of following categories. \na) Retirement on attaining the age of superannuation b) cases where the service of a \nRly. servant has been extended, in the interest of public service beyond the date of \nretirement on superannuation. \nc) At the time of Voluntary / Pre- Retirement or \n declared unfit.\nd) When a servant is terminated by Notice.\ne) In case of termination of re-employment after \n retirement..\nf) In the case of death of Rly. Servant in \n service, to the family of the deceased;\ng) In the case of leave preparatory to \n retirement \nh) In the case of transfer of Rly. Servant to an \n industrial establishment; and on absorption of \n a Rly. Servant in the Central Public Sector \n Undertakings.\nRly. Servant who resign or quit service also be entitled to cash equivalent in respect of \nleave on average pay on the date of cessation of service to the extent of half of such leave at \nhis credit, subject to a maximum of 150 days.\n [R.B's No.F (E) III/97/LE 1/8 of 10-11-97]\n Encashment of ceiling on encashment of LAP from 240 days to 300 days --\nClarification regarding calculation of LAP for encashment on termination of re-employment:\nWith effect from 1.1.97 the encashment of LAP in respect of re-employment person on \ntermination of there re-employment on or after 1-7-97 may be regulated as under :\n(1) Where Rly. Servant has availed of encashment for 240 days at the time of \nretirement, the cash equivalent in respect of leave on average pay (LAP) at his \ncredit on the date of termination office re-employment shall be limited to the \nquantum of LAP earned by him from 1.7.97\n(2) Where a Rly. Servant has not availed of encashment for 240 days at the time of \nretirement the cash equivalent in respect of leave on average pay (LAP) at his \ncredit on the date of termination of his re-employment shall be limited to the \nquantum of LAP earned by him from 1.7.97. onwards plus unavailed portion of the \nLAP ( i.e. difference between 240 days and leave on average pay for which \nencashment has already been availed of).\nIn both above cases, the total quantum of leave on average pay already encashed at the \ntime of retirement and allowed to be encashed as above shall not exceed 300 days.\n[No.F(E)III/97/LE1/8 dated 30.10.98.]\n Encashment Leave on half average pay (LHAP) on Superannuation . \n W.e.f. 14 .7 .1982 the entire Leave on half average pay at the credit of Rly. Servant \nwho retire on superannuation shall be allowed to be encashed subject to the condition that the \npension and pension equivalent of the other retirement benefits shall be deducted from the \namount payable as cash equivalent, as provided in Rule 550-B(i) of R..I. The encashment will \nbe subject to the following conditions:\n(a) The benefit will be admissible in respect of past cases on receipt of applications to that \neffect from the pensioner concerned by the office.\n(b) In respect of future retiree the amount of encashment of leave on Half-Average Pay \n(HAP) will be calculated and paid together with Encashment of LAP.\n 6\n6", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 7, + "text": "(c) Calculation of cash equivalent in respect of LHAP at the credit shall be made mutatis \nmutandis I in the manner given in Board's letter No. [ F(E)III / 82 / LE1 /2 dated11-\n2-1983].which is a under:- \n(d) The amount so calculated shall be paid as one-time settlement.\n[R.B's No..F(E)III/90/LE1/1 of dt. 20-05-1993 ]\nNote: 1. There is no limit to the total number of LHAP that can be encashed on \nsuperannuation.\n 2. If the Rly. Servant already availed of LAP encashment up to 240 days for which DA \nwould have been taken into account, he will not be entitled to DA on encashment of LHAP.\n [ R.B' No .F(E) III - 90 /LE/1 of 21.10.93.]\n14) Special Leave:- Spl. Leave is granted to the Rly. Servant to cover there absence \nfrom duties on the following occasion :-\n To attend work connected with running or administration of Railwaymen's Societies.\n Under Family Welfare Program.\n For participating sports.\n Trade Union/Federation.\n For Cultural activities like Drama and Musical\n competition.\n Scout work.\n Voluntary blood donation.\n \nChapter 3. ALLOWANCES\n1) Dearness Allowances.\n2) Compensatory City Allowance.\n3) House Rent Allowance.\n4) Travelling Allowance.:- Travelling allowance is granted on the % of absence \nfrom H.Q. \na) If absence does not exceed 6 hrs =30%\nb) If absence from HQ 6-12 Hrs. =70%\nc) If absence is above 12 Hrs. = 100%\n5) Running Allowances: Running allowances are granted normally to non-\ngazetted employees for performance of duties directly connected with the charge \nof moving trains.\nLoco staff (Diesel /Electric ) Traffic.\na) Drivers including Motorman a) Guards\n 7\n7\nCash \npayment in \nlieu of half \npay leave \ncomponent.\n Half Pay leaves salary plus DA if \nadmissible minus pension, pension \nequivalent of gratuity and relief on \npension if DA admissible on half pay \nleave\nNumber of \ndays of half \npay leave due \non the date of \nretirement on \nsuperannu-\nation30", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 8, + "text": "and Rail motor drivers. b) Asst. Guard\nb)Shunters. Brakeman.\nc) Fireman, Electric Assistant.\n Diesel Assistant.\n6) Break Down Allowance : Rly. Staff deputed for Break down duties are \nentitled :-\nUnskilled worker ) 2550 - 3200 Rs.40 PM\nKhalasi ,Helper ) 2650 - 4000 Rs.40 PM\nOther D group ) 2610 - 3540\n ) 2650 - 4000 Rs.40 PM\nStaff in scales and ) 2750 - 4400\nSkilled Staff ) 3050 - 4590 Rs.60/-PM\nTechnicians ) 4000 – 6000 Rs.80/-PM.\nSr.Technitians ) 4500 - 7000\nSupervisor ) 4500 - 7000 Rs.100/-PM.\nJr.Engr. and )\nStaff in higher scales ) Rs.100/- PM.\n7) Night Patrolling Allowances.:-Night Patrolling allowances will be admissible only \nto the gangman (permanent ) or casual labor with temporary status at the rate of Rs.1.50 per \nnight w.e.f. 1.1.90 .\n [R.B's No.E(P&A) 1/89/FE-4/1 of 25.4.1990.]\n 8) Non practicing Allowances: Railway Doctors is not supported to do private \npracticing . To compensate this Non practinging allowances, in Rly. is granting. Non \npracticing allowances is uniformly 25% of Basic Pay.\n \n 9) Normal Holiday Allowance: \n 10) Night Duty Allowance:\n 11) Washing Allowance: Washing Allowance is eligible for those who are provided \nwith uniform (Group D Staff)(Rs. 15 P.M.)\n [(R.B's No.P(E)/ 1/82/AL/29-1- of 31.3.1986.]\nRPF are also eligible (Rs.10 /- per month )\nSafaiwallas are also eligible for washing allowance.\n12) Nursing Allowances : Rs.150/- 300 /- P.M. ) \nUniform Allowances Rs.1500 /- to 3000/- 1 year. ) 1.8.97.\nWashing allowances Rs.75 /- 150/- P.M. )\n Nursing allowances Rs.1600/- from 15.7.98.\n [R.B's No.E(P&A) -1-98/AL/-1 of dt.17.9.98.]\n It is also eligible -Public Health Nurses, Public Lady Health Visitors, Field Female workers.\n13) Handicapped Allowance:- 5% or Rs.100 Behind \n1)Blind Person \n2)Orthopaedically handicapped person if 40% or 50% permanent partial disability of \neither upper or lower limbs or both upper limbs .\n [R.B's No.PC-IV/86/IMP. AL/23 of 8.5.1987.]\nScheduled Tribes Area\n1) PC - IV / 86 / IMP / AL /22 - 09 - 10 - 86.\n2) PC - IV / 87 / IMP / AL /22 - 30 - 7 - 87 .\n3) PC - IV / 88 / IMP / AL /22 - 26 - 2 - 86 .\n 8\n8", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 9, + "text": "4) PC - IV / 88 / IMP / AL /22 - 10 - 8 - 88 .\n5) PC - IV / 90 / IMP / AL /22 - 23 - 11 - 90 .\n6) F(E) 1 / 89 / AL /4 / 2 - 03 - 7 - 89 .\n7) F(E) 1 / 98 / AL /4 / 2 - 17 - 4 - 98 .\nSanction Amt.\nBellow 3000 - Rs.40/-PM\n3000 - 4499 - Rs 80/-\n4500 - 5999 - Rs. 120 /-\n6000 - 8999 - Rs. 160 /-\n9000 - above - Rs. 200 /-\n 14)Teaching Allowances 30 % of Basic pay.\n ESM (S & T) are eligible for O. T.\n [R.B's No.E(LL) 97/HER/23 DT. 1 . 4 . 98 ]\n 15) Ghat Allowance: Ghat Allowance is granted to only running staff.\n Rs. 585 /- PM w.e.f. 1.4.98-30.9.98.\n Rs. 612/- PM w.e.f. 1 .10 .98.\n 16) Ration money Allowance : Up to the grade of Inspector ( Rs.6500 -10500) are \nentitled to Ration Money Allowance at the rate of Rs.612 -PM w.e.f.1.10 .98. \nExtra duty allowance more than 9 hrs Rs.7.50 per day + 120/- PM (Ration Subsidy) \n [R.B's No.E(P&A) 1.99/ALL/RPF/89/1 of 31.5.99.]\nExemption of fully income tax for ration money\nallowances.\n[R.B's No.E(P&A) 1/98/ALL/RPF/1.4.98FE-4/1 of\nQue.:- What is the Interest Bearing Advance for purchase of\n1) Conveyances, Cycle, two wheeler and Cars.\n2) Construction/Purchase of House / flat.\n3) Purchase of Personal computer.\n4) Purchase of Table fans.\n5) Purchase of Warm clothing.\nQue.:-What are the non-interest advances.\n1) Advance on pay on transfer.\n2) Advance of TA on tour/ transfer retirement.\n3) Advance of deportation abroad / Returning India.\n4) Advance of Leave salary.\n5) Advance in the event of Natures calamity; flood/drought.\n6) Advance of Law suits.\n7) Advance for treatment of Cancer.\n8) Festival Advance.\n9) Advance for purchase of outfit for children.\n10) Advance from PF(Temp. and final).\n1.Advance for purchase of cycle :-\nAdvance payable to the employees whose basic pay does not Exceed Rs.5000/- and \nthe amount to be sanctioned is Rs.1500/- and this should be repaid in 30 installments .For \nprinciples amount and after completion of principle Amount the interest 9% as on 1.4.93 and \nthe total interest be recovered in or two installments.\n 9\n9", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 10, + "text": "2.Purchase of Motorcycle (Scooter / Moped):- \nThis advance is eligible for these employees drawing Basic Pay Rs.4500/- or above. \nAmount Rs.30000/- be sanctioned and this should be deducted in 70 installments. Also \nemployees can be granted 2nd Advance Rs.24000/- for Purchase of motor cycle. Employees \nshould provide Registration certificate. \nInterest rate is 11.5% as on 1.4.93.\n[RB's F(E)III Spl. 97/Adv. 2/2 of 26.12.97.]\n \n3.Purchase of Motor Car :- Employees who are drawing basic pay or Rs.10500/- \nand above are eligible. For getting motor car advance of Rs.1,80,000/-which will be \nrepayable in Two hundred month equal installments. The amount of Rs.1,60,000/- be granted \nto the employees who wish to purchase for second time.\n 4.Advance for Treatment of Cancer: This advance is only payable to the staff \nwhere the employee or his family member admitted in Recognized hospitals for \nCancer. Amount is Rs.1000/-\n 5.Festival Advance :Non gazetted employees whose basic pay not exceeding \nRs.8300/- may be granted F.A. Rs.1500/- that will be Repayable in TEN installments. \nTemporary employees are also eligible for Festival Advance.\n 6.Advance for purchase of Outfit for school going Children: - All non-gazetted \nemployees are eligible for granting advance of one-month salary that will be recovered in 10 \ninstallments. For the purchase of outfit for children attending schools, the Schools approved \nby the General Manager at the beginning of each day.\n7.Withdrawal from Provident Fund.:-\n Temporary: - Temporary or final withdrawal.\n1) For Medical Ground. -\nStaff, Family members 3 months pay or 50% of (DEPENDENT) \ntotal amount in 24 \n Installment.\n2) Marriage purpose:-\n Self, children and 90% of the amount \n Dependent permissible relative \n if the amount is less \n than Rs.10000/- \n otherwise 6 months \n pay recovered in 60 \n installments.\n 3) Education :\nFor children and Rs1000/-in 24 \nDependent installments\nGazette staff Rs500/-\n Non-Gazette.\n 8.Purchase of Personal Computers:- Rly. Servants whose basic pay is Rs.10500/- \nor above be granted computer advance of Rs. 80,000/- which will be repayable in 150 \ninstallments. For purchase of computer in 2nd time is Rs.75000/- \n9.Purchase of Table Fans :-For class 'D' staff are eligible to get table fans advance of \nRs.1000/- which is repayable in TEN installments. \n10.Purchase of Warm Clothing:-The employees groups C and D posted in Hill \nstations are eligible for this advance of Rs.1500/- repayable in 12 installments.\n 11.House Building Advance:- (Construction or purchasing of New home/flat ).\nThe advance for purchase of plot also be granted.\n 10\n10", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 11, + "text": "Also for enlarging living accommodation in an existing House owned by an employee \nis also granted. The amount payable to the employee is 50 time of Basic pay. Also cost ceiling \nfor the House Building advance is as follows :-\n Upto Rs.2700/- (basic pay) 2.5 lakhs.\n Rs.4500/- 4 --\"---\n Rs.4500/- add above 5 --\"---\nRepaying Capacity of Employee.\n Length of service balance % of repay capacity.\n 20 yrs. 35% of B/Pay.\n10 yrs. - 20 yrs. 40% ---\"---\nWithin 10 yrs. 50% ---\"---.\nRate of Interest :-\nUpto 50000 - 7.5 % \nUpto 1.50000 - 9 % \nUpto 5 lakhs - 11 %\nUpto 75 lakhs - 12% \nNo. of installments of of principles amount = 180 Instal. No of installments of \ninterest = 60 Instal.\n[RB No .F(E)F(E)SPL.97.ADV.3/6 - 29.12.97]\nNon Interest bearing advance\n1) Advance pay on Transfer :-\n When an employee got transferred from one station to another in the interest of \nadministration, which will not be on MUTUAL TRANSFER or transfer on OWN Request \nmay be granted one month salary advance which should be repayable in THREE monthly \ninstallments.\n2) Advance TA on Tour :- When Rly.employee is advised by administration to attend \ntour in the interior, they are eligible to claim TA advance which will not be exceeding \n30 days for expenses occurred during tour.\n3) Advance on proceeding on deportation/ Returned to India :- When A Rly. \nemployees are advised to proceed on deportation to out of India for a period less than \none month, may be granted one month salary in advance that will be repayable in \nThree monthly installments. \n4) Advance of leave salary: When a Rly. Servant going on leave up to one month (not \nexceeding one month) may be granted one month advance salary after deduction of \nnormal deduction such as P.F., HRA, I/Tax and recovery of advances.\n5) Advance in the event of Natural Calamity: -Floods, draughts, etc. This advance is \npayable to non-gazetted Rly. Employees, whose property (movable or immovable) \nhad been damaged due to natural calamity, may be granted one-month pay, which will \nbe repaid in three installments.\nTemporary Withdrawal: - Temporary withdrawal can be obtained for the following \npurposes.\n1)For passage (2) House Building (3) For opening a BookStall for unemployed \ngraduate son. \n 11\n11", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 12, + "text": "Final Withdrawal: -The final withdrawal can be permitted who has completed 15 \nyears of service and can be granted for the following purposes: -\n1. Medical ground (15 years of service)\n2. Marriage purpose.\n3. Education purpose.(Once in 6month in a year)\n4. For purchasing of consumer item.\n5. House Building.\n6. Funeral purpose.\n7. Booking of motor car.(Basic pay Rs.10500/- and above or motor cycle).\n8. For repair to car.\nA new advance shall not be granted until atleast 50 % of the last advance is repaid.\nPay Scale of Artisan Staff has been revised as under: As per R.B's No.PC-\nV/97/R.II/17 of 24.11.98.The Revised 6scale of artisan staff are as under.\nSr.N\no\nCategory Existing Pay Scale Revised\n1 Skilled Artasian \nIII\n3050 – 4590 3050 - \n4590\n2 Skilled Artisan - \nII\n4000 – 6000 4000 - \n6000\n3 Skilled Artisan - \nI\n4500 - \n7000\n4 Mistry 4500 – 7000 4500 - \n7000\n+ 100/-\n5 MCM(Master - \nCraftsman)\n4500 – 7000 5000 - \n8000\nMCM comes under artisan category.\nChapter 4. HOURS OF EMPLOYMENT REGULATION ACT\nThe hours of employment regulation act implemented in the year of 1956.\nThese rules are not applicable to those who are governed by other act such as Factory \nAct, Mines Act and Merchant Shipping Act i.e. those employed in workshops or on the \nferries.\nBased on Geneva & Washington Conventions sponsored by International Labour \nOrganization, amended, the Indian Rlys. Act.1890 in the year 1930 in order to regulate the \nHours of Employment, period of rest and payment of overtime to various categories of Rly. \nServants. The employees were not satisfied with the Act of 1930 and agitated and as a result \nJustice Rajadhayaksha amended the Act in 1956. This effects are known as HOER.\nAs per HOER Rly. servants are classified as :-\n 12\n12", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 13, + "text": "1) Intensive category.\n2) Continuous category.\n3) Essentially Intermittent and\n4) Excluded category.\nIntensive Category :- Section controller, Signalers, \nTelephone & Wireless Operators, Librarians.\nEssentially Intermittent:- Waiting Room Bearers, Gatemen Safaiwala\nExcluded Category :-Caretakers, of Rest houses, stenos, \n Matrons, Sisters, IO, Asst. Surgeons, Mid wife and supervisory staff. \n Continuous :-Clerical staff, staff of Locos, Drivers & Guards, TTE .\n If Rest is suspended temporarily it can be granted within 15 days in intensive category \n,other are within one month. \nFACTORYES ACT -1948\nThis factories Act comes into effect in the year 1949.(1.4.1949). The worker in the \nfactory are regulates by this Act.It regulates the various obligations that an 'occupier' has to \nfulfill in regard to health, safety, medical care and welfare of his workers working in a \nfactory. It also regulate the hours of week, minimum period of rest and leave, and make \nprovision of extra wages in case of there employment beyond the prescribed duty hours with \nHealth, Welfare, Safety, Hours of Employment Leave and Overtime.\nFactory:- It is a place where more than working through out the year the factory should be \nregistered with State Govt. and Licensee obtained .\nOccupier:- It means the person who controls over the affairs of factory and in Rly. occupier is \nappointed by Ministry of Rlys.\nWorker :- The person employed in a factory.\nManufacturing Operation/Process - For making, repairing,packing, oiling, washing and \ncleaning.\nInspection :- It will be done by factory inspector appointed by the State Govt.\nHealth : Employer should ensure cleanliness, standard of ventilation, reasonable temp., \nsufficient light and water.\nSafety :- Management, must ensure safety devices, safe working of lifts, hoists , cranes and \nfencing of machinery.\nHouse of work :- No woman will work between 7 PM to 6 A.M. in a factory. 48 hours in a \nweek as well as 9 hours per day be maintained.\nRest Day :- If a worker works continuously for 6 days, he is eligible for one day Rest. If the \nrest was not given on 7th day, the rest can be granted on 11th Day. Rest of employees who \ncomes under Factory Act can be given in three day advance or three days after proper rest. \nNormally the rest will be on Sundays. No woman worker should work let. 7PM to 6 A.M. \nChildren below 15 years is not permitted to work in factory or workshop.\nChapter 6. PASS RULES\nQue:-What are the kinds of passes issuing to Rly. Employees ?\n 13\n13", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 14, + "text": "a) Duty pass.\nb) Privilege pass\nc) School pass \nd) Post Retirement Pass \ne) Residential Card pass \nf) Special pass.\nSchool Passes:\nSchool passes are to be issued to the dependant of Railway employees (each student) \non producing of a Bonafide certificate from the Recognised Institution where the student is \nstudying away from the Head Quarters of the Railway Servant.\n The Dependant of the Railway Employees who are in receipt of stipend or merit \nscholarships will not be admissible for school passes, if they are above 21 years.\n[ RBS No, E(W)85 PS-5-1/8-11-9-1985] \nPasses are issued to students between the place where the parent is residing to \nschool/college and back \nduring when recognised vacations, provided the vacation period is not less than 3 consecutive \ndays and also during the closer of the institutions due to unforeseen circumstances.\nThree full sets or 6 half sets of passes are eligible in a Calendar year. The passes \nissued should be debited under the heading \"On School Account\". A parent or guarding may \nbe included in school pass in which a girl student of any age or a boy under the age of 15 \nyears, but not above 18 years age. For return journey for parents or guardian or paid Nurse to \nthe station from which journey is commenced, a separate pass may be issued in the class, \nwhich is eligible. If guardian be an attendant only II pass to be issued.\n Class of Privilege Pass :-\n1) Group A & B gazetted - 1st class A.\n2) Non gazetted group B & C\na) For those Rly. servant appointed before 1.8.1969.\nDrawing pay Rs.5000/- or above. provided the employees in a scale of which is \nMaximum Rs.6000/- or above.\nb) For those appointed during 1.8.1969 to 31.3.1987\nThose who are drawing basic pay of Rs.5375/- or above, provided they will be having \nMax. scale of Rs.7000/- or above.\nc) For those appointed during 1.4.1987 to 1.2.1999\nThose who are drawing basic pay of Rs.7250/- or above, provided their minimum pay \nshould be Rs.6500/-\nd) For those appointed after 1.2.1999.\n For those who are having minimum basic of Rs.6500/- and above and also servants who \nare drawing basic pay Rs.7600/- & above.\n Post Retirement Privilege Pass :-\n1) For Gazetted Staff :- Group A & B.\nBetween 20-to 25 Years -2 sets of passes per years.\nMore than 25 years -3 sets per year.\n 14\n14", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 15, + "text": "2) For Group C :-\n Less than 20-yr. service -1 set of pass.\nMore than 25 yr. service - 2 set of pass\nFor self-wife and children only.\n3) For class IV (Group D ) :-\n Not less than 25 yr. service -1 set per year.\nComplimentary passes-\n This pass would be issued to the widow of Rly. servant who was / is in service on or \nafter 12.3.1987 are eligible and also eligible complimentary pass. Only one pass for every \ntwo years.\nQue.:- What are the special passes ?\na) On Medical ground.\nb) On sports account.\nc) For scouting activities.\nd) For attending courts.\ne) Physical handicapped persons.\nf) Staff of Rly Co-op. Societies /banks.\ng) Pass to attend S.B.F. Meetings.\nh) Passes to Rly Staff under suspension.\nPasses to handicapped servants.\n1) If suppose one blind Rly. Servant travels alone, one attendant in the same class should \nbe allowed.\n2) Wheel chair and tricycles be allowed on privilege pass.\nPhysically handicapped servants are eligible for first class pass for the following \nconditions with one escorts that should be recommended by DMO\n1) Not having one or two hand.\n2) Not having one leg above or below the knee levels.\n3) Not having both the legs and using artificial legs.\n4) Lost function of legs and has to walk with support of hands \n [R.B's No.E(w)/82 -PS5-1 of 5.9.83.]\nPhysically handicapped Rly. Servant after getting recommendation of Head of the \nOrthopedics Dept. of Rly or Govt. hospitals to those orthopedically handicapped person if \n40% or 50% permanent partial disability of either upper or lower limbs or upper or both \nlower limbs together will get Rs100/- Allow./ Ex.. or 5% of the basic pay . Also above said \nstaff are eligible for FRC.\n[R.B's L.No.PC -IV /86/IMP/AL/23 of 8.5.87.]\nPasses to Staff of Rly. Co-operative Societies bank and SBF.\nUp to two years - NIL.\nUpto 20 years - One set.\nMore than 20 years - Two sets. \n 15\n15", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 16, + "text": "Passes of Rly Saff (Under Suspension):- Passes are eligible to Rly. staff who are \nunder suspension. Licensed porters working in Rly. station may be granted one \ncomplimentary cheque pass for self-only.\nChapter7. DISCIPLINE AND APPEALRULES-1968\n The Discipline and appeal Rule Which are called \"Railway Servants (Discipline And \nAppeal ) Rules , 1968 \" apply to all Railway servants except casual labour , member's of All \nIndia Service and members of Railway Protection Force.\n1.Appointing Authority :-\nThe authority empowered to make appointed to the service of which the Railway \nservant is :\n2.Disciplinary Authority :-\nThe competent authority to impose penalty as per the schedule in normal course and \nin case of imposing major penalties, such authority would be the Appointing Authority.\n3.Suspension\nSuspension is not a penalty. It means suspension of official activities. During \nsuspension period Rly. servant can be avail privilege pass also.\n4.Competent authority to suspend :-\n 1) A senior supervisor incharge in the Gr.Rs.1400-2300 (RS) and above (Rs.5000-\n8000) can suspend group D & C servant, provided he should intimate assistant officer or \nDivisional Officer within 24 hours in the case of group C staff. Moreover if the employees \npay is above Rs.1540/- Sr. Supervisor in the Gr. Rs.5000-8000 cannot suspend the Rly. \nservant.\n2) Assistant officer (Junior Scale and Group B) may suspend group C& D to those \npay drawing RS.1800/- and below.\n3) A Sr. scale officer and Asstt. Officer can suspend any Group D & C staff in the \ngrade Rs.1600-2660..\n4) Asset. Officer and above can suspend any group C & D staff. \nQue:-What are the types of penalties ?\nMinor Penalties:\n1) Censure;\n2) With holding of promotion for specified period.\n3) Recovery from his pay ,any loss caused by him to \n the Rly.\na) Withholding of privilege passes or PTOs. or both.\nb) Reduction to a lower stage for a period not \nexceeding 3-years without cumulative effect and not affecting pension.\n4) Withholding of promotion for specified period , with further direction as to whether or \nthe expiry of such period this will or will not have effect the postponing the future \nincrements of his pay.\nMajor Penalties:-\n5) Reduction to the lower stage in the time scale of pay for the specified period ,with \nfurther direction as whether on the expiry of such period, the reduction will or will not \nhave the effect of postponing the future promotion.\n 16\n16", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 17, + "text": "6) Reduction to the lower time-scale of pay, grade post or service with or without further \ndirection regarding condition of restoration to the grade or post or service from which \nthe Rly. Servant was reduced and his seniority and pay on such restoration to the grade, \npost or service.\n7) Compulsory Retirement.\n8) Removal from service which is not be a disqualification for future employment .\n9) Dismissal from service which is disqualification for future service.\n Authority to institute proceedings:-\na) For imposing a Minor penalty (1) to (4) of rule 6 an authority competent, under \nscheduled of Disciplinary powers, can imposed any of the penalties.\nb) For imposition of Major penalty (5 ) to (9) of rule 6 an authority competent, under \nscheduled of Disciplinary powers, can institute Disciplinary proceeding against Rly. Staff.\n \nPROCEDURE OF IMPOSING PENALTIES :\n1) No order of imposing penalties in clauses V to IX of Rule 6 should be made without an \nINQUIRY.\n2) The Disciplinary Authority should chargesheet and deliver or cause to be delivered to a \nRly. Servant a copy of article of charged framed against the staff, statement of imputation \nof misconduct or misbehavior and a list of documents and witnesses by which each article \nof charges is proposed to be sustained and should require the Rly. servant to submit a \nwritten statement of his defense with in 10 days.\n3) The Rly. Servant has to submit with a written statement of his defense, a list of witnesses \nto be examined. The authority should furnish him with a copy of each of such statement \nas early as possible. After receipt of written statement of Defense the Disciplinary \nAuthority can decide with the Inquiry. It may itself inquire into such of the article of \ncharges as or not admitted or he should appoint a Board of Inquiry or Inquiry authority.\n4) Disciplinary authority itself inquire into the article of charges or appoint a Board of \nInquiry or any other Inquiring Authority for holding an inquiry, into such charge, it may, \nby order in writing, appoint a Rly. Servant who is known as Presiding officer to be \npresent in the case in support of articles in charge.\n5) The Railway should give in writing regarding his defense's (Assistance \nRly.Employee) name. The ARE should be a Rly employee or Retired employee or official of \na retired Trade employee. The ARE should not be legal practitioner .\n6) Union official can't be an ARE unless he has been worked in a Recognized Union for \natleast one year.\n7) On the fixed date of inquiry, the disciplinary authority shall produce the oral and \ndocumentary evidence by which Articles of charge are proposed to be proved.\n8) The Presiding Officer shall examine the witnesses . And may be cross-examined on \nbehalf of Rly. Servant, for when the case of Disciplinary Authority is closed, the Rly. Servant \nshall be required to state his defense orally or in writing. The witnesses produced by the Rly \nservant shall then be examined or on behalf of him and shall be cross-examined by the \nPresiding Officer.\n9) The inquiry authority may, after the completion of the production of the evidence, \nhear the Presiding Officer, if any and the Rly. Servant, or permit them to file written briefs of \ntheir respective cases, if they so desire.\n10) After the conclusion of inquiry, a report shall be prepared by the inquiry authority. \nTaking into the consideration of this report, if the Disciplinary authority is of opinion that any \nof the penalties specified in clause V to IX of rule 6 (MAJOR PENALTIES) should be \nimposed on Rly. Servant, it shall make an order imposing such penalty and it shall not be \nnecessary to give the Rly. Servant any opportunity of making Representation.\n 17\n17", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 18, + "text": "11) The orders made by the Disciplinary Authority shall be communicated to Rly. Servant \nwho also be supplied with a copy of report of inquiry and a copy of its finding of the \nDisciplinary Authority together with brief reason for its disagreement.\nChapter 8. PROVIDENT FUND\n \nProvident Fund is governed by the Provident Act, 1925 and it means that a fund in \nwhich the subscriptions of the employees are deposited against their accounts including \ninterest accruing thereon.\nIn Railway there are two categories of funds, viz.-\n(a) State Railway Provident Fund 'Contributory'\n(b) State Railway Provident Fund 'Non-contributory'.\nFund under (a) above is applicable to all railway employees those were appointed prior to \n16.11.57 and not opted for Pension scheme and also those who are in service as on 1.1.1986 \nand have opted out of pension scheme.\nIn regard to (b) above, all -\n(i)Non-pensionable Railway employees who were in service on 15.11.1957 and who \nelect to come on pension scheme.\n(ii)Persons entering railway service on or after 16.11.1957 except those whose terms of \nappointment provided to the contrary; and\n(iii)CPF beneficiaries in service on 1.1.1986 should be demand to have come over to \npension scheme on that date, unless they specifically opt out to continue under CPF scheme.\nAll railway employees except those who are re-employed after final retirement, shall \nsubscribe to the fund, in accordance with the rules, from the first of the month following that \nin which they complete one year's continuous service, or from the date of confirmation \nwhichever is earlier.\nWith effect from 1.3.1992, the amount of subscriber's emoluments for that month in \nthe case of SRF (Non-contributory) Staff and 10% i.e. one tenth o the subscriber's \nemoluments in the case of SRPF (Contributory) Staff.\nProvided that: - In the case of a person on leave other than leave without pay, the \nsubscription to the State Railway Provident Fund shall be one twelfth (if governed by \nSRPE/Contributory Scheme) of the officiating/substantive pay (including overseas pay, \nspecial pay if it forms part of the scale of pay of the post, personnel pay and dearness pay) \nadmissible to the Railway servant from time to time, in the post which he would have held \nbut for being on leave. In the case of Running Staff one twelfth (if governed by SRPF/Non-\ncontributory Scheme) and one tenth (if governed by SRPF/contributory scheme) of 55% of \nthe basic pay shall also be added to the subscription referred to above. No subscription shall \nbe recovered during the leave without pay. It should be recovered in whole of rupee and the \nfraction of a rupee shall be rounded off to the next higher rupees i.e. fifty paise and above \nbeing rounded off to the next higher rupee and below fifty paise ignored.\n[R.B's No.F(E)III/93/PFI/4 of 30.12.1993]\nSubscriptions to Provident Fund during the last three months of service is compulsory \nexempted.\n[R.B's No.F(E)III-85-PF I/13 of 7.7.1986]\n Government Contribution :\n In the Provident Fund account of staff governed by State Railway Provident Fund \n'Contributory ', at the end of each half year, that is on 31st March and 30th September, a \n 18\n18", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 19, + "text": "contribution will be made from revenue which shall be equal to subscription paid by the \nsubscriber, shall be credited, on his being confirmed with retrospective effect. Such \ncontribution is known as government contribution, or Bonus. \nVoluntary Contribution (VPF):\n All compulsory subscribers may subscribe voluntary to the State Railway Provident Fund \nat time during the financial year at fixed rates in whole rupees subject to the condition that \nthe rates so fixed shall not exceed the emoluments after making necessary deductions due to \nGovernment. This amount of such subscription will be in addition to the normal subscription \npayable in the case of compulsory subscribers. This subscription may be reduced once at any \ntime during the course of the year, enhanced twice during the course of the year or reduced \nand enhanced as said. \n \nInterest:\n An interest shall be paid to the credit of the account of a subscriber at the rate as may \nbe determined for each year according to the method of calculation prescribed from time by \nthe President, it shall be credited with effect from 31st March of each year in the following \nmanner:\na) On the amount at the credit of a subscriber on the 31st March of the preceding \nyear, less an amount withdrawn during the current year interest for \ntwelve months;\nb) On sums withdrawn during the current year, interest from the is April of the \ncurrent year up to the last day of the month preceding the month of withdrawal;\nc) On sums withdrawn during the current year (ninety- percent withdrawal) interest \nfrom 1st April of the current year up to date of tender of payment;\nd) On sums credited to the subscriber's account after 31st March of preceding year- \ninterest from the date of deposit up to the 31st March of the current year; and\ne) Interest on the Arrears or Provident Fund Subscription Credited to the P.F. \nAccount will accrue from 1.11.97.\n[Authority: F (E) III/98/PFI/3, Dt. 23.3.1998]\nWhen the amount standing at the credit of a subscriber has become payable interest shall \nbe credited up to the date of tender of payment or up to the end of the sixth month after the \nmonth in which the amount become payable, whichever is earlier. Payment of interest on \nfund balance beyond a period of 6 month may be authorised by FA & CAO up to a period of \none year and the General Manager up to a period. After he has personally satisfied himself \nthat the delay in payment was occasioned by circumstances beyond the control of the \nsubscriber and in every such case the administrative delay involved in the matter shall be \nfully investigated and the action taken, if any, required.\n The accumulations at the credit of the subscribers to State Railway Provident Fund for the \nfinancial year beginning on 1.4.99 shall continue to carry interest @ of 12% p.a.\n[R.B.’s No.F(E)III/99/PF1/2, dated 9.7.99]\nIncentive Bonus: \nUnder the incentive scheme, any subscriber to State Railway Provident Fund who has not \nwithdrawn any amount from his provident fund account during the preceding three years \nshall be entire balance (including voluntary PF) at his credit on the last day of the year. The \nbalance on which bonus is to be calculated is the balance on the last day of the last year of the \nthree year period after crediting interest for the said last year. In case of those governed by \nSRPF (Count) Rules, the balance representing only subscriber's portion including VPF shall \nbe taken into account.\n \nWithdrawal and advances from Provident Fund:\nPlease see Chapter for Advances.\n 19\n19", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 20, + "text": "Deposit Link Insurance Scheme:\n This scheme was introduced to provide social security to the families of Railway \nemployees while death in service (if death occurred after 8.1.1975) which provide an \ninsurance cover to the subscriber without payment of any premium. This scheme is applicable \nto all Railway employees irrespective of fact whether SRPF optee or pension optee.\nOn the death of a subscriber to SRPF, the person entitled to receive the amount standing \nto the credit of the average balance in the account during the three years immediately \npreceding the death of such subscriber subject to a maximum of Rs.60,000.\nRule\"(2) (1) (a) - The balance at the credit of such subscriber shall not at any time during \nthe three years preceding the month of death have fallen below the limits of:\ni) Rs.25,000 in case of a subscriber holding a post in the scale of pay the maximum of \nwhich is Rs.12,000 or more ;\nii) Rs. 15,000 in case of a subscriber holding a post in the scale of pay the maximum of \nwhich is Rs.9,000 or more but less than Rs.12,000.\niii) Rs.10,000 in case of a subscriber holding a post in the scale of pay the maximum of \nwhich is Rs.3,5000 or more but less than Rs.9,000\niv) Rs. 6,000 in case of a subscriber holding a post in the scale of pay the maximum of \nwhich is less than Rs.3, 500;\n[No.E(W)97/WE-I/13, dt. 20.10.1998;]\nProvided that the subscriber has put in at least 5 years' service at the time of his/her death.\nThe average balance shall be worked out on the basis of the balance at the credit of the \nsubscriber at the end of each of the 36 months preceding the month in which the death occurs.\n[R.B's No.(W)WEL-23 dated 18.4.1990]\ni)The benefit can be given to member of the family only by R.B's No.(E) 76 WE 1-14 of \n31-3-77\nii) The amount of Deposit Link Insurance Benefit is also payable to the nominated major \nson without insisting on the provision of para 943 \n(ii) R-1 after duly satisfying about the bona fides of claimant.\niii) Additional benefit under DLI scheme, does not enjoy immunity from court \nattachment.\niv) DLI should be treated as insurance money so far income tax is concerned and is not to \nbe treated at par with SC to PF. It means it is not taxable.\nv) Government dues can be recovered from Government contribution hence Govt. dues \ncan be recovered from this additional benefit.\n[R.B's No.E(W)75 WEI-1 dt.21.7.1976]\nvi) Payment of DLI to the family of missing subscriber shall be made only after a lapse of \n7 years. In case under facts and circumstances there is sufficient proof of death, the payment \nmay not be delayed.\n[R.B's No.E(W)97/WE-1-13 of 1.4.98]\nvii) Suicide shall be considered and treated as death the benefit of DLI shall be accorded \nto the successor of the deceased.\n[R.B's No.E(W)97WE-I-13 of 1.4.98]\nSpecial Contribution to Provident Fund (SC to PF): \nThis amount is paid at the discretion of Government as a reward for good, efficient and \nfaithful service to permanent non- pensionable Railway employees and it cannot be claimed \nas a right. Hence it is not admissible to the railway employees who have been dismissed or \nremoved by reason of any misconduct. When retirement is due permanent physical or mental \nincapacity or abolition of appointment if other suitable appointment cannot be found for him, \nthen the controlling office may order the payment of Special Contribution to PF without \nrecording the certificate of good, efficient and faithful service.\n[R.B's No.F(E) III-80/Bn I/9 dated 18.11.1980] \n 20\n20", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 21, + "text": "In the event of death of Railway employee, it is payable to widow/widows/widower or \ndependent children, parents, brothers and sisters. In case of minor or lunatic for whom a \nnatural guardian is not available and Guardian under the Guardian and Wards Act, 1890 or a \nmanager under the Indian Lunacy Act. 1912, has been appointed, the payment shall be made \nto a person, authorised by law to receive the payment on behalf of minor or lunatic. The \nperson who has produced guardianship certificate has to execute an indemnity bond signed \nby two sureties agreeing to indemnify the Railway against any subsequent which might arise.\nThe Special Contribution of PF is calculated at half a month's salary for each completed \nyear of service subject to a maximum of 16 1/2 month’s pay.\nI f the service falls short of 15 years it shall be paid on the above rates subject to a \nmaximum of six month’s pay.\nIf the subscriber dies while in service, the controlling officer may, in addition to \ncontribution by Govt., direct a special contribution to be made to the subscriber's PF account \nin the manner prescribed above as if the subscriber had, on the date of his/her death service \non retirement on account of permanent incapacity provided that the special contribution so \ncredited shall not be less than the following. \na) If subscriber had not The amount by which\n completed one years. Government contribution \n service along with interest at his \n credit falls short of two \n months' pay.\nb)Completed one year The amount by which \n but not 5 year's Govt. contribution\n service. along with interest at\n his credit falls short \n of six months' pay.\nc)Completed 5 years Twelve months' pay\n or more.\nPayment of P.F. dues and Special Contribution to P.F. :\n \n1. Own and Government Contribution -\n Normally the amount standing at the credit of subscriber is payable in accordance with \nnomination executed. Where no nomination subsists the amount should be paid :-\na) In equal share to surviving wife/wives and children to the deceased sons who are \nmembers of the family of deceased subscriber.\nb) Sons and sons of deceased sons who have attained legal majority and married \ndaughters a married daughter of the deceased sons whose husbands are alive are \nnot entitled for any share. One share of the pre-deceased son would be paid in \nequal shares to his wife and children.\nc) In case where the only survivors are the major sons or married daughters then \nboth of them would be paid in equal shares subject to production of legal \ndocuments.\nd) In case posthumous child is brought to the notice, his share would be retained \nand if child \n is born alive, the payment would be arranged to him as in case of minor child, \notherwise his share would be distributed equally to others,\ne) In the absence of valid nomination if no member of the family survives then the \namount due could be paid to a person: -\n 21\n21", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 22, + "text": "i)Who is appearing a Accounts Officer to be entitled to receive when \nthe amount does not exceed rupees ten thousand; and\nii) Who produce Probate or Letter or Administration or succession \ncertificate when amount exceed rupees ten thousand.\n [R.B's No.D(E)III-88/PN I/42 st.20.10.89 ]\nf) In cases where only minor children are left, the following procedure may \nbe adopted :- \ni)Minor children means a son has not attained the age of 18 years and a daughter \nwho has not attained the age of 21 years or married whichever is earlier. For \nsuch children a legal guardian is necessary to receive the payment.\nii) In case of Hindu, the mother is a natural guardian, and in case of \nMohammedan, the paternal grandfather is natural guardian. In the case of \nChristian and others would be governed by Indian Succession Act, 1925 and \nbased on Succession Certificates payment would be made.\niii) In case where no natural guardian of such minor/minors exists, the \npayment can be made to any other person on his execution of an Indemnity \nBond on stamped paper with two solvent sureties. In all other cases, the payment \non behalf of minors would be made only to the legal guardian appointment by \nCivil Courts of Competent jurisdiction.\nII. Special Contribution to Provident Fund:\nThe amount is paid on the discretion of Govt. as a reward for good, efficient and faithful \nservice to permanent non-pensionable Railway employees and it cannot be claimed as a right. \nHence it is not admissible to the Railway servants who have been dismissed or removed by \nreason of any misconduct. When retirement is due to permanent physical or mental incapacity \nor abolition of appointment, if other suitable appointment cannot be found for him, then the \ncontrolling Officer may order the payment of Special Contribution to P.F. without recording \nthe certificate of good, effect and faithful service.\n[R.B's No.F(E)III-80/PN I/9 of 18.11.80]\n \nIn the event of death of Railway Servant, it is payable to widow/widows Children or \ndependent brothers sisters and parents. In case Minor or Lunatic for whom a natural guardian \nis not available and guardian under Guardian & Wards Act, 1980, or a Manager under Indian \nLunacy Act, 1912 has been appointed the payment shall be made to a person, authorised by \nLaw to receive the payment on behalf of the minor or lunatic. The person who has produced \nguardianship certificate has to execute an Indemnity Bond signed by two sureties agreeing to \nindemnity the Railway against any subsequent claims which might be arise.\nBreak in service:\nA break in service of a subscriber shall, unless condoned under the provision of rules, \nentail forfeiture of his service before the break for the purpose of calculating special \ncontribution admissible. The President may condone any break or deficiency in the service of \nsubscriber for the purpose of these rules :\nIn case of Group A & B Railway employees, the Railway Board and in case of Group C \n& D Railway servants the controlling authority, or hen the break does not exceed twelve \nmonths in all a head of department or Divisional Railway Manager may condone the break in \nservice, the period being treated as 'dies non'.\nProvided that ------\ni) The break was not due to dismissal or to participation in a strike declared to be illegal \nunder any law for the time being in force, or\nii) The break was due to the resignation by the subscriber in circumstance beyond his \ncontrol, or\n 22\n22", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 23, + "text": "iii) when the break was between one period of temporary service and another or between \ntemporary service and permanent service, the total service, permanent and temporary, \nrendered or likely to be rendered up to the date of superannuation, by the subscriber is \nnot less than thirty years.\nThe conditions mentioned in clauses (ii) & (iii) above, may, in special case, be relaxed by \nthe Railway Board or in respect of Group C & D subscriber by the Controlling Officer or \nGeneral Manager.\nNomination : \n1. A subscriber shall, at the time of joining fund, make a nomination and may distribute \nthe amount that may stand to his credit in the fund amongst his nominees at his own \ndiscretion, in the nomination. Such nomination can be cancelled by a subscriber by \nsending a notice in writing.\n2. On the marriage or re-marriage of a subscriber who is not a Hindu, Muslim, Buddhist \nor any other person exempted from the operation of the Indian Succession Act,1925, \nany nomination already made by shall forthwith become null and void.\n3. The amount standing at the credit of fund is payable (in case of death of subscriber while \nin service) in accordance with nomination executed. Where no nomination subsists, the \namount shall be payable in equal shares to surviving wife/wives, children or \nwidow/widows and children of deceased sons who are the members of the family \nof deceased subscriber.\n4. Sons and sons of deceased sons who have attained legal majority and married daughters \nand married daughters of deceased sons whose husbands are alive shall not be entitled \nany share. One share of predeceased son shall be paid in equal share to his wife and \nchildren.\n5. Where the only survivors are the major sons or married daughter then both of them shall \nbe paid in equal shares subject to the production of legal documents.\n6. Where a posthumous child is brought to notice, his share would be retained and if child is \nborn alive, the payment would be arranged to him as in the case of minor child, otherwise \nhis share would be distributed among others equally.\n7. In the absence of valid nomination if no member of the family survive, the dues shall be \npayable to a person : \ni) Who is appearing to Accounts Officer to be entitled to receive when the amount \ndoes not exceed ten thousand rupees. \nii)Who produces probate or letter of Administration or succession certificate when the \namount exceeds ten thousand rupees.\n[R.B's No.F(E)III 88/PNI/42 dated 20.10. ]\n8. In case of minor or Lunatic for whom a natural guardian is not available and Guardian \nunder Guardian and Ward Act, 1890 or a manager under Indian Lunacy Act 1912, has been \nappointed the payment shall be made to person, authorised by Law to receive the payment \non behalf of the minor or lunatic. The person who has produced Guardianship Certificate \nhas to execute Indemnity Bond signed by two sureties agreeing to indemnify the Railway \nagainst any subsequent claims, which might arise.\nIn case of Hindu the mother is natural guardian and in case of Muslims paternal \nfather is a natural guardian. In case Christian and other would be governed by Indian \nSuccession Act, 1925 and based on Succession Certificate payment would be made. \n9. Nominations are allowed for enabling the nominee to receive the following payments :\n (a) Provident Fund dues,\n (b) Death Gratuity \n (c) Benefits under Central Government Employees \n Insurance Scheme and \n (d) Life-time arrears of pensions.\n 23\n23", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 24, + "text": "Nominations in the case of Life-time arrears of pensions are to be filled before the \nretirement along with the application for pension. Form in this connection has been circulated \nvide Railway Board's letter No.F(E) III PN 1/25 of 21-11-1983. Such nominations can also be \nmodified by the pensioners with the respective disbursing authorities at any subsequent time.\nDeductions :\nNo deduction should be made from subscriber's contribution and interest thereon. The \namount of contribution made from Railway revenues, i.e., Government contribution or bonus \ncan be withheld, if the subscriber has been dismissed from the service for grave misconduct; \nprovided that if the order of dismissal is subsequently cancelled, the amount so deducted shall \nbe replaced at his credit; if subscriber resigns his employment under the Government within \nfive years of the commencement thereof otherwise than by reason of superannuation, or \ndeclaration of competent medical authority that he is unfit for further service; Government \ncontribution cannot be withheld in the cases of removal from service whatever the reasons \nfor such removal may be. \nGovernment contribution may be postponed for a period of 6 months, whether the \ncommercial debits are involved. So as to enable the recovery of sum intimated by the \ncontrolling officer, provided the deduction does not exceed 10 percent of the contribution \nmade form railway revenues [Please see page 383 also ]\n[R.B's No. of 17,11.87 ]\nThe amount of house building advance with interest there on falls due for payment shall \nbe deducted by the \nControlling Officer.\nNo order regarding the withholding or deductions from the amount of Government \nContribution to provident fund shall be made unless the Railway servant has been given a \nreasonable opportunity for making a representation in the matter. [944 - RI]\nAnnual Statement of Account (PF Slip) :\nAs soon as possible after the close of each financial year the Accounts Officer shall send \nto each subscriber a statement of his account in the fund showing the opening balance at the \nbeginning of the year, the total amount credited or debited during the year, the total amount of \ninterest credited at the end of year, closing balance at the end of the year and the amount of \nincentive bonus, if any.\nThe subscribers should satisfy themselves as to the correctness of the annual statement, \nand errors should be brought to the notice of the Accounts Officer within three months of the \nreceipt of Statement.\nChapter 9. RETIREMENT\nRetirement means, the Railway servant ceasing to be in service. The date of retirement \nwill be based on the date of birth of railway servant recorded in the Service Register/Record \nor Classified List of Gazetted Establishment. A railway servant whose date of birth is the first \nof a month, shall retire from service on the afternoon of the last day of the preceding month, \non attaining the age of sixty years, as the case may be. The various nodes by which the \nservice of railway servant may come to an end are :-\na) Normal retirement on Superannuation.\nb) Retirement due to medical invalidation.\n 24\n24", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 25, + "text": "c) Premature retirement ordered in the public interest, and\nd) Premature/Voluntary retirement on his/her own option.\n \nNormal Retirement :\n (i) Every railway servant shall retire from service on attaining Superannuation i.e. the \nage of 60 years from 13.5.1998.\n (ii) Railway servant in Group ' D' service or post who, prior to 1st December, 1962 was \nentitled to serve up to the age of 60 years, shall retire from service on the afternoon of the last \nday of the month in which he attains the age of 60 years.\n[R.B's No.E(P&A)I79/RT/9 of 8.6.79 and E(P&A)I 82 / RT / 16 of 8.12.1982 and No. \nE(P&A)I-98/RT-6 of 14.5.1998 ]\n(iii)Principals, Vice-Principals, School Teachers, Laboratory Assistant Librarians working in \nthe Railway Schools and colleges who has joined service prior to 1-4-1989 shall retire from \nservice on the afternoon of the last day of the month in which they attain the age of 60 years. \n[R.B's No.E(P&A)I/83/RT/20 of 9.5.84 and 6.4.89]\nCompetent authority may a Railway servant under suspension to continue in service \nbeyond the date of his retirement in which case he shall not be permitted to retire from \nservice and shall be retained in service till such time as required by that authority. Such \ndecisions shall be taken, on the merits of each case and only in those cases where the prospect \nof dismissal is nearly certain and there is likely of denying the employee Government \ncontribution, S.C. to P.F/Retirement Gratuity.\nMedical Invalidation :\nRailway servants, both permanent and temporary, who are declared medically unfit for \nservice in the post held by them, but are declared fit for service in the posts which fall in a \nlower medical category are eligible to be continued in service in the posts requiring a lower \nmedical standard. However, where in the case of temporary employees becoming medically \ndecategorised on account of circumstances not arising out of and in the course of employment \nalternative employment is not found within the period of leave/extenuation of \nleave/extraordinary leave granted to railway servants as admissible under the rules, the \nemployees should be discharged from service. In cases, where the offer of alternative \nemployment has been refused the railway servants concerned should retired. [304 RI]\nPremature Retirement :\nPremature retirement means the retirement of an employee ahead of attaining the age of \nsuperannuation either on his or her own volition or as a result of an order passed by the \ncompetent authority in public interest. This is distinct from voluntary retirement sought by \nthe railway servant and compulsory retirement ordered as a penalty, under the Railway \nDiscipline and Appeal Rules.\nThe appointing authority has the right to retire in the public interest a railway servant, \nfalling in one or the other of the following categories, from the service by given him/her a \nnotice of not less than three months in writing or by giving him/her pay and allowances in \nlieu thereof :\n(a) A railway servant in Group A or B service or post working in a substantive or \ntemporary capacity who has entered Government service before the age of thirty \nfive years, after he has attained the age of fifty years;\n(b) Group A & B Railway servants who has entered service after the age of fifty five \nyears, after attaining the age of fifty five years.\n(c) Railway servants belonging to Group \"C\" AND \"D\" after their attaining the age of \nfifty five years.\n(d) Pensionable Railway servants after their completing thirty years of qualifying \nservice; and\n 25\n25", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 26, + "text": "(e) Non-pensionable railway servants after their completing thirty years of service.\nRailway servants have also a reciprocal right to seek premature retirement from service \nby giving in writing a notice of not less than three months to the appropriate authority on the \nsame terms as set out in above para. \nAn order requiring/permitting a pensionable railway servant to retire on completion of \nthirty years of qualifying service should as a rule, not be issued until after the act of \ncompletion of thirty years of qualifying service by the railway servant has been verified in \nconsultation with the concerned Accounts Officer.\n It is open to the appropriate authority to without permission to a Railway servant under \nsuspension, who seeks to retire prematurely by giving the requisite notice. The appropriate \nauthority has also the right to refuse permission even if the Railway servant is placed under \nsuspension after he has given the notice for retirement, but such right shall be exercised by \nthe said authority before the expiry of the period of the notice given.\n No formal order of acceptance of the notice of premature retirement sought by the \nRailway servant, is necessary and the Railway servant will be deemed to have retired \nautomatically at the end o the notice period of three month. In case of Railway servant under \nsuspension, while the appointing authority has, no doubt, the power to without permission, \nfailure to communicate to the Railway servant concerned, withhold permission for them to \nretire will lead to their automatic retirement on the expiry of notice period. \n[R.B's No.E(P&A)I-81/RT/4 of 1.6.81 and E(P&A)I-83/RT/11 of 3.1.83]\n The notice of three months to retire a Railway servant can be given while the Railway \nservant is on leave including extra-ordinary leave.\n[R.B's No. PC-67/RT/9 of 8.9.67]\nVoluntary Retirement :\n1. A. Railway servant may retire voluntarily after a minimum qualifying service of \n20 years. In such case the weightage of maximum period of five years shall be \ngranted as an addition to qualifying service.\n2. For voluntary retirement, a notice of three months in writing or three months' pay \nand allowances in lieu of such notice shall be given.\n3. While granting proportionate pension/ Special Contribution to Provident Fund to a \nRailway servant retiring voluntarily under the scheme, weightage up to five years \nshall be given as an addition to the qualifying service (irrespective of whether \ngoverned by pension rules or SRPF rules) rendered by him. The grant of \nweightage up to 5 years will, however, be subject to the conditions that the total \nqualifying service rendered by Railway servant does not in any case exceeds 33 \nyears and it does not take him beyond the date of superannuation.\n The weightage shall be an addition to qualifying service and it will not entitle the \nRailway servant to any notional fixation of pay for the purpose of calculating pension, \ngratuity and other retirement benefits based on actual emoluments. The weightage shall \ncount for post retirement passes.\n[R.B's No.E(P&A)I-77/RT/46 of 9.11.1977 and 9.11.1983]\n4. A notice less than three months may also be accepted by the appointing authority \nin deserving cases, and when such less than three months notice is accepted in the \ncase of pensionable railway employees, it should be on the specific condition that \nthe Railway servant shall not apply for commutation of a part of his pension \nbefore the expiry of the period of notice of three months.\n5. Officers seeking voluntary retirement for joining Central Administrative \nTribunals, would be entitled for 5 years weightage subject to the conditions that \n 26\n26", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 27, + "text": "qualifying service does not exceed 33 years and it does not take him beyond the \ndate of superannuation. \n[R.B's No. E(P&A) I-94/RT-8 of 8.5.19995 ]\nChapter10. PENSION\nExtent of application :\nAll Railway servants who were in service on 15.11.1957 who elect to come on these \nrules; persons entering Railway service on or after 16.11.1957 except those whose terms of \nappointment provide to the contrary and all CPF beneficiaries in Service in 1.1.1986 should \nbe deemed to have come to pension scheme unless they specifically opt out to continue under \nthe CPF Scheme.\nClassification of Pension :\n(a) Superannuation Pension -\nSuperannuation pension is granted to a Railway servant entitled or compelled by rules to \nretirement i.e. at the age of 60 years from 13.5.98.\n[R.B's No.E(P&A)I-98/RT-6 of 14.5.98; ]\n(b) Retiring Pension -\nThis pension is granted to a Railway servant who is found unfit for further any service on \naccount of physical or mental infirmity. If, however, the unfitness is directly due to irregular \nor intemperate habits, no pension shall be granted.\n(c) Compensation Pension -\nThis pension is granted to an employee discharged from service owing to abolition of a \npermanent post unless he is appointed to an other wing to abolition of a permanent post \nunless he is appointed to an other post the conditions of which are deemed to be atleast equal \nto that of his old post. \nPension admissibility comprises of elements, viz. \n(a) The service gratuity, &\n(b) Pension.\nThe service gratuity for qualifying service less than ten years shall be calculated at \nuniform rate of half month's emoluments for every completed six monthly period of service \ninstead of at the rates specified in the Table below the relevant provisions of MRPR, 1950.\nPension shall be calculated at 50% of average emoluments in all case (Whether \nsuperannuation, Retiring, Invalid of Compensation pension), subject to a minimum of Rs. \n1275/- and maximum upto 50% of the highest pay in the Railways. Thew highest pay in the \nRailways is Rs. 26,000/- since 1.1.96. The above percentage is for 33 years qualifying \nservice. Where the qualifying service is less than 33 years the same may be granted \nproportionally, i.e. pension worked out divided by 33 and multiplied by the qualifying service \n 27\n27", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 28, + "text": "rendered by the employee. the amount of pension finally calculated should be rounded off to \nnext higher rupee.\n[R.B's No.() of B No.F(E)III-97/PNI/22 of 5.11.97]\nAverage Emoluments :\nThe terms “Emoluments\" for the purpose of calculating the various pensionary \nbenefits other than Retirement/Death Gratuity shall mean basic pay as defined in Rule 1303 \n(I) RII (FR9) (21) (I) which the Railway servant was receiving immediately before his \nretirement or on the date of his death.\nIn the case of Retirement/Death Gratuity, Dearness Allowance admissible on the date \nof retirement/death shall also be treated as emoluments, along with the emoluments as \ndefined under Rules 1303 (I) RII (Ferry) (21) (I)\n[R.B's No.F(E)III-97/PNI/22 of 5.11.97]\nAverage emoluments shall be determined with reference to emoluments drawn by a \nRailway servant during the last ten months of his service. Average emoluments calculated \nwith reference to the position of the employees during last ten months if he quitted service or \nafter 1.3.1976 and includes running allowance of 55% in the case of running staff and non-\npracticing allowance incase of Doctors.\nIf during last 10 months of service, a Railway servant is absent from duty or on \nextraordinary leave (without salary) or has been under suspension, the period whereof does \nnot count as qualifying service, the aforesaid period of leave or suspension should be \ndisregarded, an equal period before 10 months, being included.\nThe stagnation increment should be treated as pay for calculating average \nemoluments.\n[R.B's No. PC-IV/87/Increment/3 of 25.9.90]\nWith effect from 1.4.95, the charged allowance, which is actually in the nature of pay \nrestricted under Ferry-35, should be reckoned as pay and will count as pay for the purposes of \npension, gratuity as well as for leave salary. However, for calculating average emoluments in \nthe case of retired employee who has drawn charged allowance prior to 1.4.95 and whose \nretirement date falls after 1.4.95, this allowance shall be included in pay.\n[R.B's No. F(E)III/94/PNI/26 of 23.6.95]\nLast Emoluments :\n Last pay means basis pay as define in Rule 1303 (I) RII(FR9) (21) (a) (I) which the \nRailway servant was receiving before retirement/death and includes Running Allowance in \ncase of running staff and non practicing allowance in case of Doctors and there is no ceiling \nlimit for the purpose of these rules.\nQualifying Service :\n Qualifying service includes the period of permanent, temporary or officiating service \nwithout interruption by confirmation in the same or other post excluding leave without pay \nother than covered by medical certificate, apprentice / under-age service, suspension treated \nother than duty / strike, substitute service first 6 months, suspension period and candidate \nservice on stipend plus weightage (due to medical unfitness for certain categories), and \nmonthly rates service less half of this service.\nAll periods of leave with leave salary and extraordinary leave granted on medical \ncertificate, take up to the date of superannuation or the date of extension of service, if any, \ncount as qualifying service. Extraordinary leave other than covered under the medical \ncertificate may also be allowed to count for pensionary benefits at the discretion of competent \nauthority if - \n (i) It is taken due to the inability of the person concerned to join or rejoin duty due to \ncivil commotion or a natural calamity if he has, no other leave, due. \n(ii) it is taken for higher scientific and technical studies.\n 28\n28", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 29, + "text": "Extraordinary leave granted on or after 18.2.1986 in the above-mentioned circumstances \nshall automatically count as qualifying service for pension and increments.\n[R.B's No.F(E)III/86/PNI/21 of 9.1.87]\nFor the purpose of pension, qualifying service is considered in terms of completed six \nmonthly period. In calculating the length of qualifying service, fraction of a year equal to \nthree months and above shall be treated as a completed half year and reckoned as qualifying \nservice for determining amount of pension \n[R.B's No.F(E)III/79-PNI/10 of 25.8.1983]\nWith effect from 22.12.1983, Group C and D employees who are required to \nundertake Departmental Training relating to job before they are put on regular employment, \neven though during the training, they are in receipt of normal allowances and not given the \nscale of pay, training period may be treated as qualifying service for pension, if the training is \nfollowed immediately by appointment.\n [R.B's No.F(E)III-79-PNI/20 of 17.4.1984 and 13.10.1986]\nIn case the trainee fails to complete the training period in one attempt, the benefit of \ninitial training period to qualify for pension in the event of the trainee's failure in the initial \ncourse but passing the repeat course subject to the condition that the period of interruption \nbetween the initial training period and repeat course as well as the entire period of repeat \ncourse will be treated as dies-non in such cases, is allowed.\n[R.B's No. F(E)III/79/PN-I/20 of 14.3.1995.]\nThe Officers/Servicemen exercising option for counting of Military Service as qualifying \nservice shall be required to refund the benefits in accordance with Rule 34(I) of Railway \nService (Pension) Rules, 1993 along with interest as detailed in Railway Board's letter No. \nF(E)III/94/PNI/28 of 1.11.94]\n[R.B's No.F(E)III/88/PNI/15 of 25.1.95]\nCommutation of Pension :\nA Railway servant shall be entitled to commute for a lumpsum payment upto 40% of his \npension. An employee who on superannuation/retiring compensation or on voluntary \nretirement(i.e. before next birth date) shall not be subjected to do medical examination for the \npurpose of payment of commuted value.\nA Railway servant retiring from Railway service on absorption in or under a corporation \nor company or body, the period of one year for the purpose of commutation of a portion of \npension without medical examination, shall be reckoned from the date of issue of \nGovernment orders and not from the date of actual retirement. In case, where departmental or \njudicial proceedings have been instituted against a railway servant, the period of one year for \ncommutation of pension shall reckon from the date orders issued on the conclusion of the \nproceedings provided that such employee on the conclusion of proceedings is granted \npension in whole or part thereof.\n[R.B's No. F(E) III/76 PNI/7 of 11.2.1981]\nIn case the Railway servant is on deputation to Public Sector Undertaking and has \npermanently been absorbed there he will be granted Retiring Pension. Such employees are \nnot entitled for commutation of full pension.\n[R.B's No.F(E)III 95/PN I/19 of 10.7.95]\nPensioners who have commuted full pension in the past are also entitled the benefit so \nfar it related to restoration of 1/3rd of the commuted pension. The procedure to be followed in \nsuch case is detailed in Boards letter No.F(E)III 96/PNI/9 of 25.10.96, RBE 103/96 and dated \n18.8.98; RBE 185/98.\nThose who on absorption in or under a Corporation or Company or Body elect the \nalternative of receiving the DCRG and lump sum in lieu of pension, will be subject to \nmedical examination even though they apply within one year of date or retirement/absorption \netc..\n[R.B's No. F(E)76 - PN I/24, dated 4.1.1979]\n 29\n29", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 30, + "text": "Applications for commutation of pension can be made even before retirement, to be \nsubmitted alongwith pension papers for authorisation along with pension payment order for \nthe employees retiring on superannuation pension only. Such applications should be made in \nnew prescribed form for the purpose at least three months in advance. These rules do not \napply to the employees who desire to receive commutation value at cash office by cheque in \nwhich case the existing procedure is applicable.\n[R.B's No.F(E) III-761/24, dated 8.8.1983]\nIf a Railway pensioner dies on or after a date on which the commutation becomes \nabsolute but before receiving the commutation value the same is payable to his legal heirs. \nWith a view to simplify the procedure the Board have conveyed President's sanction that \nwhile making application for commutation of pension either :\n(i) without Medical examination admissible in terms of R.B's No. F(E)III-76/PNI/24, \ndated 27.1.1978 & 4.1.1979; or\n (ii) with Medical examination as permissible under \nRule 2906 RII (Para 1205 MRPR); or\n(iii)provisional pension sanctioned on account of \n non-availability of service records; or\n(iv) any omission/deficiency therein as the case may be shall also make nomination in the \nPerforma attached to BD’s letter by conferring on one or more persons the rights to \nreceive the commuted value of the pension in case the applicant dies without receiving \nthe commuted value on or after the date on which the commutation becomes absolute.\n[R.B's No.F(E)III-85-PNI/15, dated 19.8.1985]\nCommutation Table at each Birth Year of Age\n[R.B's No.FE/III/71/PN/1/10, dated 23.6.1971] (Rule 9,27(7), 29(5), 30(1) & 2 of \nCommutation of Pension Rules, 1993]\nCommutation Table\n----------------------------------------------------------------------\nAge Purchase value Age Purchase value\n----------------------------------------------------------------------\n32 17.46 x 12 = 209.52 53 12.35 x 12=148.20\n33 17.29 x 12 = 207.48 54 12.05 x 12=144.60 \n34 17.11 x 12 = 205.32 55 11.73 x 12=140.76\n35 16.92 x 12 = 203.05 56 11.42 x 12=137.04\n36 16.72 x 12 = 200.64 57 11.10 x 12=133.04\n37 16.52 x 12 = 198.24 58 10.46 x 12=129.36\n38. 16.31 x 12 = 195.72 59 10.78 x 12=125.52\n39 16.09 x 12 = 193.08 60 10.13 x 12=121.56\n40. 15.87 x 12 = 190.44 61 9.81 x 12=117.72\n41. 15.87 x 12 = 187.68 62 9.48 x 12=113.76\n42. 15.40 x 12 = 184.80 63 9.15 x 12=109.80\n43. 15.15 x 12 = 181.80 64 8.82x 12=105.84\n44. 14.90 x 12 = 178.80 65 8.50x 12=102.00\n45. 14.64 x 12 = 175.68 66 8.17 x 12= 98.04 \n46. 14.37 x 12 = 172.44 67 7.85 x 12= 94.20\n47. 14.10 x 12 = 169.20 68 7.53 x 12= 90.36\n48 13.82 x 12 = 165.84 69 7.22 x 12= 86.64\n----------------------------------------------------------------------\nAge Purchase value Age Purchase value\n----------------------------------------------------------------------\n49. 13.54 x 12 = 162.48 70 6.91 x 12 = 82.92\n50. 13.25 x 12 = 159.00 71 6.60 x 12 = 79.20\n 30\n30", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 31, + "text": "51 12.95 x 12 = 155.40 72 6.30 x 12 = 75.60\n52. 12.66 x 12 = 151.92 73 6.01 x 12 = 72.12\n---------------------------------------------------------------------\nA Railway servant while making application for commutation may also nomination one \nor more persons he right to receive the commuted value of pension, in case the applicant dies \nwithout receiving the commuted value on or after the date on which commutation becomes \nabsolute. In the absence of nomination, the commuted value is payable to the heirs of \napplicant in the manner indicated in para 702(I) & (ii) of MRPR ( as in the Caw of Death \nGratuity),\nIn cases, where the nomination has not been or the amount is not payable because the \nClaimant is not a member of the family, the same has to be released on basis of Legal Heir \nCertificate.\n[R.B's No.F(E)III 85-PN-1/15 of 19.8.1985; F (E)III/88/PNI/28 of 1.11.1988]\nExample : An employee wishes to commute his 40% of pension at the age of 59 years \nand his pension is fixed Rs.1800/-p.m. 40% pension comes to Rs. 720/- and the purchase \nvalue against age of 60 years the next birth date in the above table is Rs.121.56. Hence the \ncommutation value would be 121.56 + Rs.87,524.\nAfter commutation of maximum 40% of pension, the employee would be entitled for \nresidual pension plus dearness relief on original pension i.e. in this case the employee would \nget Rs.1080 plus dearness relief on Rs.1800. The employee has to appear for Medical \nExamination as he has completed one year after retirement.\nNote : The amount of personal pension will not be taken into account for the purpose of \ndetermining the commuted value and relief on pension. \n[R.B's No.PC/III/85/DP/I 27.6.1985 ]\nImplementation of the recommendation of Fifth Pay Commission relating to \ncommutation of pension :\n---------------------------------------------------------------------------------------\nPoints Decision/Clarification\n----------------------------------------------------------------------------------------\n(1) Whether a post 1.1.1996 Yes\n retiree has to apply\n afresh for commutation\n of his pension upto 40% ?\n (2) Whether 40% commut- In case the retired Railway\n ion should be allowed servant has availed of the\n after medical examin- benefit of commutation of\n ation, if applied after pension not exceeding 1/3rd \n one year of retirement of his pension within one \n and what will be the year of retirement, he may\n commutation factor allowed the benefit of \n for revised commutation? commutation of pension\n upto 40% w.r.t. age next birthday,as on \ndate,without medical examination. In case the retired \nRailway servant had not availed of the communication \nupto 1/3rd within one year of retirement, he 40%w.r.t. age \nnext birth day, as on date, after medical examination.\nThe pensioners who have already undergone medical \nexamination in the latter case need not be medically \n examined again for this purpose.\n (3) Date from which Reduction in pension on\n 31\n31", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 32, + "text": "reduction in pension account of additional \n will take effect ? commutation of pension \n will be in two stages as per\n the provisions contained in rule \n 7 of Railway Services\n (Commutation of Pension) Rules, 1993..\n (4) What will be the The commuted portion of\n date of restoration pension shall be restored\n---------------------------------------------------------------------\n Points Decision/Clarification\n----------------------------------------------------------------------\n \nof additional commu- after 15 years from the \n tation of pension ? respective dates of \n commutation as provided in \n Board's letter No.F(E)III/\n 76/PNI/7 dt. 15.9.80.\n Necessary endorsement should be made\n in the PPO.\n (5) Whether pensioners Yes.\n retired on or after\n 1.1.1996 and had\n retained pre-revised\n scales will also be\n eligible for 40% of\n commutation of\n pension ? \n (6) Whether the family No.\n can be given the\n benefit of 40%\n commutation if a \n pensioner dies \n before exercising\n his option.\n----------------------------------------------------------------------\n2. In regard to point (2) clarified as above, it is stated that in the case of post 1.1.1996 \npensioners who have opted for commutation of an additional fraction of pension upto 40% \nover and above fraction of pension already commuted and where medical examination was \nnot involved, the commutation became absolute on the date on which the application form \nwas received by the Head of Office and that date should be reference to age next birthday. In \ncases where medical examination was involved, the commutation became absolute on the \ndate on which the medical authority signed the medical report and that date should be the \nbase date for determining the commutation factor with reference to age next birthday. \nAccordingly, in all those cases where commutation of additional fraction of revised pension \nupto 40% has time been allowed by taking the same commutation factor as was admissible at \nthe time of original commutation of a fraction of the pre-revised pension without regard to \nthe date of receipt of application for the same, and where commutation factor undergoes a \nchange in terms of the clarifications given here-in-above the commutation value may be \nrecalculated and recoveries, thereof, if any, made from the pensioner. \n3. As regards points (3) & (4), it is clarified that the reduction in pension shall be in two \nstages -\n 32\n32", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 33, + "text": "(i) from the original date commutation upto 33.33% of pre-revised pension & (ii) from the \ndate of payment of difference between the commuted value of pre-revised pension upto \n33.33% and the commuted value determined with reference to revised pension, as also \ncommuted value of a fraction beyond 33.33% but up to 40% of the revised pension. The \nrespective date of the reduction in pension and the amount of pension so reduced as well \nas the corresponding dates of the restoration after 15 years from the dates of reduction , \nshould be endorsed in the Pension Payment Order. Where further reduction in pension on \naccount of payment of enhanced commu7tation value of a fraction up to 33.33% of \nrevised pension as also payment of commutation value of an additional fraction up to \n40% of revised pension, has been effected from the original date of commutation of a \nfraction of pre-revised pension, the recoveries made from the dues of the pensioners on \nthis account at that time should be refunded to the pensioners.\n4. It shall be the responsibility of the Head of Office to adhere to the \ndecision/clarifications given as above in order that the additional commutation value \nis recalculated and excess amount paid is recovered or adjusted against the amount \ndue for refund to the pensioner on account for change in date of reduction of \nrevised/additional commutation of pension and endorsements in all these respect \nincluding the respective dates of reduction in pension and the corresponding dates of \nrestoration of reduced amount of pension, are made in the revised Pension Payment \nOrder.\n[No.F(E)III/97/PNI/22; dt.8.10.1998, RBE 207/98]\nRestoration of Commuted portion of Pension :\nIt has been decided that only such Central Government pensioners who have \ncommuted a portion of their pension and on 1.4.1985 or thereafter have completed or will \ncomplete 15 years from their respective dates of retirement will have their commuted portion \nof pension restored.\n[R.B's No.F(E)III/87/PNI/7 of 26.3.1987]\nPensioners would be entitled to have the commuted portion of pension restored to them \non the expiry of 15 years from the date of retirement only if the commutation was \nsimultaneous is subsequent to the date of retirement thereby causing a time-gap between \nthese two events, this restoration would take place only on the expiry of 15 years from the \ndate of commutation and not from the date of retirement.\n[R.B's No.F(E)III/87/PWI/7 of 26.10.90]\n[Dept. of Pension and PW.No. 34/2/86. P.& P.W.(G) of 23.1.1989]\nFamily Pension :\nIn case of Railway servants who entered in service on or after 1.1.64 or having entered in \nservice prior to 1.1.64 has opted for or is deemed to have opted for Family Pension Scheme, \n1964, the family pension is sanctioned to the widow/widower and if there is no \nwidow/widower, is payable to minor children of Railway servant. It can be granted only if the \nRailway servant.\n(a) dies while in service on or after 1.1.64,\n(b) retired on or after 1.1.64 and at the time of death he \n was in receipt of ordinary pension, and\n(c) families of Railway servants governed by pension scheme who retired or died before \n1.1.64 or otherwise not covered by the family pension scheme. In such cases payment of \npension shall be effective from 22.9.1977.\n[R.B's No.F(E) III-85 PNI/19 of 26.7.1985]\n 33\n33", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 34, + "text": "Family Pension shall be calculated at a uniform rate of 30% of the basic pay in all cases \nand shall be subject to a minimum of Rs.1275/- p.m. and a maximum of 30% of the highest \npay in Railways. (The highest pay in the Government is Rs. 30,000/- since 1.1.96)\nIn case of Railway employee who dies after having put in not less than seven years' \ncontinuous service, the amount of family pension will be at the rate of 50% of pay last drawn \nor employees ordinary pension subject to a maximum of ----\n(a) one and half times the pension admissible as per the limit laid down above in the case of \nfamilies entitled to compensation under the Workmen's Compensation Act, and\n(b) twice the pension admissible as per limit laid down above in case of families not entitled \nto the Workmen's Compensation Act.\n[R.B's No.F(E)III/99/PNI/5, dated 15.3.99;Bahri's 49/99]\nThe family pension will be admissible only one person at a time to the following family \nmembers :\n(a) Wife in case of male Railway servant,\n(b) husband in case of female Railway servant,\n(c) minor sons,\n(d) unmarried, widowed/divorce daughters, and\n(e) Parents.\nIf wife/husband is alive, the family pension shall be granted in favor of wife/husband, as \nthe case may be and the children shall not be eligible. The eligible male/female children \n(including male and female children suffering from disorder or disability of mind) of the \ndeceased Railway employee or pensioner will be entitled to the family pension in order of \ntheir birth irrespective of the sex of the child and the younger of them will not be eligible for \nfamily pension unless the elder above him or her becomes ineligible for the grant of family \npension. The children irrespective of sex will be eligible for family pension up to the age of \n25 years, excepting those suffering from disorder of disability of mind who would be eligible \nfor life time.\nFamily pension payable to a son be stopped when he attains the age of 25 years and in the \ncase of a daughter when she attains the age of 25 years or when she gets married whichever is \nearlier.\n [R.B's No. F(E)III/85/PNI/19 of 14.5.93]\nFor the purpose of Family Pension, the definition shall also include, the parents who were \nwholly dependent on the Railway servant when he/she was alive provided the deceased \nemployee had left behind neither a widow nor a child. In case, where family pension is \ngranted to widowed/divorced daughters, it may be stopped when she attains the age of 25 \nyears.\n Parents shall be eligible for family pension with effect from 1.1.98. Widow/widower, son, \ndaughter, or widowed /divorced daughter will have prior claim to family pension Wherever \nfamily pension admissible to parents, the mother will receive the pension first and after her \ndeath father will receive. \n[R.B's No.F(E)III/98/PNI/4 of 9.9.99]\nThe income criteria for grant of family pension in respect parents and widowed/divorced \ndaughters will be that their earning is not more than Rs.2550/- per month. The parents will \nget family pension at the rate of 30% of basic pay of the deceased employee subject to a \nminimum of Rs.1275/- per month. They also will have to produce an annual certificate to the \neffect that their earning is not more than 2550 per month. Family pension to the \nwidowed/divorced daughters will be admissible till they attain the age of 25 years or upto the \ndate of her marriage which over is earlier.\nFamily pension in respect of sons/daughter (including widowed/divorced daughters) will \nbe subject to the condition that the payment should be discontinued/not admissible when the \neligible son/daughter starts earning a sum of Rs.2550/- per months from employment in \nGovt., the private sector, self employment etc. It is also admissible till he/she attains 25 years \nof age or upto date of her/his marriage whichever is earlier. \n 34\n34", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 35, + "text": "There is no change in the provisions about admissibility of family pension in respect of \nsons/daughters suffering from any disorder or disability of mind or who is physically crippled \nor disabled.\nFamily pension to parents and widowed/divorced daughters will be admissible w.e.f. \n1.1.98 subject to fulfillment of other conditions.\nThe case where family pension has already been granted to sons/daughters after \n1.1.98 before issue of these instructions without imposition of earning condition need not be \nreopened.\n [R.B's No.F(E)III/98(PNI)4 of 27.4.98 ]\nIn cases, where the family pension payable to the twin children, the same will be \npayable to such twin children in equal shares. In the event of any of such children ceasing to \nbe eligible for family pension, his/her share family pension will not lapse but will become \npayable to the other such children and when both such children become ineligible for family \npension, the family pension will become payable to the next eligible single child or twin as \nthe case may be.\n [R.B's No.F(E) III/85/PN-I/19 of 25.3.1991]\nFamily pension is first granted to widow/widower and then children and no other \nmember is eligible except that the authority competent to sanction pension in a suitable case \nfor reasons to be recorded in writing, orders, that the minor children in preference to the \nwidower who is judicially separated, should be paid. \n [R.B's No.F(E)III-7-PNI/36 of 2.2.1972]\nAfter the children cease to be eligible for family pension the same shall be authorised \nto the Judicially separated spouse of the deceased Railway servant(Judgement of Kerala High \nCourt)\n [G.I.D.P. & W NO. 1/6/98-P & P W(E) of 5.7.99] \nAt present the cases, for grant of family pension to the eligible family members of \nemployees who have suddenly disappeared (absconded or missing) and whose whereabouts \nare not known, are delayed considerably due to the facts that in normal course unless a period \nof seven have elapsed since the date of disappearance of the employee, he cannot be deemed \nto be dead and the retirement benefits cannot be paid to the family. This principle is based on \nsection 108 of the Indian Evidence Act which provides that when the question is whether the \nman is alive or dead and it is proved that he has not been heard of for seven year by those \nwho would naturally have heard of him if he had been alive, the burden of proving that he is \nalive is shifted to the person who affirms it.\nWithholding of the benefits, due to the family has been causing a great deal of hardship to \nthe families, therefore, the following course of action should be taken in such cases.\n(a) When a employee disappears leaving his family, the family can be paid in the first \ninstance the amount of salary due, leave Encashment due and the amount of Provident \nFund pertaining to his own subscription in SRPF having regard to the nomination \nmade by the employee\n(b) After elapse of one year period, other benefits such as Retirement Death \nGratuity/Family Pension in respect of pensionary staff and Government \ncontribution/SC to P.F. in respect of staff governed by SRPF (Contributory) Rules \nmay be granted to the family subject to the fulfillment of conditions prescribed.\nOne year will be reckoned from the date first information report lodged with police and \nthe period of one year after which the benefits of family pension and gratuity will also \nreckoned from this date.\n [R.B's No.F(E)III/86/PNI/77 of 23.7.91]\nThe family pension, which in pursuance of these orders, will continue to be sanctioned \nand paid one year after the date of lodging the FIR will accrue from the date of lodging the \nFIR or expiry of leave of the employee who has disappeared whichever is later. When \n 35\n35", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 36, + "text": "sanction for family pension is issued the payment of pension from the date of accrual may be \nauthorised, after obtaining the usual indemnity bond.\n [R.B's No.F(E)III/86/PN-I/17 of 21.1.1994]\nThe Indemnity Bond shall be obtained from the family members of the disappeared \nemployee/pension in the formats prescribed separately for the employee and pensioner.\n [R.B's No.F(E)III/86/PN-1/17 of 27.3.1991]\nThe payment of family pension is to be made after expiry of one year from the date the \nfirst information report regarding the missing person is lodged with the police and the arrears \nof family pension shall also be payable from the date the pensioner is reported missing. \nHowever, before making payment, it is to be ensured that the payment of employee's pension \nto the pensioner has been discontinued from the date he has been reported missing. These \nrules are applicable to the Railway servant and also Railway pensioner.\n [R.B's No. F(E)III/86/PNI/17 of 16.1.92]\nThe above benefits may be sanctioned after observing the following formalities :\n(a) The family must lodge a report with the concerned police station and obtain a report \nthat the employee has not been traced after all efforts had been made by the police.\n(b) An Indemnity Bond should be taken from the nominee/dependents of the employees that \nall payments will be adjusted against the payments due to the employee in case he appears on \nthe scene and make any claim.\n [R.B's No.F(E)III-86/PN-1/17 of 19.9.1986]\n [No.F(E)III/98/PN-1/4 of 11.5.1989]\nThe benefit of family pension shall also be admissible to the post-retrial (married after \nretirement) spouses from the date following the date of death of the pensioner.\n [R.B’s No.F(E)III/89/PN-1/7 of 23.1.1991]\nThe following procedure may be followed for endorsement of family pension entitlement \nof post-retrial spouse in the pension payment order of Railway pensioners;\n(i)As and when a pensioner marries or remarries after retirement, he shall intimate the \nevent to the Head of Office who processed his pension papers at the time of his \nretirement. He shall also furnish along with his application, an attested copy of the \nmarriage certificate from Registrar/Gram Panchayat/District Magistrate in respect of his \npost-retirement marriage.\n(ii)The Head of the Office on receipt of the application mentioned above and after due \nverification where necessary forward the papers to the Accounts Officer who will in turn \narrange to forward these papers to the PPO issuing FA & CAO for issue of corrigendum \nPPO. While forwarding the papers to the Accounts Officer, the provision of clause \n801(10) of MRPR as amended \nvide Board's letter No. F(E)III/89/PNI/27 of 18.9.92 shall be kept in mind. When the \npensioner does not have any child or children from his previous spouse marriage, if any, \nthe post retrial spouse shall be eligible for full family pension. Where the pensioner has \nany eligible child or children from an other wife who is not alive, the family pension to \nthe post-retrial spouse and the child/children from the previous marriage will be \nauthorised in terms of para 801 (10) as amended vide Board's letter No.F(E)III/89/PNI/27 \n02 18.9.92.\n(iii)The corrigendum PPO shall be forwarded by the Accounts Officer to the concerned \npension disbursing agencies through FA & CAO. A copy of the corrigendum PPO shall \nalso be endorsed to the pensioner.\n(iv)As far as children, including those born after retirement are concerned, a fresh PPO \nwill be issued as and when the turn of each child for receipt of family pension is reached \nas at present.\n [R.B's.No.87/AC-II/21/33 of 29.9.1993]\nIn case son/daughter is invalid or physically crippled or disabled and unable to earn \nhe/she will be entitled for family pension for life time, provided they produce the required \ncertificate, once in three years and fulfil other conditions such as started earning and in case \n 36\n36", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 37, + "text": "of daughter not yet married. This certificate shall be evidenced by Medical Officer not below \nthe rank of Divisional Medical Officer. The condition of disability manifest before the \nretirement or death has been withdrawn. Pension is admissible to such children whether born \nbefore or after retirement from the marriage that took place even after retirement of railway \nservants.\n [R.B's No.F(E)III/86PNI/22 of 29.5.89 & 15.5.90]\nFamily Pension where more than one claimant :\nIt is payable as under -\n(i) Where the deceased Railway servant or pension is survived by more than one \nwidow, the pension will be paid to them in equal shares. On the death of a widow here \nshare of the pension will become payable to her eligible minor child.\nProvided that if the widow is not survived by any child, her share of the \nfamily pension shall not lapse but shall be payable to the other widows in equal shares, \nor if there is only one such other widow, full pension shall be payable to her.\n(ii) Where the deceased Railway servant is survived by a widow but has left behind \neligible child or children from other wife who is not alive, the eligible child or children \nshall be entitled to the share of \nfamily pension which the mother would have received if she had been alive at the time \nof death of Railway servant or pensioner. \nProvided that on the share of family pension payable to such a child or \nchildren or to a widows ceasing to be payable, such share or shares shall not lapse but \nshall be payable to the other widow or widow or the other child or children otherwise \neligible, in equal shares, or if there is only one widow or child, in full, to such widow or \nchild.\n [R.B's No.F(E)iii-89/PN_I/27 of 21.7.1992]\n(iii) Where the deceased Railway servant or pensioner is survived by a widow \nbut has left behind child or children from a divorced wife or wives such child or \nchildren if they satisfy other conditions of eligibility for the payment of family pension, \nshall be entitled to the share of family pension which the mother would have received at \nthe time of death of the Railway servant or pensioner had she not been divorced.(w.e.f. \n7.10.89). \nProvided that on the share or shares of family pension payable to such a \nchild or children or to a widow or widows easing to be payable, such share or shares \nshall not lapse but shall be payable to the other widow or widows and or to other child \nor children otherwise eligible, in equal shares, or if there is only one widow or child, in \nfull, to such widow or child.\n(iv) Except as provided in clause (I), (ii) & (iii) of sub-para, pension awarded \nunder the scheme will not be payable, to more than one member of family at the same \ntime. It will be payable first to widow widower and thereafter to minor children.\n [R.B's No.F(E)III/89/PN-I/27 of 18.9.1992]\nThe family pension entitlements of the absorbed Railway employees I the \nPublic Sector Undertaking Autonomous Bodies, shall be regulated as under :-\n(i) The absorbed employees shall have an option to be governed either by the family \npension scheme for Railways employees or by that of the P.S.Us./Autonomous Bodies but not \nfor both. However, the benefit for family pension scheme for Railway employees will be \navailable only to such of the absorbed employees who are permanent and have qualifying \nservice of not less than ten years, and\n(ii) The liability of the Railways in this regard will be frozen as on the date of permanent \nabsorption of the individual employee; that is to say, the amount of family pension payable \nwill be calculated with reference to the pay drawn and the rules in force on the date of \npermanent absorption.\n 37\n37", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 38, + "text": "The absorbed employees who opt for the Railway family pension scheme will have to \nseek exemption from the operation of the provisions of \"The Employees Family Pension \nScheme\", 1971 under section 17 (IC) of the \"Employees\" Provident Fund and Miscellaneous \nProvisions Act, 1952, wherever necessary. For this purpose, the concerned employees should \nsubmit a formal application for employers i.e., the concerned P.S.U.s./Autonomous Bodies. \nThe other terms and conditions stipulated in the various letters on the subject, which have \nnot been modified will continue to be operative. These orders shall take effect from 22.1.90.\nThe Railway employees absorbed in P.S.Us./Autonomous Bodies and who are in service \non this date will be eligible to exercise the option for being governed by Family Pension \nScheme for the Railway employees. The option shall be exercised within in a period of six \nmonths from the date of issue of this letter. Option once exercised shall be final.\n [R.B's No.F(E)III-90/PN-I/8 of 21.2.1990]\n(1) The existing terms and conditions of absorption of permanent Railway servants in :-\n(i) Central Public Sector Undertaking/Central Autonomous Bodies are regulated by the \ninstruction in Board's letter No. F(E) III/86/PNI/5 of 16.4.86 and F(E) III/84/PNI/4 of \n25.6.87, and\n(ii) State Public Sector Undertaking/State Autonomous Bodies/ Joint Sector Undertaking \nare regulated by the instructions contained in board's letter No. .F(E) III /92 / PNI /25 of \n16.3.93..\n(2) Permanent Railway servant who have rendered not less than 10 years qualifying \nservice under the Railways prior to their absorption and who have opted to receive pro-rata \npensionary benefits fort the service rendered under the Railways are entitled to exercise on of \nthe following two options :\n(a) To draw pro-rata monthly pension and death-cum retirement gratuity as admissible \nunder the relevant rules;\n (OR)\n(b) Pro-rata gratuity and lump sum amount in lieu of pension.\nThe existing terms and conditions had been reviewed and decided to modify to the extent \nas indicated below:\n(a) The existing facility of receiving capitalised value equivalent to 100% commutation of \npension on absorption is withdrawn.\n(b) The existing facility to draw pro-rata monthly pension from the date of absorption \n(with option to commute 1/3rd pension wherever admissible) shall continue to exist.\nThe above decision shall take effect from 10.7.1995 \nGrant of Pro-rata retirement benefits to the permanent Central Government/Railways \nemployees who are absorbed in the Nationalised Banks, General Insurance Corporations and \nits subsidiaries, are not entitled to count the service rendered in Government/Railways for the \npurpose of pension on absorption. Similarly, Central Government/Railways employees who \nhave rendered service in Nationalised Banks including the Reserve Bank of India and the \nState Bank and its subsidiaries as well as other financial institutions including life Insurance \nCorporation of India/General Insurance Corporation prior to their appointment in Central \nGovernment/Railways are also not entitled to count such service for the pensionary benefits \nunder Central Government/Railways. They are, however free to seek terminal benefits as \nadmissible under the relevant rules from the concerned Nationalised Banks etc.\n [R.B's No.F(E)III/95/PNI/14 of 4.9.95]\nIn the case of mad, lunatic, idiot and insane pensioners, when any sum is payable in \nrespect of pay, pension, gratuity or similar allowance to any person certified by a Magistrate \nto be such, the Government Officer under whose authority such sum would be payable may \npay so much of amount as he thinks fit to person having charge of such pension and may pay \nthe balance amount, if any, of such part thereof as he thinks on him, for the maintenance of \nsuch members of his family as are dependents on him, for the maintenance of such members \nof his family as are dependent on him, for maintenance.\n [R.B's No.99/AC-II-21/25 of 20.9.94] \n 38\n38", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 39, + "text": "Pension admissibility contains:-\nA) Service Gratuity and Pension.\nCalculation of Pension:-\n Basic pay on 1.6.97 = 5600 /-\n Pay on 1.6.98 = 5750/-\n Calculation as follows .\n ( 1 - 3 - 98 -- 1 - 12 - 98 )\n ( 5600 x 3 + ( 5750 x 7 ) ) ÷10 = 5705/-\nIf employees completed 33 years of service .\nPENSION = ( 5705 x 50 ) ÷ 100 = 2853 /-\nIf employees completed 30 years of service .\nPENSION = ( 5705 x 30 ) ÷ 33 = 2594 /-\nGRATUITY PAYMENTS\nThere are types of gratuity such as Retirement Gratuity and Death Gratuity.\nRetirement Gratuity : The Rly. Servant who had completed minimum 5 years of qualifying \nservice, the retirement gratuity should be paid equal to 1/4th of its emolument for every \ncompleted Six-month period.\n(e.g.) Rly. Servant who has completed 5 years of service .\n1) Emoluments means = basic pay + DA (20% as on the 16.9.93) for staff.\n2) Emoluments for running staff = basic Pay + 55% Running allowance + DA.\n Rly. Servant completed 5 years of service\n Emoluments (Basic Pay+DA) x 5 x 2 \nRetirement Gratuity = -------------------------------------\n 4 \n Emoluments\n = ------------------- x Every six monthly period completed\n 4\nThe retirement gratuity will be of a maximum of 16 ½ times of the emolument. The \nmaximum ceiling limit of Retirement gratuity will not exceed 3.5 lakhs .\nDeath Gratuity:- All the Rly. Servant permanent or temporary who were expired while in \nservice, the Death gratuity is payable in the following rates.\n1)Less than one year service = 2 times of emoluments.\n2) Upto 5 years = 6 times of emoluments.\n3) Upto 20 years = 12 times of emoluments.\n4) More than 20 years = Half emoluments for every 6 \n monthly period of qualifying \n service and to a max. of 16 ½ \n times of emoluments.\nDeath / Retirement Gratuity should be paid all members of the family eligible in equal \nshares.\na) Wife or wives in the case of male servant.\nb) Husband in case of Female servant.\nc) Sons \nd) Unmarried / widow daughters. Including Step and \n Adopted Children. Children of pre-deceased son. \ne) Father, \nf) Mother,\ng) Brother below the age of 18 years and unmarried or \n widow sisters (including stepbrother and sister ).\n 39\n39", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 40, + "text": "h) Married daughter.\ni) Children.\nCalculation of Gratuity: \nBasic Pay = 5750 /- + DA 1265 /- = 7015 /- (Emoluments)\nFor 33 years of service = ( 7015 x 66 x1) ÷ 4 = 115748/-\nFor 25 years of service = (7015 x 50 x 1) ÷ 4 = 87688 /-\nFor 22.5 years of service = (7015 x 45 x 1) ÷ 4 = 78919 /-\nExpired in service:\nFor 33 years of service = ( 7015 x 66 x1) ÷ 2 = 115748/-\nFor 25 years of service = (7015 x 50 x 1) ÷ 2 = 87688/- \nFor 22.5 years of service = (7015 x 45 x 1) ÷ 2 = 78919/- \nFor 8 years of service = 7015 x 1 2 = 84180 /-\nVOLUNTARY RETIREMENT.\nA Rly. Servant is permissible to take voluntary Retirement after a minimum qualifying \nservice of 20 years.\nIn the case of Rly. Servant will be given weightage of Max. 5 years.\nRly. Servant, who seeks V/Retirement, he should give an application in writing before \nthree-month .The weaightage given to Rly. Servant is not for calculation of pension.\nChapter 11.Staff Welfare\nQue.:-What do you mean by staff welfare ?\nIndian Railway or any Rly. is being run on Commercial basis. Since being a government \nundertaking it is the moral duties of the government to fulfil social obligation towards its \nemployees in order to a good human relations between the employees and the employer. The \nsocial obligations is known as staff welfare.\nQue:-Who is looking after the staff welfare ? \nAbove all the personnel functions staff welfare is also key functions of Personnel \nManagement. Chief Personnel Officer is the key part of management in Head quarter of any \n& Zonal Rly. and he is assisted by a Personnel Officer (Labour & Welfare ) is posted and \nassisted by Welfare Inspector, Co. Operative Inspector and Personnel Inspector.\nIn divisional levels this is functioning under the guidance of Sr. DPO., DPO and APOs. \nand Welfare Inspector, / Personnel Inspector and Co. Op. Inspectors and working directly \nunder Asstt. Personnel Officer in the divisional level. There is a separate Personnel officer \nattached to workshop also. \nQue.:-What are the Activities of the staff welfare organization.?\n1. Provision of Rly. institutes & clubs.\n2. Provision of schooling facilities.\n3. Grant of AIDs.\n4. Educational assistance.\n5. Provision of Holiday homes.\n6. Scouts & Guides.\n7. Provision of Canteens.\n 40\n40", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 41, + "text": "8. Handicraft Centers/ and vocational Training Centers.\n9. Provision of Co-operative Societies.\n10. Mobile libraries.\n11. Medical facilities.\n12. Staff Benefit Fund.\nQue.:-What are the duties of Welfare Inspectors ?\n1) It is the duties of Personnel/Welfare Inspector to contact labors in the work place at \nleast once in a week to get the grievances of the staff and to be solved after contacting \nrequired officer.\n2) It is the duty of W.I. to educate the labors about the their rights.\n3) Has to explain about various staff welfare schemas and also help them to improve \ntheir living conditions as well as working systems.\n4) To supervise various welfare activities such as Co-operative societies, Canteens, Child \nWelfare Sports activities, welfare centers, Adult Education and to conduct holiday \ncamps.\n5) To help labors by means of medical helps and to arrange Medical camps\n6) To visit Rly. Colonies and inspect sanitation, water problems, light facilities and also \nmaintenance of Rly. Qtrs.\n7) To help Retiring staff in getting retirement, settlements, Pension.\n8) To help and solve all the matters of staff benefit fund.\n9) To inspect stations, Sheds.\n10) To arrange Drama, shows.\nFilm shows regarding staff welfare.\nQue.:-What are the duties of Personnel Inspectors ?\n1) He should inspect all the Registers of Overtime, Hours of Employment Regulations, \nand Rosters.\n2) In PNM meeting they should assist D.P.O. in all means.\n3) They should ensure of names of staff retiring are published.\n4) To attend courts.\n5) To assist Personnel Officers.\nRailway Institutes & Clubs :\nAll working employees are entitled to become a Member of a Institute. It may be \nprovided as Sr. or Junior institute and should cover large number of members. If there are \nmore members there can be separate institutes for Artisans staff. Swimming Pool can be \nattached to the Institute or Clubs and also children's park should be provided in all institutes. \nThe administration will bear the first cost of the building, cost of Electrical installations, with \nfurniture, roads, fences, tennis courts and play grounds. There should be elected body for \neach institutes and it should be observed by Welfare Inspector.\nEducational Assistance Reimbursement of Tuition Fees and Hostel subsidy :-\nThe Rly. Servant with out with not less than 3 year's service is eligible for the assistance \nfor education of the children. \"(Rly. service Educational Assistance) order 1988\". This order \nwas implemented on 1.10.1988.\nThe educational assistance is eligible for those children are studying away the station at \nwhere he posted or residing , where there is no school at the required standard is not available \nat the station. Children studying upto XII are eligible for the Allowance Rs. 100 P.M.\n [RB's No. E(W)/83 AL.12-8 of 6.2.84.]\nReimbursement of Tuition Fee :\nRevised Rate w.e.f. 1.8.1997\n1) Upto X Std- Rs.40/-PM.\n 41\n41", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 42, + "text": "2) XI to XII -Rs.50/-PM.\n3) Class I to XII physically handicapped- Rs.100/- PM.\n Hostel subsidy :- \nA Rly. servant shall be eligible of a Hostel subsidy at the rate of Rs.300/- P.M. per child if \nbecause of his transfer he is compelled to keep the children in the hostel of a school way from \nthe station where he is posted or residing.\nIf a Rly servant is getting educational allowance so he is not eligible for Hostel subsidy. For \nHostel subsidy age limit is 54 yrs - 20 yrs. only.\nAssistance are available to those who are having 3 children, who were born upto \n31.12.1987 and is allowance only for two who were born after 31.12.1987 \n [RB No. E(W)/98/Ed-2/8-9.9.98.]\nProvision of Holiday Homes :\nHoliday homes of higher type and lower types are established by Rly. charges for serving \nRly. staff.\n1) Group A & B staff -Rs. 10/- per suit per day\n2) Group C staff -Rs. 5/- per day\n3) Group D -Rs.2/- per day\nFor retired Rly. servants :-\nGroup D - Rs 5/- per day\nGroup C - Rs 10 \" \"\nOfficers - Rs.15 \" \"\n [RB No.. E(W)/87-WE-2-4-27-7-1988.]\n \nSupply of Uniforms to Primary school Children :-\nThree sets of terricot uniform in lieu of 3 sets of Khadi uniform are eligible to the \nstudents studying in Rly. Primary School.\nThe pay limit for the supply of concession of supply of school uniform to the students \nstudying in Rly. school is raised to Rs.500 /- P.M. Rate of uniform is Rs.135/-per set.\nRly. servants including Trainees, and Apprentices who are joined in scouts/guides of Rly. \nState Associations may be granted 30 days Spl. casual leave in a calendar year for attending \nTraining Camps or rallies. No. TA/DA are eligible for those attending camps.\nProvision of Canteens :-\nTypes of Canteens :-\na) Statutory (b) Non Statutory\n a) Statutory Canteens : The provision of section 46 of the factory act 1948 Rly. \nadministration should set up Rly. Canteen, which are governed by Factory Act and employees \nshould more than 250 members. such canteens are to be strictly adhered to the Rules framed \nby State Govt. (Sec.2) of the Act to constitute Managing Committee of Canteen that also \nsome representation from workers.\n b)Non Statutory :- The Administration should take steps to develop Canteens by \nencouraging co-operative basis. If the Canteen is run by Co-operative Society there should \nover all control of Rly. administration. There should be an elected body consists of \nChairman, Secretary and a Managing Committee\nLoans for the initial capital may be sanctioned from the Staff Benefit Fund and the loan \nshould be repaid in Installments.\nQue.:-Where are Canteens to be provided ?\na) Canteens should be provided at the places where large no. of Rly. Staff are working such \nas workshop, sheds, large station and yards. \n 42\n42", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 43, + "text": "b) If Rly. staff where the strength is below 25, Tiffins should be provided. The Regular \nCanteen can be provided where more than 100 staff or more.\nc) For providing of new canteens, should get approval from Rly.\nHandicraft Centers/Vocation Training Center :-\nHandicraft Centers are to be provided for the benefit of Women members of Rly. family \nin handicraft such as weaving, knitting, spinning and tailoring of garments during their spare \ntime in order to learn the trade.\na)The expenditure for the schemes should be not from FBF.\nb)Accommodation should be provided in spare Rly. building free of Rent.\nc)The charges for electricity and should be met by Rly. and if Institute governs the Center, \nthis institute will bear the cost.\nd)Rly. Administration should encourage such centers by placing orders for supply and \nfabrication of articles required by Rly.\nVOCATIONAL TRAINING CENTER. \nThis center can be provided where suitable spaces is there to conduct classes to unskilled \n,skilled Rly. workers and also wards of Rly. Servant.\nThe technical training center classes should be separately be conducted for Rly. employee \nand children of Rly. employee including dependents.\nOutsiders are not permitted to attend the said classes.\nRailway employees are not permitted on duty hours.\nThe welfare Inspector will be nominated as Secretary of the above said Training Centers.\nThere would not be any prefer in promotion for the above said Training Centers. \nEfficient Sr. Supervisors and Artisan staff can be permitted to conduct classes as \ninstructors on payment of Honorarium.\nCo-operative Society :\nQue.:-What are the type of societies ?\n1) Consumer Co-operative Society.\n2) Co-operative Credit Society and Bank.\n3) Co-operative Housing Society.\nCONSUMMERS CO.OPERATIVE SOCIETY\nThis society is nothing but a Retail Shop to provide consumers items at reasonable prices \nat minimum profit. This society would be controlled by Chief Personnel Officers at Head \nQtrs. levels as well Sr. Divl. Personnel Officers at Divisional levels and will be assisted by \nAsst. Personnel Officer and Welfare Inspector. It is the duty of Welfare Inspector to report \nMonthly Report to Chief Personnel Officer through D.P.O.\nQue.:-What are the provisions done by Rly ?\n1) If the Rly. Co-operative societies are running as FAIR PRICE SHOP,(Rationing items), \nthe Rent will be charged on nominal rent of Rs.one per month (Plus actual Municipal \nTaxes).\n2) It is the duty of Administration to provide Electrification and water connections.\n3) The Electrical charges and water charges are only on concessional rates.\n4) Special passes and Spl. Casual leaves are permissible for managing committee.\n5) Rly. should provide land for constructing in Co-operative Society.\nThe Rlys. are to provide grant for matching share capitals upto Rs.2500/- Also to provide \nFinance Assistance upto Rs.10,000/- to each society on Interest bearing scheme and would be \nrepayable by society.\n 43\n43", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 44, + "text": "Membership :-Retired Rly. servants or Ex.Rly. servants should not be permitted or continue \nbeyond the limited period. Only serving Rly. servants will be eligible to become members \nafter purchasing a share or more of Rs.10/- each share.\nManagement :-Till the share holders should by means of conducting elections, to elect one \nChairman, Secretary and Treasurers and Board of Directors. The Co-operative Society will be \nobserved by Co-operative Registrar.\nSTAFF BENEFIT FUND :-\nThe staff benefit fund consists of a Committee at the h.q.'s level.\n1) Chairman - C.P.O\n2) Members - C.M.O. , Dy. GM, 12 selected members from the Union.\n3) Secretary - Labour Welfare/Personnel Officer.\n \nDistribution of Fund:- \n1) To aid education of staff and children.\n2) Relief of distress among the staff and family members.\n3) Recreation and Amusement of staff and their children.\n4) For the following purposes the staff Benefit Fund are being utilized :\nI) Education :-\n1) For Technical education, Engineering, Medical and Scientific courses.\n2) Assistance to those who are doing chartered Accountancy and Cost Accountancy.\n3) For operating vocational Training Centers.\n4) Scholarships on merit and technical courses.\n5) Assistance to Dumb and blind children.\nII) Recreation:-\n1) Loan to Canteen.\n2) Mid day meals to children in Primary schools.\n3) Supply of Uniforms to Primary School children of Rly. Schools.\n4) Supply of books to Rly.hospitals for indoor patients.\n5) Grant to Institutes, sports club, children camp, and Cultural activities.\nRecreation Centers and Mahila Samities.\nIII) Sickness and Distress Relief :-\n1) For funerals expenses for low paid staff.\n2) Assistance to those who are suffering from TB, Cancer, mental disease, when they are on \nleaves without pay.\n3) For purchase of artificial limbs, spectacles.\n4) Running homeopathic dispensaries.\n5) Distress due to natural calamities.\n6) Provision of Library and mobile library.\n7) Railway reading rooms.\n 44\n44", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 45, + "text": "Chapter 12. SAFETY CATEGORIES\nStaff under safety categories in.\nA) Operating dept .\n1) Transportation inspectors.\n2) ASMs/Cabin ASM/Station supdtt./SMS/Dy.SS/.\n3) Guards\n4) Yard Masters/AYMs/Yard Foremen.\n5) Switchmen and Shunting Jamadars.\n6) Section controllers/Dy.chief controllers/ chief \n controller\n7) Safety controllers/Safety inspector.\nB) Engineering Department : \n1) Bridge inspectors.\n2) Permanent way inspectors\n3) Asst. Foreman cum Operator (Plasmatic Tie Tamping).\n4) Operator- Cum Chargeman (Tie Tamping).\n5) Section Mate,Keyman , P.Way Mistry.\n6) Asst. Shop Supdtt. (Bridge workshop)\nC) Signal & Telecommunication :- \n1) Signal Inspectors\n2) ESM and Mistries\n3) Asst. Shop Supdtt. (Axle counter production and Inspection)\n(Production & overhauling of relays) \n(Tokenless block instrument testing)\n4) Relay inspectors.\nA) MECHNICAL 7 ELECTRICAL DEPTT.\n1) Drivers/Asstt.Drivers/Diesel Asst./Motorman.\n Tower wagon driver/Motor Trolley driver.\n2) Loco Foreman / Asstt.Locoforeman / Elec.Foreman Asst. shop \nSupdtt.Chargeman.\n (OHE-S/Stn/Remote Control - Loco Train Lighting - Air-\nconditioning(Coach)Mech, Asstt. Mech.Foreman/Chargeman,Loco-EMU-\nRunning Sheds.\n 3) Carriage / Wagon foreman\n5) Loco Inspectors/Driving Instructors.\n6) Train Examiners.\n7) Shunters.\n8) Carriage and wagon inspector.\n9) Power controllers (Traction - Traction Loco Controller - Traction SS - Operators).\n10) Traction Foreman.\n11) Engine Examiners / Lubricating Supervisor.\n12) Boiler Inspector - Boiler Foreman.\n13) Asst. Shop Supditt. Train Lighting & Air conditioning.\n14) Safety inspectors.\n 45\n45", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 46, + "text": "15) Laboratory Supdtt.\n16) Loco fitters (All Deptts) & Welders.\nReservation post for Handicapped persons :-\n3% of total vacancies would be reserved for handicapped persons. This category includes \nDeaf, Blind, and Orthpaedically handicapped persons. 1% of the vacancy is reserved for each \nof these category.\nPhysically handicapped persons who are SC/ST, Ex.Serviceman - or dependents of those \nkilled in action should be given special preference in C & D ground.\n[RB NO. E(NG)/111/77/RC/54 - 8.1.78.]\nSpl. Concession for Handicapped Persons.\n1. Age relaxation upto 10 years/Extra 5 years for SC/ST persons.\n2. Only pass in SSC will do instead of minimum 50% in the normal cases.\n3. Exemption from payment of application and Exam. fees.\n4. Exempt from Medical Examinations.\n5. Exempt from typing qualification for appointment to clerical post if they are found \notherwise qualified and are certified and are unable to type.\nNominated Category for Handicapped Persons :-\nAdministration : Office Clerks, Typists. Steno-Peons and \n Safaiwala.\nOperating/Commercial - Telegraph Signalers, Commercial \n Clerks. \nCooks, Bearers-Indicator Boys. \nWaterman - Waiting Room Bearer and Running room \n attendants.\nMechanics - Coreman-Trimeers, Tracers-Machine \n Operators,\nPump drivers.- \nEngineering - Tracers - Painters.\nReservation quotas of Ex-Serviceman :-\n20% quota reserved for group \"D\".\n10% quota reserved for group \"C\".\nUpper age limit for their recruitment for Apprentice is 40.\nReservation of sport persons :-\n30% of the total vacancy is reserved for sport persons in group \"C\" and the respect of \ngroup \"D\". The total recruitment quota for recruitment of sports persons would be as per \nadvertisement.\nRecruitment of Ex-servicemen against vacancy in-group \"C\" post will be centralized in H. \nQtr. Office in respect of each Zonal Rlys. The recruitment would be done by only one Rly. \nRecruitment Board for each of the zonal railways.\nChapter13. Special Pay \nSpecial pay for announcing work :-Spl. pay would be eligible for those who are doing \nannouncing work in addition to their normal duties. Rs.100/- PM./\na) Spl. pay are entitled for full time announcers Rs. 100/- \n (1.8.1997)\n1) Spl. pay of Rs….PM to Gateman of Engg.deptt.\n2) Spl. pay of Rs….PM to PWI Gr.III.\n 46\n46", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 47, + "text": "Spl. pay is entitled Rs.200/- PM.\n3) Health inspectors Rs.200/- PM\n4) Instructors in Training schools - Rs.15% of Basic pay.\n5) Teachers doing library work - Rs.140.PM.\n6) Clerks doing library work - RS.140 PM.\n7) CTIs/TTRs in flying squads. - Rs. 100/- PM.\n8) Train Supdtt. - Rs.300/- PM.\nSpecial pay to power controllers / Crew controllers :-\nWith effect from 1.8.97 Power controllers and crew controllers are entitled for Spl. pay of \nRs.450/ PM.\n[RB No.E(P&A)11/98/FE-2/7.9.3.99]\n ---------------------------\n \nChapter 14. APPOINMENTS\nOn compassionate ground :-\nThe following posts are exclusively reserved for appointment on compassionate ground \nfor the widows.\na) Water woman.\nb) Retiring room attendants.\nc) Cinder Picking woman.\nd) Sweeper woman.\ne) C & W Khalasis.\nf) Ayah and female sanitary cleaner in hospitals and \n schools.\ng) Khalasis in PWI & IOW.\nQue.:-What is the educational qualification required for compassionate ground \nappointment ?.\nFor group \"D\" post, minimum qualification is 8th Std. for Son. For widows no restriction \nof education qualification.\nWoman posted in the PWI dept. should be posted in the gangs, which are located in the \nstation limit or yards.\nFor compassionate group appointments for group C post the qualification should be judged \nand recorded by the screening committee. Final offer of appointments will however be \nsubjected to availability of vacancies, passing of Medical exam. and production of necessary \ncertificates.\n Appointments on compassionate ground are offered in the following types of cases.\n1) Dependents of Rly employees who are in harness, as a result of Rly. accident.\n2) Dependents of Rly. employees who die or permanently crippled in the course of duty.\n3) Dependents of Rly. employees who die in harness while in service before retirement or \nmedically incapacitated.\n4) Dependents of RLY. employees whose whereabouts are not known for a period of 7 years \nand the settlement dues are paid to the family on this account.\n5) Dependents of Rly. employees who was developed serious diseases like heart disease of \ncancer as well as medically unfit for any cadre of post.\nCasual laborers could also be given appointments on compassionate ground but they should \nbe offered as casual labor only.\n 47\n47", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 48, + "text": "For appointment In-Group 'C' post suitability test (Written test and Viva-voce) should be \ncompleted in one day only.\nAppointment on compassionate ground to the adopted son/Daughters is in be legible in \nthe following conditions :-\n1) The satisfactory legal adoption proof should be submitted.\n2) The adoption must be reconigised.\n3) The legal adoption process should be completed and should be proper valid before the \ndeath or medically unfit \n [RB.NO.E(NG)11 86/RG-1/1 policy dt. 20.5.1988. ] \nCompassionate appointments in the case of missing Railway employees. Conditions for \ncompassionate appointments.\n1) FIR should be lodged in the police station in the case of missing Rly.employees and if the \nmissing employee is traceable and the competent authority should feel the case is \ngenuine.\n2) The length or remaining service is more than two years and should not committed any \nfraud or joined any terrorist.\n3) Appointment in the case of missing employee should not be a matter of right, and \nsubjected to fulfillment of all conditions including availability of vacancy. \n4) Police investigation proof should be submitted and the decision would be considered on \nGM level only.\n5) The service of widow/ward should be terminated in the case when missing RLY. \nemployee becomes available.\n6) The above will be applicable to the wards/widow of casual labor of temporary status.\nA bother-in-law (Wife's brother) or a son-in-law are not eligible for appointment on \ncompassionate ground.\nAuthority competent to make appointment on compassionate ground.\nThe General Manager is having the power to appoint on compassionate ground. However \nGM re-delegate this power to DRM and HOD's of different units.\nIn the cases of appointments in-group 'C' posts, the power may be exercised by the CPO \nin consultation with the Head of Dept. concerned.\nFor group D posts DRM can make such appointments.\nChapter 15. MEDICAL TREATMENT\nQue.:-What are the Institutions identified which are having facilities for specialties \ntreatment?\nA) By pass coronary surgery :- \n1) SRLY H.Q. Hospital - Perambur (Madras).\n2) Christian Med.Collage and Hospitals - Vellore-Tamil \n Nadu.\n3) KEM Hospital - Bombay.\n4) Jaslok Hospital.\n5) Bombay Hospital.\n6) Kasturba Hospital - Bhopal.\n7) ShreeChitra Tirunal Instituate of Medical Sciences and \n 48\n48", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 49, + "text": "Technology -Trivendrum.\nB) Kidney Transport :- \n1) Christian Medical college -Velour.\n2) All India Institute of Medical Science - New Delhi.\n3) Post Graduate Institute - Chandigarh.\n4) Jaslok Hospital - Bombay\nC) Blood Cancer :- \n1) S.Rly. H.Q. Hospital - Perambur - Madras.\n2) Christian Medical Collage - Velour.\n3) KEM Hospital - Bombay\n4) All India Medical Institute & Science - New Delhi\n5) Bombay Hospital.\n6) G.B. Gant Hospital - New Delhi.\n7) Shree Chitra Tirnual Institute of Medical Science - Trivendrum.\n8) Postgraduate institute - Chandigarh.\n9) SSKM & Hospital - Calcutta.\n10) Samaritan Hospital - Alwaye - Kerala.\n11) Kasturba Hospital - Bhopal.\n12) N.M. Wadia Institute of Cardiology - Pune.\nFamily members eligible for medical treatment .\n1) Wife of a RLY. employee whether serving or not serving.\n2) Husband of a RLY. employee.\n3) Sons upto the age of 21 years.\n4) Unmarried daughters (no age limit)\n5) Married daughters under 18 yrs.\n6) Widowed daughters (no age limit).\n7) Step sons - Stepdaughters, Mother and stepmother, unmarried widowed sisters if father is \nnot alive.\nMedical treatment facilities would be available free of charge to all the RLY. employees, \nand their family members and dependents relatives for all groups (ABCD). whether they are \npermanent or even temporary.\nMedical treatment can be available to the staff of Consumer Co-operative society, Staff \nBenefit Fund Committee, RLY. Institute, RLY. officers club and Station committee.\nThe family members of the above said quasi organization would be available only out \ndoor facilities. Also apprentices in RLY. are also eligible for free of charge medical facilities \n(only employees).\nGovt. RLY. Police staff are eligible free of charge medical facilities indoor as well as \noutdoor.\nAll casual laborers are eligible for free medical facilities.\nContractors laborers are eligible for free medical treatment, but not their members.\nRLY. contractors and their staff are not eligible for free medical treatment.\nLicensed Porters (only for self) are eligible for free medical treatment. (out door \ntreatment) but the routine laboratory and x-ray Examination they will be charged. \nWhen a Licensed porter got injured while working they will be permitted as Indoor \npatients, after on certification from StationMaster. The dist charges will not be available.\nEven bonafide licensed porter will be issued Medical Identity card mentioning the names of \nfamily members such as wife and dependents. But he should handover medical identity card \nwhenever he got transfer or terminated from service.\n 49\n49", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 50, + "text": "REIMBURSEMENT :-\nIn an emergency an RLY. employees has to go for treatment to a government hospital or \na reconigsed hospitals or dispensary, without prior consultation with the authorized medical \nattendant, the reimbursement of the expenses incurred, to the extent other wise permissible, \nwill be permitted. This circumstance should be examined carefully by the competent Med. \nauthority. Only GM/AGM and upto Rs. 50,000/- in each case would sanction the \nreimbursement of the medical expenses, which were incurred in emergency without proper \nprior commission as well as reference from authorized medical attendant.\nThe Reimbursement upto Rs.3000/- in the event of special laboratory tests in private \ninstitutions, for which tests facilities are not exist in the Rly. hospitals, provided this test \nwould be permitted, after advance of authorized medical attendant. These powers would be \nexercised by CMS personally and no lower level officer can be permitted to sanction the \namount.\nThe GM could sanction advance payment upto the reimbursable portion of the anticipated \ncost the treatment or upto one lakh which is less on the recommendation of C.M.D. and \nconcurrence would be made by FA & CAO/DRMs of the division could be sanctioned \nadvance payment subject to the limitation stipulated with the concurrence of divisional \nfinance after recommendation of Sr.MS/CMS in charge of Divisional Hospitals.\nMedical treatment facility of retired employees. There are also schemes \nfor/employees/retired.\n1) Retired employees contributory scheme - Introduced in 1966.\n2) Retired employee liberalized health scheme - Introduced in 1986.\nThe retired employees contributory scheme are limited to out door treatment only at \nany of the nominated hospitals. They will be given the following facilities :-\n1) Free medicines in the case of outdoor patients.\n2) Routine examining of blood and stools.\n3) For indoor treatment they will be charged at a rate of 10% of the charges laid down to \noutsiders.\nThe charges are as follows w.e.f. 1.1.2000.\nGroup D - Rs.9/- per month- Advance payment for 6 months or 1 years.\n C - Rs. 18/- per month.\n B - Rs.27/- per month.\n A - Rs.36/- per month.\n \nChapter 16. INDUSTRIAL RELATIONS\n \n Industrial Relations have assumed a great importance because of its far-reaching \nconsequences on production, productivity and economy of the country. Indian Railways are a \nlabour intensive industry having a work force of nearly 16 lakhs employees. The output of \nthis large work force depends directly on the degree of industrial peace prevailing. This to \noptimise the output of the work force, industrial peace is very essential.\n In order to achieve optimum productivity, every organisation has to avoid any dispute with \nits employees or resolve it as early as possible. \n Two Federations of Union viz. All Indian Railwaymen's\nFederation (AIRF) and 'National Federation of Indian Railwaymen'(NFIR) have been \nRecognised by the Ministry of Railways. All the Railway units of the Unions affiliated to \nthese Federations have also been given recognition.\n With a view to maintain contact with the labour, to resolve disputes and differences \nbetween labour and management and to maintain healthy industrial relations, the Railway \nBoard have set up Machinery to have a periodical dialogue with both the Recognised \nFederations which is called 'Permanent Negotiating Machinery'. \n 50\n50", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 51, + "text": "PERMANENT NEGOTISTING MACHINERY\n \n Que.: When was PNM was formed ?\nIt was formed in the year 1951 and was founded by Shri V.V.Giri, when Shri Lal Bahadur \nShastri was a Rly. Minister. To solve the problems of differences arises between Labors \n(organized) and the administration, the Machinery was formed.\nThere are 3 tier systems arranged to conduct Machinery and they are :-\n1) Rly. Level.\n2) Railway Board level.\n3) Ad.hoc Tribunal levels.\nRailway level :\nUnder the Rly.level there are four committee\n1) H.Q. levels. \n2) Divisional levels.\n3) Stores.\n4) Workshop.\n In H.Q. levels GM will be the Chairman, Personnel Officer (L&W) will be the secretary. \nDuration of meeting will be once in 3 months 3 meetings will be conducted separately with \nTwo recognized unions (NRMU & CRMS).\n In divisional levels, DRM will be the Chairman and Sr. DPO will the secretary. Once in \na Month (Main and Review will be separately).\n In stores levels, DCOS and APO(Stores) as well as Dy. CME and Personnel Officer - \nworkshop will be the Chairman and secretary.\nRailway Board Level :-\nMeeting will be conducted separately with AIRF as well as NFIR. with RLY. Board once \nin 3 months. There will be no limit for subjects as well as no. of union members. It should be \ndecided by Dy. Director(Estt.).Staff Member be Chairman. Dy.Director (Estt) be Secretary.\nThe Tribunal Level :-\nCases in which agreement is not reached between the Federation and the Railway Board \nand the matters are of sufficient importance, are referred to an ad hoc Railway Tribunal \ncomposed of, representative from the Railway Administration and labour presided over by \nthe neutral Chairmen.\nJoint Consultative Machinery :-\nWith the view to have harmonious relation between the Government (Employer ) and its \nemployee in the matter of common concern , a machinery has been established which is \nknown as \"Joint Consultative Machinery (JCM) \" It may discuss matters relating to \nconditions of services , welfare of the employees, and improvements of efficiency and \nstandard of work. JCM works on three tiers, viz. National Council, Departmental Council and \nthe Regional Council.\nNational Council: National Council deals with matters affecting all Central Government \nemployees (including railwaymen) such as remuneration, dearness allowance and pay of \ncertain common categories. National Council is headed by the Cabinet Secretary and consists \nof members from official side as well as from staff side.\n 51\n51", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 52, + "text": "Departmental Council: Departmental Council deals with matters affecting the staff in a \nparticular Ministry. The Departmental Council on Railways is headed by Member Staff \nconsisting of members from official side as well as members from both the Federations.\n Matters, which remain, unsolved at the National Council or the Departmental Council are \nreferred to Compulsory Arbitration from each Council independently. Recommendations of \nthe Board of Arbitration are binding on both sides.\nPAYMENT OF WAGES ACT 1936\nThis act aims for securing prompted regular payment of wages without any arbitrary \ndeductions to certain class of persons employed in Industrial Establishment including \nrailways either directly or through a sub contractor, by a person fulfilling agreement with Rly. \nand employing or having employed 20 or more persons on any day of the proceeding 12 \nmonths. It applies to employees whose wages are less than 1600 per month.\nWages means all remuneration's capable of being expressed, in terms of money, which \nwould be, payable to the employed person upon fulfillment of the contract expressed and \nimplied :-\n The employer shall fix wage period, which shall not exceed one month in any case.\na) The wages should be paid in working day.\nb) All the wages to be paid in current coins and currency notes but not in kind .\nc) The wages should be paid where less than 1000 persons within 7 days of the expiry of \nwage period.\nd) Where more than 1000 persons, are there it should be before the expiry of 10th Day.\ne) When the employment is terminated by employer he shall be paid before the expiry of the \n2nd day after termination.\n \n Factories Act 1948 :-\nFactories act was been given with effect from 1.4.49. If regularizes the labor is factories \nand also regulates the various obligations that on \"Occupies\" has to fulfil is connection with \nHealth, welfare, safety, hours of employment, leave overtime, rest for workers working in a \nfactory. This Act applies to All Rly. workshops and production units, but does not extend to \nLocosheds and C & W departments. No woman worker should be permitted to work between \n7 P.M. to 6 A.M. Children below 15 Yrs. should not be employed in a factory or workshop. \nFactory:- It is a place where manufacturing operations are carried out with or power, \nwhere on 10 more workers are working any day the proceeding 12 months and any part of \nwhich manufacturing process is being carried out with the aid of power or any promises \nwhere on 20 or more workers are working on any day proceeding 12 months.\n The factory should be registered with state Govt. and license obtained. \"Occupies\" means \nthe person who has ultimate contract over the affairs of factory and in case where such affairs \nare entrusted to a manager such manager shall be demand as occupies. \nIn Rly. occupies shall be appointed by central Govt. (Member of RLY.) \n \n Factories Act -1948 (Some Definations)\nWorker :- Who is a person employed is a factory of any kind of work.\nManufacturing operation/process : Means any process for making, altering, repairing, \nornamenting, finishing, packing, oiling washing, cleaning, breaking up. \nInspection : Inspections are made by inspectors appointed by staff Govt. It is the duty of \nthe inspection to make attentions of the health safety welfare rest, holidays, OT, manufacture \nof book and forms.\n 52\n52", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 53, + "text": "Hours of Work : 48 Hrs. is a week, 9 Hrs. per day . O.T. should be paid twice his \nordering rate of wages and not more there 60 Hrs. in a Quarter.\nRest Day : If a workers worker continuously for 6 days shall be entitled Rest for one day. \nIf Rest cannot be given then 11th Day must be granted Rest. Rest can be granted 3 days in \nadvance or 3 days later. Normally rest is on Sunday. \nNotice Board Display :\n1) Specially No. of workers working\n2) Notice of Rest day.\n3) Notice of Holiday and cancellation if any\n4) Duty rosters\n5) Abstract Act\n6) Notice for payment\n7) Name and address of Inspection and Doctor.\nMinimum Wages Act 1948 :\nThis act aims securing minimum rates of wages is those categories of employment whose \nwages are low, in order to prevent exploitation of unorganized labor. If applied to persons \nengaged on schedule employment on specified class of work is respect of which minimum \nwages have been fixed. So far Rly are concerned this act applies to workmen employed.\n1) On road constructions and Building.\n2) In stone breaking.\n3) In loading and unloading.\n4) Casual labor employed in PWI.\n Central Govt. Ministry of Labor fixes minimum wages admissible to workers in the various \nlocations.\n5) Method of Payment : 1) Monthly\n 2) 7th day\n2 3)10th day\nWorkmen's Compensation Act 1923\nThis Act is enforced with effect from 1.7.1924 and under this Act, an employer is liable to \ndischarge his liability to a workman or his dependents, as the case may be, for accident \narising out of and with course of his employment on account of either death or disablement. \nWhether permanent total or parties or temporary.\nThe Act was amended in the year 1984 and came into force from 1.7.84. If provides \nsubstantial enhancement of compensation payable to workmen in the care of death or \ndisability caused by accident or an occupational disease and also provides for the payment of \nCompensation in terms of percentage of monthly wage linked to the age of workman at the \ntime that disablement or death bared on the rates specified. The limit on monthly salary for \nentitlement has also been removed. Also Rly men engaged to supervise workmen are covered \nunder this provision.\nApplication :- It is applicable to RLY. Servants including causes labor and also labor \nemployed by the contractors for carrying out works but excluding those employed is the \nadministrative, District, and divisional offices and those mentioned in schedule II of the act \nand will not also apply to the staff in foreign territories.\nHours of Employment Regulations Says If ‘REST’ due is suspended temporarily, The \nRest in lieu may be granted within 14 Days for incentive category staff and with is one month \nto other categories of staff.\nThe following cases are excluded for the payment of compensation:\n1) Injury does not result is total or partial disablement for the period not exceeding three \ndays.\n 53\n53", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 54, + "text": "2) Workman having been at the time of accident under the influence of drink or drug.\n3) Willful disobedience of workman in order expressively given, or to a rule expressively \nframed for the purposes of securing Safety and not used Safety Devices.\nThere are four schedules appended under this Act :-\nSchedule I -This schedule indicates the percentage of loss of earning capacity of a workman \nfor the various types of injuries, deemed result is permanent total and partial disablement and \naccordingly the payments of compensation is arranged on the certification of Railway Doctor. \nSchedule II -This schedule indicates the list of persons who are included in the category of \nworkman and entitles for the payment of compensation under the Act.\nSchedule III-This schedule indicates the list of occupational diseases. \nSchedule IV-This schedule indicates the amount of compensation payable to workman, is the \nevent of death, permanent total disablement and half monthly payment of compensation for \ntemporary disablement on the basis of monthly wages .\nRailway Doctor would indicate the percentage of payment for permanent disablement.\nTrade Union Act 1926 :-\n1) The trade union act was passed in 1926 and implemented from 1.6.1927.\n2) Any seven or more persons can form an association .\n3) Union may raise fund on only voluntary basis to promote social activity.\nQue.:-What are the factors for the growth of union?\na) Due to First World War economic condition gone downwards.\nb) Due to growth of many leaders and social reformers.\nc) Due to International Labour office in India.\nd) Success of Russian Revolutions.\nIndustrial Disputes Act - 1947\n This is a comprehensive law for the investigation and settlement of industrial disputes \nand cover all RLY. workmen other than those employed is supervisory capacity whose wages \nexecs 1600 Per month. An industrial dispute under this act means any dispute or difference \nbetween employers and employees and between employers and workmen or between \nworkmen to workmen which is connected with the employment or non employment or the \nterms of employment or with the condition of labor, of any person. Among other matters, this \nact deals with reference of industrial disputes or Arbitration or Tribunals, Strikes, and \nLockouts, Conditions of employment of the workmen. \nIndustrial Disputes Act :-\nUnder this act, the following authorities have been set up for the investigation and \nsettlement of industrial disputes.\n1) Works Committee :- Where one hundred or more workmen are employed, in any \nindustrial belt, such committee consisted of equal representative of workers and \nmanagement.\n2) Conciliation officer :- He is appointed in order to Mediate in and promotes the settlement \nof industrial dispute. \n3) A Board of Conciliation : A Board of Conciliation may also be constituted if occasion \narises, for promoting and settlement of Industrial dispute.\n4) A Court of Enquiry : -\n5) Tribunal :- \n6) Lockout :-The Notice for strike or Lockout should be given in advance before 6 weeks as \nwell as.\n 54\n54", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 55, + "text": "Chapter 17. UNIONS\nFormation of Union in India :\n SORABJI SHAPURJI started first Labor Agitation in Bombay in 1875. Between 1882 \nand 1890 about 25 strikes were in Madras and Bombay. \"Bombay Millhand Association\" a \nLabour movement was started by N.M. LOKHANDEY in 1890. In 1891 Fact. Act was \npassed. From 1904-1911 a Common Society of Railwaymen of India and Burma formed. \nMr.P.B. Wadia who was a worker in Madras Textile Mill formed MADRAS LABOUR \nUNION in MDRAS (Choolie) in 1918.\nIn 1917 Miss. Ansuiya Surabaya had organized workers and strike in Ahemedabad.\nIn 1920 Mahatma Gandhi formed Spinning and Weavers Association at Ahemedabad. In \nthe same year 1920 Mr.MILLER formed Association of Railway worker in Punjab.\nIn 1920 Lala Lajpat Raj formed All India Trade Union Congress.\nIn 1922 All India Railwaymen Federation was formed.\nIn 1926 government passed Trade Union Act.\nIn 1946 Indian National Trade Union Congress was formed.\nIn 1954 NRMU was formed.\nQue.:What are the facilities given to Union by Railway?\n1) Railway Membership or Representatives in Staff benefit fund committee who are \nnominated by recognized Union. \n2) Railway provide land for building or accommodation and also provide telephone.\n3) Sanctioning permission after application to hold meeting in Rly. ground. \n4) Space for Notice Board in Railway premises.\n5) Supply of copies of Railway board letters.\n6) Special Casual leave and passes to attend meetings.\n7) Issues Card pass to office bearers of unions.\n8) Union office bearers would not be transferred until and unless two months notice.\n9) Collection of subscriptions of Unions on payment Day,\n20 yard away from pay counters.\nADVANTAGES OF UNION\n1) A boon to a working class.\n2) Through Union improvements in working conditions. \n3) This can brings out industrial peace.\nQue. :- What are the Unions in India ?\nB) All Indian Trade Union Congress (AITUC) (By Communist)\nC) Indian National Trade Union Congress . (INTUC) (By Congress)\nD) Hind Majdoor Sabha (Socialist)\nE) Bhartiya Majdoor Sangh (Jansangh)\nF) United Trade Union (Communist.)\nG) Central India Trade Union.\n 55\n55", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 56, + "text": "H) All India Railwaymens Federation.\nI) National Federation of Indian Railwaymen.\nJ) Bharatiya Railway Mazdoor Sangh.\nQue.:-What are the unions in Railways?\n1) National Railway Mazdoor Sangh.\n2) Central Railway Mazdoor Sangh\n3) Madhya Railway Karmachari Sangh.\nTrade Union Act - 1926 (Amended 1947 )- A trade union is a Continuos association of \nwage earners for the purpose of maintaining and improving the condition of workers and their \nlives.\nIn the year 1875 Sorabji Shapurje Stated a Labour agitation in Bombay against appalling \ncondition of workers especially women and children is factories. Between 1882 to 1890 \nabout 25 strikes were recorded is Madras and Bombay alone. In 1890 N. M. Lokhandey had \nstarted Labour Movement is India and formed \"Bombay Millhand Association\". He had also \nstarted English News Paper known as \"Deen Bandhu\".\nIn 1918 P.B. Wadia had started Labour Movement is Choolce is Madras. He was working \nis Buckingam and Karnatie Mill as a worker. He was removed from service for his \nparticipating in political affair. The name of the union was kept. \"MADRAS LABOUR \nUNION\" With in one year, the union had its four Branches and members gone to 20000.\nTrade Union Act 1926 (Amended - 1947) - In 1917 Miss Ansuiya Sarabhai a Social \nWorker had organised workers and strike at Ahmedabad.\nIn 1920 Mahatma Ghandhi had founded Spinning and Weavers Association at \nAhmedabad Textile Mill. From here the Labour took good turn.\nIn 1920 Mr. Miller had formed 'Association Railway worker in Punjab.'\nIn 1920 All India Trade Union Congress was formed and founded by Lala Lajpat Raj.\n In 1926 Trade Union Act was passed by the Govt. and prior to this Unions were not \nrecognised. In 1940 Govt. instituted on Inquiry is regard to all India Trade Union Congress in \norder to know the activities of the Union.\nIn 1946 India National Trade Union Congress was formed. \n1) In 1922 all India Railway men Federation was founded \nFactors Responsible for the growth of trade union :\n1) Economic condition due to 1st world was.\n2) Many sold returned home and needed jobs.\n3) Due to growth may leaders and social reforms\n4) Due to international labor office is India.\n5) Success of Russian revolution.\nSalient Feature of Trade union Act 1926.\n 1.This Act was passed in 1926 and implemented on 1-6- 1927\n 2.Any seven or more can form an association and get registration.\n2. The Registrar can withdraw or cancel the registration of Unions.\n3. Legal protection can be given to the union office bearers against criminal proceeding but \nthat must be for union work only.\n4. The union may raise separate funds other than subscriptions on purely voluntary basis \nfor promotion of social or political interest.\n5. Union are to define their aim and objects for its constitution and maintain and get Audit \naccounts.\n 56\n56", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 57, + "text": "6. The registrar can inspect the accounts and the Union Books at any time.\n7. If a Union indulges in unfair practices, go for irregular strike, submit false statement - \npunishment would be total withdraws of recognition.\n8. If employer interferes is the working of union, influences against the union, \ndiscriminates with any officer of the union, Refuses to Negotiate or Deny Privileges to \nunions, he is liable to be find Rs. 1000.\nParticipation of Labour is Management :\n In order to have better and systematic participation of LABOUR is management for \nimprovement in working of Railway system and appropriate changes for improving \nefficiency and viability, A corporate Enterprise Group was set up at central level in the \nMinistry of Railways in 1972. Specially to provide a free flow and exchange of ideas on the \nrunning and slopping of the enterprise of railway.\nThis group consists of Chairman, Members and secretary of RLY Board on Hand and in other \nside three representatives each per AIRE, NIFR and one representative from representative of \nthe Officers Federations .\n1) Functioning of Rly and exchange of data and Idea for improving efficiency.\n2) Investment Program Housing and welfare.\n3) Use of Technology.\n Staff matters including those, which can from with in the purview of PNM, JCM are not to \nbe discounted by ECG.\nCorporate Enterprise has also been set up on Zonal Railways from 15.7.77.\nOfficial side GM(chairman) + CPO (Secy.) \nStaff side AIRF, NFIR and officers once in two months.\nStaff Councils :The staff councils are the bodies organized by RLY on territorial basis. It is \nformed to maintain good relations and co-operations between Rly administration and all \ngroups of Non gazetted employees.\n1) Central staff council\n2) Divisional staff council at divisional HQ level and at workshop.\n3) Area staff council (or) station committee on selected stations.\nCentral staff council: - The council consists of one elected member from each divisional \ncommittee and equal no of the members nominated by GM and one of the members will be \nnominated by GM as Chairman, the sectary (P.O. LABOUR) This meeting will be continued \nquarterly.\nDivisional Staff Council :- Five members are nominated by DRM and equal no of elected \nmembers representing the employees of various departments. One of the nominated member \nwould be Chairman. All non-gazetted employees those are having minimum 3 years service \nshall be eligible for election and the employees minimum one-year service can vote. Period \nof elected members is only 3 years.\nFunction of Divisional Staff Council :\n1) Staff can being questions in connection with this conditions of service.\n2) Matters of Common interest may be discussed in order to improving effecting.\n3) Staff councils function on various welfare committees and advise all welfare activities.\nElection: - Election to Staff Council shall be held once in two or three years and by Ballot. \nApprentice are not eligible for content as will for voting\n 57\n57", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 58, + "text": "Chapter 18.Railways Claims Tribunal (RCT) \n \nThe Railways Claims Tribunal set by central Govt. to exercise the jurisdiction, powers \nand authority conferred on if under the Railway Tribunal Act- 1987, and effective from \n8.11.1989. \nIf consists of a Chairman, four Vice chairman and such number of judicial members and \ntechnical members as central Govt., the Jurisdiction power and Authority of Claims Tribunals \nmay be exercised by Benches. The chairman holds the office for 5 years or till the attains the \nage of 65 years. There are 19 Benches.\nAll claims for payment of compensation against railway arising out of provisions under \nsection 82 A of Indian Railway Act.1890. are filed in such courts of Tribunal. The tribunal \nshall have for the purpose of discharging its functions under the Railway claims Tribunal \nAct., the same powers as are vested in a Civil Court under the code of Civil Procedure, 1908 .\nWhile trying such suits the applicants have to submit applications along with fee as \nprescribed is schedule II for cases.\n1) Claims performing to loss, destruction, damage, deterioration or non-delivery of goods \nand animals.\n2) Refund of fare and freight for goods and animals.\n3) Compensation payable under Railway act, to passengers for injuries caused in Railway \naccidents.\n National Railway User's Committee (NRUC).\nThe committee was formed is 1953 to secure better representation of Railway users and more \nfrequent opportunities for consultation between Rly and Rly users on matter related to the \nservice period by Railways. The council holds the office for the period not exceeding two \nyears. It consists of the two member appointed by the Ministry of Railways. From Chamber \nof Commerce, Traveling Public Retired Railway Officer, various Ministry is having concern \nwith Railway working. The Ministry of State, Deputy Minister will refer as Chairman, and \nthe Railway Minister will preside at the meeting of Councils.\nRailway Traffic Enquiry Committee (RETC):\nThe Committee consists of the Chairman and two Members to make an examination of \nthe structure of fair and fright, The charges for the public tariff including post office and \nmilitary tariff.\n1. The structure of fare rates and other charges for public tariff carried by passenger train \nand goods train.\n2. The structure and other charges for post office mails and military traffic.\n3. Other matter connected with the rationalisation and simplification of fair and freight \nstructure on Indian Railways.\nRailway Recruitment Board.\nRailway Board has set up various RRB's on Indian Railways to catch the needs of Zonal \nRailways for recruitment of Group C posts. except those mentioned in Recruitment and \nTraining. Recruitment by Zonal Railways.\nRRB is placed under the control of Chairman (Senior Administrative Grade) who is \nassociated by members and secretary to manage the function smoothly.\nIt is the duty of the Zonal Railways to asses in advance, the requirement of staff in \ncoming years, by locating vacancies , planning for replacement and to place advance indent \non RRBs. After getting such indents from Zonal Railways the function of RRB starts.\nFunction Of RRB\n1. To scrutinised the indents and arrange for publication of vacancies in leading News \npapers \n 58\n58", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 59, + "text": "2. To Contact specialist / Professors for setting Question papers.\n3. To arrange printing Question papers.\n4. To contact educational institutions for examination.\n5. To contact Railway Official for arranging persons for supervision.\n6. To allot Roll Number to candidates.\n7. To send call letters for written examination.\n8. To visit computer center for valuation of answer book. \n9. To frame the result and send the list of successful candidates along with required \ndocuments to Zonal Railways.\nChapter 18. Rajbhasha or Official language Act.-1963.\nAn act to provide for the languages which may be use for the official purpose of \nunion, for transaction of business in Parliament, for central and state acts and for certain \npurposes in High Court be it enacted by parliament in the year of the Republic of India. This \nact may be called the official language act. This was come into effect on the 26th Jan. of \n1965. In the meanline English language shall be used for Purpose of Communication between \nunion and state which had not adopted Hindi as its Official language. Both Hindi and \nEnglish shall be used for all Documents. Any employee may submit application either Hindi \nor English. An employee applied an application it shall give reply in Hindi.\nAll manuals, codes and other procedure literature relating to the central Govt. offices \nshall be provided in Hindi and English.\nAll nameplates, sign boards, letterheads to be use in Central Govt. shall be in Hindi or \nEnglish.\nIncentive to promote Rajbhasha.\nPersons pay, equal in amount to one increment for a period of 12 months would be \npayable to the central Govt. employees, on passing the Hindi, Hindi Typing or Hindi \nStenography exams of the Hindi Teaching Scheme, subject to full fill the following \nconditions.\n 1. Pragya Exam. a. Passing Mark for Non-gazetted \n b. 60 % and above for gazetted .\n 2. Praveen Exam. 55% as above Non-gazetted.\n3 > 60% For Gazetted Officer.\n4 4. Prabodh Exam . Only Non-gazetted staff eligible \n for passed pay whose score more \n than 55% \n 5. Hindi Typing. Both are eligible \n 6. Steno graphy . Passing for Non -gazetted more \n than 90% for gazetted. \nLump sum award also eligible to those passed the Exams of the Hindi Teaching Scheme. \nthrough their own effect that organization should be a Recognized are ;\n5 1) Prabodh - RS. 250\n6 2) Praveen - RS. 250\n7 3) Pragya - RS. 300\n8 4) Hindi Typing - RS. 150\n9 5) Steno - RS. 300\n10 6) Passed through.\n11 voluntary Hindi\n12 organization - RS . 300\n 59\n59", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 60, + "text": "13 Awards for Noting and Drafting in Hindi :\nCash awards with the recommendations of the assessment committee to those who \nhave written not less than 500,000 words in Hindi in a year. Also they world be issued letter \nof Appreciation Certificate.\nThe completes belong to Non Hindi speaking states would be given additional weigh of \n20 %.\nCollective Cash Awards :- The departments, which had done more usage of Hindi \nlanguage, would be given award independent. Department were Rs. 5000, 3000 & 2000.\nAmount of Compensation Payable :\n1) Where Death results from the injury.\nAn amount equal to 40% of monthly wages of the deceased workman.\ni.e. 40% of monthly wages X Relevant factor\n OR\n Amount Rs 25000, which is more.\n2) Permanent total Disablement Results from the injury.\nAmount equal to 50% of the monthly wages of the injured workman multiplied by the \nrelevant factors \n OR\n Amount Rs.24000/- which ever is more.\n Duties of Supervisors in case of Injuries: \n1) First of all he should render First Aid and their call the Doctor.\n2) Give All Concerned Messages including Associated Accounts Officer with in 48 Hrs.\n3) Take Two Eye witness/Statements where possible.\n4) Prepare Accident Report indicating small diagram.\n5) Get MEDICAL Report on Injury.\n6) GET POLICE Report.\n7) Take Down the Particulars of Leave taken during Last 12 months.\n8) Wages calculation.\n9) Finding of Enquiry.\nChapter19. Recruitment, Training and Development. \nRevised Procedure for Absorption of disabled / medically decategorised staff in \nAlternative Employment:\n1. Procedure for dectegorisation: A Rly. Servant who fails in a vision test or otherwise by \nvirtue of disability acquired during service becomes physically incapable of performing \nthe duties of the post which he occupies should not be dispensed with or reduced in rank, \nbut should be shifted to some other post with the same pay scale and service benefits.\n2. Classification of Rly. Servants declared medically unfit: Rly. Servants acquiring \ndisability during service and declared medically unfit are divisible into two groups:-\n 60\n60", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 61, + "text": "i) Those completely disabled for further service in any post in the railway , i.e. those who can \nnot be declared fit even in the 'C' medical category ; and \nii) Those disabled /incapable for further service in the post they are holding but declared \nfit in a lower medical category and eligible for retention in service in posts \ncorresponding to this lower medical category.\n3. The Rly. Servants both in group (I) and group (ii) above cease to perform the duties of \nthe post they are holding from the date they are declared medically unfit for the present \npost. If such a Rly. Servant can not be immediately adjusted against or absorbed in any \nsuitable alternative post he may be kept on a special supernumerary post in the grade in \nwhich the concerned employee working on regular basis before being declared medically \nunfit pending location of suitable alternative employment for him with the same pay scale \nand service benefits; efforts to locate suitable alternative employment starting \nimmediately. The special super supernumerary post so created will stand abolished as \nsoon as the alternative employment is located.\n4 Disabled Medically decategorised staff to be absorbed in pots they can adequately \nfill:-In the matter of absorption of disabled / medically decategorised staff in alternative \nposts, Railway administration should take care to ensure that the alternative employment \noffered is only in posts which the staff can adequately fill and as for as possible should \nbroadly be in allied categories where there background and experience in earlier posts \ncould be utilized. While finding alternative post for absorption of disabled medically \ndecategorised staff the Railway Administration should ensure that the interests of other \nstaff in other staff in service are not adversely affected and no reservation of any \nofficiating Railway servant is made to absorbed the disabled / medically decategorised \nRly. Servant not only within the Unit / Division or Department, but in other Unit / \nDivision or Department.\n4. Absorption in posts identified for employment of physically handicapped persons / \ncreation of supernumerary posts. - The Rely. Servants falling in group (I) mentioned in \npara 2 above i.e. those who are declared unfit even for the lowest medical category, may \nbe absorbed in a post / category identified suitable for employment of physically \nhandicapped persons and fresh recruitment to that post / category from open market from \namongst physically handicapped withheld. In case the alternative post is not carrying the \nrequisite pay scale, a supernumerary post may be created in appropriate scale of pay and \nthe employee adjusted against the same keeping the lower grade post vacant by \nwithholding fresh recruitment thereto. The supernumerary post so created to \naccommodate disabled /medically incapacitated employee shall stand abolished as soon \nas a suitable post in the appropriate scale is found for the Rly. Servant concerned or the \npost is vacated by him for other reason, whichever is earlier.\n5. Step to be taken for finding alternative employment Leave:-\n(1) With the view to determine the categories in which the disabled/medically decategorised \nRly. Servant is suitable for absorption; a committee should examine him. The committee \nmay consist of two or three officers / posted at the headquarters of the officers under \nwhom the disabled/medically decategorised Rly. Servant was working, the Rly. Servant \nimmediate officer being one of the member of the committee. After the committee has \nbeen examined the Rly. Servant and determined his suitability for certain categories of \nposts, the officer under whom the Rly. Servant was working will proceed to take further \naction to find suitable alternative employment for him.\n(2) The officer concerned will prepare a list of vacancies within his jurisdiction in the \ncategories for which the disabled/medically incapacitated Rly. Servant has been found \nsuitable and a post with some scale of pay as was attached to the post he was holding on \nregular basis before being declared medically unfit will be offered to him.\n 61\n61", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 62, + "text": "(3) It will be the responsibility primarily of the officer under whom the concerned Rly. \nServant was directly working to find suitable alternative employment for him. This will \nbe done first by trying to find alternative employment in the officer 's own unit /division, \noffice, workshop etc. and a register with the details as mentioned in sub para (6) bellow \nwill be maintained for this purpose.\n(4) If there is no immediate prospect of employment in his own unit /division, office etc., the \nname of the Rly. Servant with particular given in sub para (6) bellow will be circulated to \nall other offices or establishment where suitable employment is likely to be found.\n(5) Nothing in the previous paragraph, however, debars a Rly. Servant from applying for a \nparticular post for which he is likely to be deemed suitable and it is known to be vacant \nunder any officer. Such an application must be addressed through the immediate officer of \nthe Rly. Servant concerned and must contained full particulars of his service and must \ncontained full particular of his service and must be forwarded to the officer to whom \naddressed or to the authority competent to make the appointment. The result of the \napplication must be intimated to the Rly. Servant.\n(6) A register containing the names of all Rly. Servant declared medically unfit and to be \nabsorbed in alternative post will be maintained by Headquarters, Divisional and other \nextra-Divisional offices. These registers will contain not only the names of the staff of the \nparticular division, etc., but also the names notified to the unit Officer concerned by other \nunits/offices. This will not, however, absolve officers under whom the Rly. Servant was \nlast working from continuing their efforts to find suitable employment for the disabled / \nmedically decategorised employee. The particulars required to be maintained in registers \nand notified to other offices in accordance with the instructions above are as follows:-\n(i) Serial number.\n(ii) Date on which incapacitated.\n(iii) Name and Father's name.\n(iv) Post last held on regular basis with scale of Pay and rate of pay.\n(v) Educational qualification:-If no educational qualifications, then general remarks \nregarding knowledge of English, regional language etc.\n(vi) Medical category in which placed.\n(vii) Details of special supernumerary post till absorption in alternative appointment.(para \n1303)\n(viii) Date from which absorbed in alternative appointment.\n(ix) Nature and category of alternative appointment.\n(x) Scale of pay of the alternative post and the pay fixed at.\n(xi) Details of supernumerary posts if any after absorption in Alternative \nappointment.(para 1305)\n(xii) Remarks.\n(7) If and when a Rly. Servant is absorbed in an alternative post intimation will be sent by the \nofficer under whom he was previously working to all other officers to whom his name \nwas notified. His name will be deleted from the registers.\n(8) Before any post is filled or a promotion is ordered, officers concerned will refer to their \nregisters satisfy themselves that no disabled medically incapacitated Rly. Servant who is \nsuitable for the post is available. If any such disabled / medically incapacitated employee \nis available, he will be given preference over all categories of staff for appointment.\n6. Element of Running Allowance to be recorded while finding alternative post to \ndisabled medically decategorised running staff:-In order to determine the same scale of \npay for the propose of absorbing a medically decategorised running staff in the alternative \nemployment, an amount equal to such percentage of pay in lieu of running allowance as \nmay be in force may be added to the minimum and maximum of the scale of Pay of the \nrunning staff. If the scale of pay so arrived at is not identical with the scale of pay already \nexisting, the same may be replaced by the equivalent existing scale of pay.\n 62\n62", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 63, + "text": "7. Fixation of Pay:- The pay of the disabled / medically decategorised Rly. Servants will be \nfixed on absorption in an alternative post at a stage corresponding to the pay previously \ndrawn in the post held by them on regular basis before acquiring disability / medically \ndecategorisation. For running staff, the fixation will be based on the basic pay plus a \npercentage of their basic pay, representing the pay element of running allowance as may \nbe in the force. If the basic pay so arrived at does not corresponding to any stage in the \nabsorbing grade the pay may be fixed at the stage just below and the difference allowed \nas Personal pay to be absorbed in future increase in pay. Similarly if the Pay so arrived at \nexceeds the maximum of the absorbing grade, the Pay may be fixed at the maximum and \nthe difference may be allowed as personal pay to be absorbed in future increments \n/increases in pay. Other allowances such as Dearness Allowance, City Compensatory \nAllowance and House Rent Allowance should be allowed on pay plus personal pay, if \nany, in the absorbing grade.\n8. Benefit of past service to allowed:-A disabled/medically de-categorized Rly. Servant \nabsorbed in alternative post will for all-purpose have his past service treated as continuos \nwith that in the alternative post.\n9. Fixation of seniority of disabled/medically de-categorised staff absorbed in \nalternative employment: -The disabled/medically de-categorised staff absorbed in \nalternative post should be allowed seniority in the grade of absorption with reference to \nthe length of service rendered on non declared medically unfit. This is subjected to the \nproviso that if a disabled/medically de-categorised employee happens to be absorbed in \nthe cadre from which he was originally promoted will not be placed above his erstwhile \nseniors in the grade of absorption.\n10. The staff who get their cases recommended for a change of category on medical grounds \nwill not get the benefit of these rule, but will be treated as staff transferred on their own \nrequest.\n[Section 47 (1) of the Persons with Disabilities (Equal Opportunities, Protection of Right and \nFull Participation) Act, 1995 and Board's Letter No.E (NG) I/96/RE3/9(1) and (2) dated \n29.4.1999;]\nProcedure for deservation of post:\nAs a general rule the vacancies meant for SC/ST should be filled up by SC/ST candidate \nand when such candidate is available the vacancies may be got deserved after following the \nprocedure on the subject and then the vacancies may be got deserved after following the \nprocedure on the subject and then the vacancies may be filled up from another candidates.\nExcept in Group 'A' and Group 'B' the quota temporarily deserved shall be treated as \narrears quota to be carried forward in the subsequent effective three years ignoring the year in \nwhich there is no promotion / selection. During the next three years all attempts should be \nmade to fill the vacancies and if no candidate is available even in the next effective three \nyears, the vacancies may be filled in by ST and vice versa. Such interchange in case of Group \n'A' & 'B' where no carried forward is applicable should be done in the first year, in the case of \ngroup 'B' posts filled by LDCE, the quota will as usual.\nBefore asking for de reservation it should be ensured that in case of direct recruitment, wide \npublicity in the newspapers and also to organisation of SC/ST is given and all relaxation and \nconcession available to the SC/ST candidates has been applied.\nPower to deserve a vacancy rests with the Railway Board except in technical and \nOperating categories where GM may give temporary de reservation and quarterly report to \nsubmit to Railway Board. Similarly in case of workshop categories de reservation may be \naccorded by the head of workshop and similar report submitted to Railway Board.\n 63\n63", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 64, + "text": "For de reservation of Group 'B' prior permission of Ministry of Home, Department of \nPersonnel is to be taken through Railway Board.\nFilling up of reserved post due to non availability of SC/ST candidates -\nAd-hoc promotions: -\nIn case where de-reservation is absolutely necessary and justified on the ground of safety \nof train operations, achievement of production target etc., proposals for de reservation may be \nsubmitted to board for consideration. The Board on merit as per extent procedure will \nconsider such proposals. However, before proposing any de-reservation the following \npositive steps will be required to be taken to fill up reserved vacancies by the reserved \ncandidates.\n(i) Considering the possibility of direct recruitment are permissible in the grade in which \npromotion are required to be made in terms of Railway Boards letter No. 90E(SCT) \nI/25/23 dated 29.11.90.\n(ii) Where direct recruitment is not permissible, the possibility of down grading the post \nand filling up the same promotion may be considered. If it is not feasible, it may also \nbe examined whether such down graded posts can be filled up by direct recruitment if \nit is permissible.\n(iii)In exercise of powers delegated to G.M. vide Board's letter No E(NG)I-94/PM I/717 \ndated 11.11.94 , the possibility of relaxation the condition of two years minimum service in \nthe existing grade to one year in non-running category posts may be considered, so that the \nScheduled Castes/Scheduled Tribes may be allowed to be promoted under these delegated \npowers.\nBesides, where the work, is of such imported /urgent nature that the reserved posts cannot \nbe kept vacant. Zonal Railways/ Production Units may consider ad-hoc promotions for \nspecific periods in accordance with Board's instructions on the subjects with the personnel \napproval of the GM, subject to the fulfillment of the following conditions.\n(i) The ad-hoc arrangement is absolutely necessary and justified on the ground of safety \nof train operations, achievement target etc.\n(ii) Any extension of the period of ad-hoc arrangement against reserved post will also \nrequired GM's personal \napproval.\n(iii)The ad-hoc arrangement will be stop gap arrangement and will not be allowed to continue \nfor unduly long duration.\n[RB'S No.99-E (SCT) 1/25/10, dated 11.5.99]\nApplication on Compassionate Grounds:\nAppointment on Compassionate ground is those appointments, which can be made to \nthe dependents of Rly. Servants who lose their lives in the course of duty or die in harness or \nbecome crippled while in service or medically incapacitated or decategorised for the post \nholding or due to sickness like heart trouble or such diseases where no alternative \nappointment on reasonable emolument could be offered. Compassionate appointment is \noffered in the following type of cases.\n(i) Dependents of the employee who die or permanently crippled in the course of duty;\n(ii) Dependents of the employees who die in harness as a result of Railway accidents \nwhile off duty.\n(iii) Dependents of the employees who dies in harness while in service before retirement \nor medically incapacitated;\n(iv) Dependents of the employees whose whereabouts are not known for a period of seven \nyears and the settlement dues of the employee are paid to the family on this account;\n(v) Dependents of the employees who develop serious ailments like heart diseases, \ncancers or medically decategorised where no alternative job of the same emoluments \ncould be offered to them.\n 64\n64", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 65, + "text": "Note: Medically decategorised non-Gazetted staff should be absorbed in suitable \nalternative posts in a regular cadre only and not in tenure posts.[R.B's No.E(NG) 1/88/RE-3/1 \nof 11.4.88.]\nSon/Daughter /widow/widower of the employees are eligible for appointment on \ncompassionate grounds:\nIn the case candidate has the necessary minimum qualification for employment in a group \n'C' post , his suitability, for all types of Group 'C' posts , in order of suitability, should be \njudged and recorded by the screening committee, which should also clearly indicate the \ncategories for which the candidate has not been considered suitable. Final offer of \nappointment will, however , be subject to availability of vacancies, passing of medical \nexamination, production of necessary certificate etc.\n [R.B's No.E(NG) II/88/RC-1/1 Policy of 2-11-89.]\nNormally only the father is taken to be breadwinner of the family. Where both husband \nand wife are Railway Employee, consequent upon the death of husband appointment on \ncompassionate ground is admissible to a ward but not on account of death of wife. In such \ncases, only one compassionate appointment is admissible.\nThis has been modified to the extent that compassionate appointment is admissible in \ncase of death of the mother or father, subject to a stipulation that compassionate appointment \nwill be available either on the death of the husband or wife whichever event occurs first.\nRib's no. (NG) II 86 /RC - 1 /1 Policy of 31.10.86 and rib's no. (NG) II /86 /RC- 1/1 \nPolicy of 2.6.97]\nRly. Employee dying in harness leaving more than one widow along with children born to the \nsecond wife, the appointment on compassionate ground to the 2nd widow and her children not \nto be considered unless administration has permitted the 2nd marriage, taking in to account the \npersonal law. Second marriage is not permissible is invariably specified in the terms and \nconditions advised in the offer of initial appointment.\n [R.B's No.E(NG)II/91/RC/ - 1/36 of 2-1-92]\nWhere the widow cannot take up employment Railway can keep the case for appointment \non compassionate grounds open to enable consideration of appointment of a minor when he \nattains majority, even though at the time of occurrence of the event making compassionate \nappointment permissible, there is a daughter who has attained majority and / or a major son \nwho is already employed. This will be subject to the following conditions:-\n(a) The minor son to be appointed will be attaining majority of age within a period of five \nyears of the event of death which is the basis for appointment for compassionate ground.\n(b) Where there is more than one minor sons, it is the only eldest minor son who should be \nconsidered for appointment when he attend majority and not any of the minor sons.\n(c) Further in such cases , the competent authority should be satisfied about the bona fides of \nthe request of the widow or if there is no surviving widow of the family, that appointment \nshould be given to the minor son (When he attains majority) instead of daughter or an \nemployed son who is already major.\n [R.B's No.E(NG) II/84/RC-1/172 of 1-3-85]\nFor recruitment in Group 'D' the following posts of appointment on compassionate \ngrounds are exclusively reserved for widows and in respect of these posts minimum \neducational qualification as now prescribed will not be insisted upon.\n(a) Water woman\n(b) Retiring room attendants\n(c) Cinder picking woman\n(d) Sweeper woman \n(e) C & W Khalasis(For picking west only)\n(f) Ayah and female sanitary cleaner in Hospital and Schools\n 65\n65", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 66, + "text": "(g) Khalasis attached to Sub-divisional offices of AEN, PWI and IOW. \n [R.B's No.E(NG)III/86/RC-1/1/ Policy of 25-3-86.]\nNote:- (1) Women appointment on compassionate in permanent Way Gangs, Are to be posted \nonly in the Gangs that are located within the Station limits or in the Yards. The papers for \nappointments of women in Permanent Way Gangs are to be put up to the competent authority \nfor approval through Senior Divisional Engineer ( Co - ordination ) of the Division, who will \nensure that there are only a limited number of women in each Gang. and also that it should be \nmade clear to the women posted in the Gang that they would have to do the normal Gang \nwork.\n[R.B's No.E(NG) II/RC-1/139/ of 21.10.97.]\n(1) For appointments of widows on compassionate ground, educational qualification need not \nbe insisted upon the Group 'D' post that has been exclusively reserved for them.\n[R.B's No.E(NG) II/98/RC-1/39 of 4.3.99]\n Normally, the appointment on compassionate grounds should made within one month for \nitem no(I) and within three month for others, but all out efforts should be made to offer \nappointments as early as possible. A period of 5 years from the date of occurrence of event is \nprescribed as period of eligibility of entitlement of appointments on compassionate ground \nwhich may be relaxed up to 20 years with the approval of General Manager. In all cases of \ndeath of an employee while in service and in cases where the widow cannot take up \nemployment and sons/daughter are minor, the case may be kept pending till the first son or \ndaughter becomes major. Compassionate appointments, as permissible under the extent \ninstruction, could be approved by the G.M. even beyond the limit of 5 years and up to the 10 \nyears, subject to the following conditions:\n(a) The powers shall be exercised personally by the G.M. and shall not be delegated;\n(b) The cases should not be more than 15 years old from the date of the death.\n(c) The widow of the deceased employee should not have re-married;\n(d) The benefit of compassionate appointment should not have been given at any time to any \nmember of the family or to a near relative of the deceased employee.\n(e) The circumstances of the case should be such as to warrant relaxation of the time limit.\n(f) The preseason for relaxing the time limit should be placed o records;\n(g) Th e request for the compassionate appointment should have been received by the \nRailway administration as soon as the first child or, wherever the family desires for some \nsatisfactory reasons, the first son/daughter to be considered for appointment, become a \nmajor. The G.M. will, however have the power to relax this period up to a maximum of \ntwo years of attaining majority by the candidate, with the educational qualification for the \npurpose of appointment being taken as that acquired at the time of attaining majority.\n(h) Wherever the individual cases of merit, it is consider that justification exists for extending \nconsideration to cases falling beyond the above limit i.e. where death took place above \nthe 20 years ago and where the application for appointment are made for other than first \nchild/first son/first daughter, the prior approval of the Ministry of Railways should be \nobtained by forwarding a detail proposal with specific justification and personal \nrecommendation of the G.M. in the prescribed Performa, circulated vide R.B's \nNo.E(NG)II/87/RC-1/143 of 19.4.88.\n(i) A SL/II Class Special pass may be granted to the wards of Rly. employees called for \nappearing in the test/interview, for the first time, for adjudging their suitability for \nappointment on compassionate grounds in death cases, from the places of residence to the \nnearest station of the place, where test/interview is held, and back. No such pass shall be \nissued if the candidate fails in the test/interview in the first attempt and is call again to \nappear.\n[R.B's No.E(W)99 PS5-8/9 of 18.10.99]\nRelaxation of minimum educational qualification:\n 66\n66", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 67, + "text": "Normally the educational qualification prescribed for the post to be offered should not be \nany case be relaxed. However if the merits of the individual case the GM feels that such a \nrelaxation of a educational qualification is absolutely necessary, then such cases may be \nreferred to the Ministry of Railways, with the stipulation that the candidate has to acquire \nqualification with the prescribed time limit.\nIn order that the employees may acquire the qualification required within least possible \ntime and they do not take it for granted that extension of time will be given, and eventually \nthey will be retained in service albeit in the lower grade, following stipulation should be \nmade in case where educational qualification may be relaxed:\n(a) The period to be allowed for acquiring the qualification will be two years.\n(b) Such a person will not be confirmed in service till he acquires the qualification.\n(c) He will not eligible for promotion till such time he acquire the qualification.\n(d) If any junior is promoted before the senior compassionate appointee acquires the \nqualification such promotion will be treated as regular. \nWhile processing the proposals for relaxation of educational qualification and issuing of \noffer of appointment the above mention instruction may be kept in view.\n[R.B's No.E(NG)II/80/RC-1/4(KW) of 22-2-1989]\nNote: For compassionate appointment to the Non-Technical Popular categories the \nminimum of 50% marks in matriculation need not be insisted upon and candidate possessing \na pass in the matriculation may also be appointed on compassionate grounds provided the \nother prescribed conditions are satisfied in their cases.\n[R.B's No.E(NG)II/91/RC-1/117 of 30.9.1992]\nDependent of Rly. Employee: \nRail shall consider the cases of dependent of Rly. employees dying or getting medically \ndecategorised as bachelor / spinster for appointment on compassionate ground subject to the \ncondition that the candidate proposed for appointment is shown as dependent on the ex-\nemployee as per Pass Rules. Such appointments will also be subject to the fulfillment of all \nthe conditions contained in the extent instruction governing appointment on compassionate \nground.\n The genuineness of the claim of dependency may also be verified from Ration Card and \nalso by deputing Welfare Inspector.\n[R.B's No.E(NG)II/88/RC-1/Policy of 4-9-96 and RBE 66/97 and 21.1.98]\nNote: The provision for the appointment of near relative has been deleted vide \nBoard's No.E(NG)II-88/RCI/1 of 13.12.95.]\nEligibility: 1.Dependent members of the family covered under pass rule are eligible\n2. In cases there are daughters who have attain majority/major son who is employed and if \nwidow cannot take up appointment it may be kept pending till minor attains the age of \nmajority and if there is no other son/daughter the major if so desires could be appointed \nprovided he resigns the job he had and otherwise major daughter could be given appointment.\n3.Casual labours could also be given appointment on compassionate grounds but offer as \ncasual labour only.\nFor recruitment on compassionate grounds as suitability test is to be held for judging the \nsuitability of applicant, the standard for the same need not be rigid. It should only be ensured \nthat person concerned would be in a position to discharge the duties of the post offered to \nhim. If the ward possesses the prescribed minimum educational qualification, he should be \nconsidered for appointment in Group 'C' post for which he may be suitable and eligible and if \nunsuitable for Group 'C' one post should be considered for another alternative Group 'C' post. \nIt is not necessary that the ward of Group 'D' should be appointed for Group 'D'. If he is \neligible and suitable for Group 'C' he may be given appointment in Group 'C' only. \n[R.B's No.E(G)82/EC2(Lt. IV) of 27-6-1985]\n 67\n67", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 68, + "text": "Appointment on compassionate grounds suitability test for Grade 'C' posts:\nThe suitability test should be completed on a single day i.e. written test and viva-voce \nshould hold on the same day to avoid inconvenience to the candidates.\n[R.B'sNo.E(NG)II/98/RC-1/58(Policy),of 26.7.98]\nAn adopted son, adopted daughter shall also be eligible to be considered for appointments \non compassionate grounds in cases all the following condition are satisfied:\n(a) There is satisfactory proof of adoption valid legally;\n(b) The adoption is legally recognized under the personal law governing the Rly. Servant;\n(c) The legal adoption process has been completed and has become valid before the death of \ndeath/medically decategorisation/medical incapacitation of the ex employee.\n[R.B's No.E(NG)II 86/RC - 1/141 of 20-5-1988 ]\n In case, the appointment on compassionate grounds is made as a Junior Accounts \nAssistance and a clause of passing Appendix - II examination within three years is included \nin the appointment letter as per normal rules, failing which the employee so appointed would \nbe reverted as junior clerk in Grade II.\n[R.B's No.E(NG)II 88/RC-1/141 of 8-3-1990]\nWhile appointing on compassionate grounds, a suitability test is conducted by a \ncommittee consisting of three Senior Scale Officers, one from Personal branch and the other \ntwo from other departments, one preferably from the department where the employee has to \nbe absorbed.\nIn exceptional cases where circumstance warrant additional chance being given, the \ncompetent authority may consider the request for allowing candidates to reappear in the \nsuitability test, duly taking onto account the merits of each individual case.\n[R.B's No.E(NG)II/99/RC-1/Gen./3/PNM-AIRF,of 28-4-99]\nAppointment on compassionate grounds beyond 10 years, and also in the case where \ndeath took place between 5-10 years but the conditions stipulated are not fulfilled, the \ncompassionate appointment is not with in the competency of the GM except in the case of \nloosing life in the course of duty or getting crippled in the course of duty. Such cases after \ncareful examination of the case Railway Board shall be approached for relaxation of the time \nlimit.\n[R.B's No.E(NG)II-87/RC-1/57 of21-8-1987]\nNote: \"Para three of Railway Board letter no E (NG) II-87/RC-1/57 of21-8-1987 \nstipulates that whether death occurred more than 10 years back and also in the cases where \ndeath took place between 5 & 10 years back but the condition stipulated in the Boards letter \ndate 18-4-85 & 18-4-90 are not fulfilled, if compassionate appointment is otherwise \nadmissible and if after careful examination of the case it is found that there are special \nfeatures or circumstances justifying relaxation of time limit, the cases should be considered \nby Railway Administrations for approaching the Railway Board for relaxation of time limit as \na special case, the reference being made by the Railway Administration to Railway Board \nshould have the personal approval of the GM. Therefore Board desire to reiterate the extent \ninstruction contained in Board's letter of 21-8-87 for strict compliance. \n[R.B's No.E(NG)II/93/RC-1/157 of 17-6-94]\nGM should exercise his personal discretionary power for giving appointment on \ncompassionate grounds, as a casual labour or substitute of the ward of casual labourer who \ndies due to accident while on duty, provided the casual labour concerned is eligible for \ncompensation under the Workman's Compensation Act, 1923. This power shall not be re-\ndelegated to the lower authority.\n[R.B's No.E(NG)II/86/RC-1/20 of 4-5-84 & 31-12-86]\nWhere a Rly. Servant is declared unfit for all post in terms of para512 (ii) of the medical \nmanual and is retired form Railway service, compassionate appointment to the ward of such a \nRly. Servant would not be admissible.\n 68\n68", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 69, + "text": "[R.B's No.E(NG)II/86/RC-1/20 of 24-6-87]\n Where the employee choose to recruitment even though a suitable employment is found \nfor him. The compassionate appointment of an eligible ward of the employee, can be given \nby the competent authority, if so requested by him, provided that if the employee has less \nthan 3 years before superannuation at the time of unfitness/ decategorisation, personal \napproval of General Manager has to be obtained. Three years shall be reckoned from the date \nof medical unfitness / decategorisation of the employees for consideration the candidate for \nappointment on compassionate grounds.\n[R.B's No.E(NG)III 78/RC-1/1 of3.9.83 & E(NG) II/90/RC-143 of 25.2.91]\nCompassionate Appointment in the cases of missing Rly. employees:\nAttention is invited to the instruction contain in this Ministry's letter No. E(NG) II/81/RC-\n1/251 dated 6.2.82, 24.5.28 & 21.12.83 on the above mention subject.\nIn super-session on existing instruction on the subject . It has been decided as under :-\n (i) A request to grant the benefit of compassionate appointment can be considered after a laps \nof at least two years from the date from which the Rly. employee has been missing provided \nthat an FIR has been lodge and the missing person is not traceable, and the competent \nauthority feels that the case is genuine;\n(ii) This benefit will not be applicable to the case of Rly. employee :-\n(a) Who had less than two years to retire on the date from which has been missing ; or\n(b) Who is suspected to have committed fraud, suspected to have joined any terrorist \norganisation or suspected to have gone abroad .\n(iii) Compassionate appointment in the case of a missing Rly. employee also could not be \na matter of right and will be subject to fulfillment of all the conditions, including the \navailability of vacancy, laid down for such appointment under the such existing \nscheme.\n(iv) While considering such a request the result of police investigation should also be \ntaken into consideration.\n(v) A decision on any request for compassionate appointment covered by these general \ninstructions should be taken only at the level of the GM on the Railways.\n(vi) The service of the wards/widows will be terminated in the case the missing Rly. \nemployee become available subsequently.\n(vii) The compassionate appointment may be de-linked from the payment of settlement \ndues i.e. compassionate appointment in such cases may not be denied or deferred \nonly on the ground that settlement dues of the missing employee are still to be paid to \nthe person entitled to receive them.\nThe above will also be applicable to the wards/widows of the casual labour (temporary \nstatus) who are found missing. The other conditions contain in Board's Letter No. \nE(NG)II/96/RC-1/85 of 17.10.97 ( RBE 137/97), will however continue to apply in such \ncases.\n[No. E(NG)II/97/RC-1/210 of 26.7.98]\nFor appointment of handicapped wards of Rly. employee on compassionate grounds, \nregistration with special employment exchange is not necessary and if the candidate claims \nphysical handicapped this may be verified / established based on the general criteria \ncirculated under R.B's No.E(NG)III/77PRE-1/54 of 8-1-78 through competent medical \nofficers.\n[R.B's No.E(NG)II/82/RC-1?48 of 18.10.82]\nIn the case of a railway servant who is medically incapacitated or decategorised and \nretires from service and is compassionate appointments is otherwise permissible, such \nappointments may be offered also to the wife of the railway servant subject to the following \nconditions :-\n(a) Either the employee has no son or daughter or the son or daughter is minor at the \ntime of the request for appointment is made.\n 69\n69", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 70, + "text": "(b) In such cases the appointment will be approved personally by the Chief Personnel \nOfficer and.\n(c) The railway administration has no practical difficulty in offering appointment in a \npost for which the candidate is eligible and suitable.\n[R.B's No. E(NG)II/84/RC - 1/105 of 16.1.84] \n \nThere is no bar in giving appointment to the husband of a female railway employee on the \ncompassionate grounds in the circumstances in which appointments are otherwise \npermissible. \n[R.B's No.E(NG)II/82/RC-1/213 of 17.1.83]\nIn case of persons being declared unfit on account of malingering, medical unfitness \npapers should invariably carry an endorsement that he was declared unfit under para 512(ii) \nof the Indian Railway Medical Manual.\n[R.B's No. E(NG)II/86/RC-1/20 of 7.8.87]\nA brother - in - law (wife's brother) would not come within the categories of persons \neligible for appointment. Similarly, a Son-in-law also is not eligible for appointment on \ncompassionate grounds.\n[R.B's No. E9NG)II/87/RC-I/152 of 19-10-87 and E(NG)III/78/RC-I/I of 3.2.81.]\nAuthority competent to make appointments on compassionate Grounds :\nThe power to make compassionate appointments is vested in the General Manager. The \nGeneral Manager, may, however, redelegate this power to the Divisional Railway Manager \nand also Heads of Extra Divisional Units, who are in level I subject to such control as may \nlike to impose on the exercise of power by those authorities.\n[R.B's No. E(NG)III/78/RC-I/1 of 7.4.83]\nIn the cases of appointments of Group 'C' post the powers may be exercised by the Chief \nPersonnel Officer in consultation with the Head of Department concerned. In the cases of \nGroup 'D' posts the power to make such appointments should be delegated to the Divisional \nRailway Managers.\n[R.B's No.E(NG)III/78/RC-I/I of 30.4.79]\nGeneral Manager may also exercise powers in regard to appointment of the Gazetted \nOfficers on compassionate grounds provided the appointments are made in the recruitment \ngrades viz. Office Clerks, Ticket Collectors, Commercial Clerks etc.\n[R.B's No. E(NG)III/78/RC-I/I of 27.5.83] \nPriorities in making appointments on Compassionate Grounds :\n(a) The following should be order of priority to be followed while making appointments on \ncompassionate grounds :-\n(i) Dependents of employees who die or are permanently crippled in the course of duty.\n(ii) Dependents of employees who die in harness as a result of Railway or other accidents \nwhen off duty.\n(iii) Dependents of employees who \n(a) die in service or are totally incapacitated while in service irrespective of the period of \nservice left to reach the age of superannuation or of earning retirement benefits in full, or\n(b) are medically decategorised with less than 30 years of qualifying service for pensioner \nbenefits/30 years service of service for SC to PF.\n(iii) Dependents of employees who are medically decategorised with 30 years or more of \nqualifying service for pensioner benefits/30 years of service for SC to PF.\n(b) For the proper enforcement of priorities, separate lists should be maintained in each \nofficer, for the categories indicated above, the date of priority being from the date of \neligibility. All appointments should be made strictly in this order. Where, for any special \nreasons, it is felt necessary to depart from the priority list, the sanction of next higher \nauthority (Chief Personnel Officer for appointments to Group 'C' posts) must be obtained \n 70\n70", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 71, + "text": "giving details for ignoring the priority and the list of persons being put back in priority list. \nSuch cases should, however, be rare.\n(c) Where a candidate for compassionate appointment is eligible and is also adjudged suitable \nfor a post in Group 'C' but for want of vacancy in Group 'C' he offered an appointment in a \nGroup 'D' which he accepts, his case may be considered for appointment in a Group 'C' post \nas soon as suitable vacancy arises therein. Such a candidate will have performance for \nappointment in a vacancy in Group 'C' occurring later over a candidate in the same priority \ngroup, found suitable for such a post at any subsequent date under the same approval of the \ncompetent authority should be kept to the effect that the candidate was selected for a Group \n'C' post but appointment to a Group 'D post for want of vacancy in Group 'C' as early as \npossible when a vacancy arises therein subject to his being found medically fit for the post for \nwhich he is considered.\n (d)At time limit of one month should be observed within which appointment should be given \nin priority (I) cases and three months in cases relating to priority (ii) & (iii) &(iv) subject to \nthe vacancies being available.\n[R.B's No.E(NG)III/78/RC-I/I of 7.4.83]\nWards / Widow of Casual labour :-\nCasual labour who dies due to accident while on duty provided the casual labourer \nconcerned for compensation under Workmen's Compensation Act, wards/widows of such \ncasual labourers could be given appointment as casual labour (fresh face) or substitute by the \nGeneral Manager. This includes casual labour having temporary status.\n [R.B's No.E(NG)III/84/COLOUR/28 of 4.5.84, 31.12.86 & 6.12.89]\nInstructions for appointment on compassionate Grounds :\nThe very purpose of compassionate appointment is to provide immediate financial \nassistance to the bereaved family and if the offer of appointment is delayed, the object of the \nscheme is defeated. It is therefore, necessary that concerted efforts should be made by the \nAdministration to ensure that compassionate \nappointment cases are processed at the earliest so that eligible and suitable candidates get \nappointment early. The following directives of Railway Board should be followed \nscrupulously :-\n(i)Railway Administrations/Production Units, should ensure that proper guidance is given to \nthe family/applicants regarding the formalities to be completed for compassionate \nappointment.\n(ii)A brochure given an outline of the procedure including a check list of all documents to be \nattached to the application for compassionate appointment should be prepared by each \nRailway /Production Unit.\n(iii) A register should be maintained by the Welfare wing in each Division Unit. Containing \ndetailed particulars of the deceased employees including the date on which the children of \nthe deceased would attain the age of majority. One column in the register should invariable \nindicate the file number opened for the case.\n(iv) The Welfare wing should intimate the widow/the family enclosing a copy of the brochure \nand bringing out among other things that in case the appointment is sought for the \nson/daughter who is minor at the time of death of the employee, the application for \nappointment must be submitted immediately after the candidate attains the age of majority \nand, in case w3ell within the prescribed time limit for submitting application after attaining \nthe age of majority is raised to two years)\n [R.B's No.E(NG)II/92/RC-I/112 of 22.11.1994]\n(v) DRM/HOD/CWM have been delegated powers to consider cases, of compassionate \nappointment of first son or first daughter provided the case is not more than 20 years of \n 71\n71", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 72, + "text": "employee's demise and application has been made within 2 years of attainment of majority of \nthe candidate.\n[RBE-300/99 dated 30.11.1999]\nRecruitment Rules for Canteen Employees (Statuary and non-statutory) Canteen \nRailway Production Units :\nPursuant to the judgment of the Supreme Court dated 27.2.90, Ministry of Railways have \ndecided that the canteen employees, where statutory or non-statutory treated as Railway \nservants, are to be governed by the following rules:\n(i)there should be common seniority for statutory and non-statutory (recognised) canteen \nemployees taking each Production Unit as one unit.\n(ii)In respect of Zonal Railways, a Division/ Workshops should be taken as a unit of seniority \nfor regulating recruitment/promotion of canteen employees.\n(iii)the canteen employees as a whole, should be divided into 4 distinct groups keeping in \nview the identical nature of work being performed by them as detailed in Annexure_I.\n(iv)AVC in respect of Staff belonging to these 4 groups maybe finalised by concerned Zonal \nRailway Administration/Production Units in consultation with recognised unions.\n[R.B's No.E(NG)II/90/RR-1/12 of 27.5.92]\n(v)The cadre of Canteen staff shall consist of the Group. as indicated at item 48 in the \nMiscellaneous Chapter. The pay scales existing under IV CPC structure, the replacement \nscales, the equivalent revised scales, and the percentage distribution of sports in various \ngrades shall be as indicated in the item 48 of Misc. Chapter.\n(vi)The number of posts to be operated in the scales, as indicated above, will be with \nreference to the sanctioned cadre strength as on 10.5.98. The staff who are placed in scales \nhigher than the scales allotted to them, as a result of these order will draw pay in the \nrespective higher grade with effect from 10.5.98.\n(vii)These are applicable to regular cadres of Canteen staff in Open Line including Workshop \nand Production Units and will include post of rest givers and leave reserve, and will not be \napplicable to ex-cadre, work-charged posts and Construction Units and Projects.\n(viii)Staff selected and posted I higher-grade posts will have their pay fixed under Rule 1313 \n(RII)[Ferry-22-1 (a) (I) with usual option for pay fixation.\n(ix)The normal minimum eligibility condition of 2 years' service in the immediate lower \ngrade, will apply.\n[R.B's No.PC-V/98/1/11/18(B) of 10.5.98, Bahri's 99/98]\nChapter 20. All Concerned [ Mumbai Division.]\nNo:- BB/P/606/Qr/Fousing. Date 27.10.87\nSUB: Allotment of Railway Quarters to non-gazetted staff- Constitution of UnitHousing \n Committee on Mumbai Division.\n In suppression of all previous orders, the following guidelines are issued for the \nfunctioning of Unit Housing Committee at Bombay VT, Kasara, Igatpuri, Neral, Lonavla, \nPune Kurla, Kalyan and Parcel for non Gezetted Staff for which the Housing Committees on \nMumbai Division are hereby constituted with effect from the date to be notified separately.\n 72\n72", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 73, + "text": "1.The Chairman / Senior Supervisor who is authorized to allot to a quarters with the \nconsent of Housing Committee in his jurisdictions as mentioned above, one member from \neach of the recognized Union will act as a member of the unit hushing Committee in a \nparticular given jurisdiction. It should be ensured that atleast one member belong to SC/ST \nCommunity. If none of the members on the Committee belong to any one of the reserved \ngroup, the Chairman may nominator a 5th member form SC/ST Community from his \njurisdiction (as per allotment zone).\n2.The Unit Housing Committee for the Administrative pool of Bombay shall consist of \nDPO as Chairman with one representative of each Union as mentioned above and Shri P.D. \nKoli, APO (Leave&W) representing the reserved class (SC/ST).\n3.The Chairman will maintain separate registers for each pool showing separately \n\"essential\", \"non-essential\" categories for original allotments of quarters as well as change of \nquarters within the pool. Unit Housing Committee will not grant request for change of \nquarters from one pool to another pool (interchange of pool). The register should be updated \nevery month taking into account the allotments already made. These registers should be \nproduced at the time of unit Housing Committee meeting and the signature of the nominated \nmembers obtained during every meeting . Separate register. Should be maintained for Class \nIII and Class IV staff. The allotment of quarters belonging to Running staff will be made on \nthe basis of seniority-cum-registration as shown in Annexure 'A\". Pool Holders should \nidentify the pool to which a particular quarter belongs on receipt of the vacant list from IOW \nbefore allotment. \n4.The Committee will allot the quarters to the staff strictly as per the registration of the \nstaff. In case, if there are suggestions for \"out of turn\" allotment of quarters because of local \ncircumstances, the case will be put up the DRM by the Committee through DPO. \n5.All the subordinates who are allotting quarters at present should allot the quarters as \nsuggested by the quarter Committees. Registration of quarters with the subordinates will \ncontinue to be made by them. When representatives of each Station Master, IOW, PWI, Loco \nForeman and other subordinates should come with their records to quarter committee and \nshow the quarters vacant committee will allot the quarters to the staff of the subordinates.\n6.The Chairman and the members of the Unit Housing Committee will be fully \nresponsible to ensure that the extant orders of allotment to non-gazette staff are correctly \nfollowed and also to comply with any special instructions including out of turn allotment \ncommunicated by the Divisional Railway Manager. In terms of extant instructions (Board's \nletter dated 22-8-86) separate waiting list have to be maintained for General and SC/ST \nemployees for allotment against 10 % quota for Type I & II and 5% in Type III & IV the \nSC/ST employees who are senior enough and are covered in general list in their turn will be \ngiven allotment from the general pool The special list will be operated only if the \naccommodation provided from the general list falls short of this percentage.\n7.While deciding allotment the earliest registration will be considered first where it is for \nthe original allotment or the change of accommodation.\n8.The staff attached to brake down duties should be given preference for allotment of \nquarters who are required to be called out at any time in case of emergencies. It is therefore \nimperative that nomination of the break down staff should be done only from amongst those \nwho are in occupation of railway quarters nearby so that there may not be any occasions for \nout of turn allotment under this pretext.\n 73\n73", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 74, + "text": "9.Under no circumstances, class IV th quarters be allotted to class III staff without \nSpecific order of Divisional Office. In case Class IV th quarters remain vacant without any \nrequest for occupation such case should be referred to Divisional office.\n10.In case of promotion of staff from Class IV to Class III or from lower grade to higher \ngrade within Class III, the employee can register for higher type of quarter according to his \nentitlement after materialisation of his promotion. Staff promoted from Class IV to Class III \nwill have to register their name afresh, as they will loose their turn on promotion. \n11.Meetings should be held atleast once in a month on a predetermined date if not often. \nWhen the chairman is on leave or otherwise absent, he will nomination an officer who will \nhold the meeting. Similarly, if for any reason one or both the nominated Union \nrepresentations are not in a position to attend the meeting, another office bearer of the same \norganisation at the same station may be deputed along with authority letter by the \nChairman/secretary. In case Union representatives do not attend the meeting on the \nnominated day, the meeting should be held by the Chairman and allotment completed.\n12.All the allotments as a result of the meeting should be issued in an office order as per \nAnnexure \"B\" copied to the Divisional Headquarters for information. If any specific remarks \nare expressed by the Union representatives, which could not be complied with by the \nChairman, the same may also be forwarded to the Divisional Headquarters for information. \nHowever, allotment of the quarters need not pend for any reply from the divisional \nHeadquarters. The Chairman of the Housing Committee should hence make sure that the \nallotment is made correctly is accordance with the extant orders.\n13.The Unit Housing Committee will, not allot out of turn allotment on compassionate \ngrounds, father to son basis, Handicapped ground, Medical ground and also sports account \netc. All such cases should be forwarded with recommendations to the DPO for disposal by the \ncontrolling officer or Chairman unit Housing Committee. Such allotments of quarters will be \nmade by D.R.M.. either on his own motion or otherwise.\n14.Request for mutual exchange in the same pool and the same type of quarter with \nallotment zone can be considered by the Unit Housing Committee, provided the incumbents \nare entitled for the quarters involved, one or both of the requesters are not under orders of \ntransfer or retiring within a period of one year from the date of request. Any mutual requests \ninvolving interchange of pool should be forwarded to DPO for disposal.\n15.All respective IOW's should advise the Chairman in writing the date of vacation of \nquarter every month in first, week indicating the pool to which it belongs.\n16.Quarters are earmarked for the specific categories and should normally be allotted by \ndesignation. However, in case the previous incumbent is permitted to retain the quarters then \nthe new incumbent can register himself for a quarter may also apply for out of turn allotment \nwhich will be considered by Divisional Headquarters on Merit.\n17.Registration of quarter should be obtained from employees on the prescribed form as \nper Annexure 'C'. The employees in their own interest should submit the applications in \nperson to the Chairman. The Chairman in turn shall arrange for an acknowledgement on the \napplication as per Annexure 'D' and register the application immediately to the date of \nsubmission and not the date mentioned in the application. If more than one employee \nsimultaneously turn up for registration of same category of accommodation then the \nregistration will be done according to their seniority.\n18.The Executive Branch Officer, Senior Subordinate controlling the employees who are \nstaying in Railway Quarters will advise the Chairman the date of retirement of the employee \n 74\n74", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 75, + "text": "concerned. The employee should ask for retention of quarters, if he is interested in staying in \nthe quarters after his superannuation or cessation of service, in terms of extant instructions. It \nshould be recommended by the Unit Housing Committee and forwarded to DRM for \nsanction. In all cases of unauthorised occupation of quarters action should be initiated by the \nChairman in co-ordination with the Estate Supervisor of the DRM's Office for initiating \neviction proceedings against the concerned railway servant. The Chairman shall also organise \nsurprise checks frequently of the quarters occupied by a Committee consisting of IOW \nconcerned, EF concerned, a representative of RPF, a representative of CRMs, a representative \nfrom NRMU in his allotment zone for checking unauthorised occupation/subletting etc.\n19.The permission for sharing accommodation will be granted only by the Divisional \nOffice.\n20.The retention and allotment Zones of running staff and other categories of staff shall \nbe continued unchanged.\n21.An uptodate list of quarters belonging to each pool under the control of each Chairman \nUnit Housing Committee along with the register particulars of the staff waiting for quarters \nwill be handedover to Chairman from Divisional Office, by the OS (P) Qrs. and thereafter it \nshall be the responsibility of the Chairman to updated allot the same in terms of instructions \ncontained above.\n22.A copy of the allotment letters as well as vacation memo with the date of occupation and \nthe date of vacation as the case may be should be endorsed to the IOW/Elect. Foreman, \nOS(P) Quarters concerned, Bill Section preparing the paysheet, controlling Unit of Personnel \nBranch of DRM's Office, quarter section and Sr. DAO BB. \n23.Presently senior subordinates are allotting Class IV Quarters to their staff like SMs of \nway side stations PWIs controlling gang staff quarters, LFs and IOWs for their respective \ngroup 'D' Staff. However, the allotment will be made only after the approval by the \nnominated committee.\n24.With the setting up of Unit Housing Committees, the Chairman shall arrange for up dating \nand further registration or requests. At the time of the meeting of the Unit Housing \nCommittee the respective pool holder should present his record of registration and the IOW \nthe list of vacant quarters indicating the Unit to which it belongs. The Quarter Committee \nshall allot it to the senior most registered employee as per turn, taking into account requests, \nmutual exchange etc.\nAllotment of Railway Quarters :\nReservation for allotment of quarters for SC/ST .\n10% of total Qtrs. of Type I and II where no of quarters are more than 50 and 5% of Type III \nand IV Qtrs. A special waiting list should be maintained for the purpose allotment qtrs. for \nSC/ST employees. If the SC/ST employees who are senior enough and are covered to the \ngeneral waiting list they will be allotted from the general quota. The special list would be \noperated only if the accommodation provided in the general list falls short of this percentage. \nThe 10% and 5% quota would be shared as 2:1 ratio for SC/ST employees.\n [RB'S No. E(G) 70 QR 1/6 of 27.7.1992]\nHow Out of turn allotment of Rly Qtrs. be allotted :\nThe out of turn of allotment of Railway Quarters would be done in the following cases.\n 75\n75", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 76, + "text": "1) Staff appointed on compassionate ground when the employee was already occupied \nRailway Qtr. while in service.\n2) Son/Daughter or wife of a Railway employee who are in Railway service when the \nemployee retires.\n3) On Medical ground getting certificate from competent Medical Officer.\n4) Staff belonging SC/ST communities.\n5) Handicapped employees.\n6) Sport persons.\nThe above cases would be allotted by Quarter allotment Committee and would be allotted \nafter the Recommendations.\nSubletting of Railway Quarters :No Railway employees are permitted to sublet the Railway \nQtrs. The staff violating the orders would be charged market rent or the penal rent after the \nfinalisation of DAR-inquiry.\n [RB'S No. E(G) 79/RN-2-117-9-4-1980]\nHow is Damage Rent Rates for unauthorised Occupation of Rly Qtrs.\nIn terms of Railway Boards No. F(X)T/72/RN3/1 of Dt. 23.9.1976 MARKET RENT is to be \nrecovered at 5 times, 4 times, 3 times and 2 times of the Assured rent or 10% of the \nEmoluments. Whichever is higher depending upon the classification of CITY/TOWN. The \nabove said instruction had been withdrawn under Rly.No.dt. 1.4.1989 and hereafter \nDAMAGE RATES for Unauthorised Occupation of Rly Qtrs. should be recovered at the \nfollowing rates w.e.f. 1.11.1997 \nType of Qtrs. Revised Rates per Sq. Meter of plinth area per\n Month w.e.f. 1.11.97\n Class A City Class B Class C& Others\nCLASS I to IV Rs. 49 Rs 37 Rs.33\nCLASS V and Rs. 72 Rs.54 Rs.48\nabove This order of rates would be in force for a period of two years or till further orders. \nOld Cases Rs.42 Rs.32 Rs. 28\nUpto 31.10.97 Rs.60 Rs.45 Rs.40\n[RB'S No. F(X) 1-97/11/5 30.12.97]\nRegularisation of allotment of Railway Qtrs. in the name of eligible dependent of Railway \nemployees who retires or dies while in service.\nThe requests from eligible dependents of deceased Railway employee who are appointed \non compassionate grounds and retired Railway employees may be allowed by the competent \nauthorities on the Railway as under.\n 76\n76", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 77, + "text": "When a Railway servant who has been alloted Railway Qtrs. retires from service or dies \nwhile in service, his/her son, daughter, wife, husband or father may be allotted Railway Qtr. \non out of turn basis provided that the said relation was a Railway employee eligible for Rly \nQtrs. and had been sharing Accommodation with the retiring or deceased Railway employee \nfor at least six months before the date retirement or death and had not claimed any HRA \nduring the period. The same Qtr. may be regularised in the name of eligible relation if he/she \nwas eligible for the QTR of that type or higher type. In other cases eligible below type can be \nallotted.\nRetention of Railway Qtrs.:\n1) Suppose a Railway staff got transfer from one place to another. Which essentially \nrequired charge of Residence. May permit to Retain the Qtr for a period two months on \npayment of Normal Rent. \nOn employees own request to detain the Qtr or education or sickness after application he \nmay further permitted to retain the Qtr for six months after paying double rent.\nFurther detention of Rly Qtr up to the end children's Current Academic session after \npayment of Special Rent, staff who were posted for Training institute may permitted to \nRetain the for a period of two years on normal rent.\nThe rent charges to a Railway Servant in respect of Rly Qtr. supplied should not exceed \n10% of his/her monthly emoluments in respect of pay allotted.\nHowever the Administration may charge a Rent in Excess of 10% the Emoluments from a \nRailway Servant under the following circumstances.\n1) Who is not required or permitted to reside on duty at the station at which the residence is \nsupplied to him.\n2) Who at his own request, is supplied with Accommodation which exceeds that which is \nappropriate to his status.\n3) Who is permitted to sublet the residence.\n4) Who sublet without permission.\n5) Who does not vacate the residence after the cancellation of the allotment.\nRetention of Rly Qtr by Apprentices:\n A Servicing Railway employee who was selected as an Apprentice either departmentally \nor through RRB he is permitted to retain the Railway Qtrs. during his training period.\n On Temporary Transfer:\n During the entire period of temporary transfer staff permitted to Retain the Qtr or Normal \nRent. Mostly for four months. If temporary transfer is converted into permanent he is \npermitted to retain the Qtr for further period as admissible on permanent transfer (i.e. Two \nmonths period on the date of permanent on Normal Rent and further Six months on education \nor self or family member on double rent after producing school certificate or Medical \ncertificate).\n Officers or staff proceeding abroad through RITES-IRCON may be permitted to Retain \nthe Qtr. for two months only on recovery of rent at damage rate.\n 77\n77", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 78, + "text": "On Training:\n A Railway staff who was deputed for Training in any Railway or non-Railway training \ninstitute or to attend seminar conference may be permitted to Retain Railway Quarters on \npayment of Normal Rent. An employee deputed for training in Abroad under any aided \nScheme may be permitted to retain Qtr. on normal rate.\nOn Leave Including Extraordinary Leave :\n A Railway employee who is on leave not exceeding 120 days after sanctioning of leave \ncertificate can Retain the Railway Quarter on Normal Rent.\nOn Retirement:\n When a Railway was retired in normal case or voluntary the employee can be retain the \nRailway Quarter for 4 months on Normal rent, and on children's education or sickness of the \nemployee he can retain the railway quarter for another 4 months on double rent.\nOn Death:\n When a Railway employee who expired while in service, the family of Railway \nemployee can be Retain the quarter for 24 months or normal rent w.e.f. 22.1.99.\nRB'S No. E(G)98 QR-1-11-22-1-99 on Missing Railway Employee:\nWhen a Railway employee was found missing while in service, the family of the Railway \ncan retain the Railway Quarter from the date the FIR lodged for one year on Normal Rent. If \nafter loding FIR upto one year if the employee is not traceable he can retain Railway quarter \nfor another 4 months as the case of retired employee in Normal Rent.\nRB'S No. E(G) 96CRI-36 of 29.1.1997\n Recovery of Rent from other Organisation\n 1) Railwaymen's consumer's Co-operative Societies which do not RUN FAIR PRICE \nshops the RENT to be charged should only cover Maintenance charges at 2 % per Annum on \nthe capital cost plus Muncipal and other Taxes payable under Local laws.\n1) During First year - Nil\n2) During 2nd year and 3rd year –1/4th Rent\n3) During 3rd year- 1/2 Rent\n4) During 4th year - 3/4th Rent\n5) During 5th year - Full Rent\n2) Welfare Organisation\nA Uniform rate of Rs. 100/- should be charged for Accommodations allotted for Handicraft \ncenter.\nHomeopathic Dispensaries \nVocational Training Center\n 78\n78", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 79, + "text": "Social Welfare Centers\nStaff Canteens \nBharat Scout and Guides\nPrivate Managed Schools in Railway Colony\nTemple Committee.\nRecovery of Electrical Charges :\n1) Staff and Teachers of Kendriya Vidyalayas Govt. Schools Departments occupying \nRailway Quarters may be charged at the rates applicable to Railway staff.\n2) Railway Institutes, community Hall, Recognised Union Officers, and other Associations \nmay also charged at the rates applicable to Railway employees SUBJECT TO \nMAXIMUM LIMIT of Consumption decided by CEE.Excess consumption over the \nlimit should be charged at OUTSIDERS Rates.\n [RB'S NO. 93 Elec(G) 150/1 of 13.12.1993]\nStandard Rent of Railway Quarters w.e.f. 1.7.97\n [RB'S No. F(X)-95/11/2 27.2.97] \nType Sq. Mtr. Rate\nType I\nAll Group 'D' Staff\nUp to 25\n25 - 30\n30 - 35\nAbove 35\nRs. 26\nRs. 32\nRs 38\nRs. 42\nType II\nGroup 'C' Staff\nUp to 45\n45 - 50\n50 - 55\nAbove 55\nRs. 52\nRs. 59\nRs 65\nRs. 71\nType III\nGroup 'C' Staff\nUp to 60\n60 -65\n65- 70\nAbove 70\nRs. 80\nRs. 86\nRs 92\nRs. 100\nType IV\nGroup 'C' Staff\nUp to 80\n80 - 90\n90 - 100\n100 –120\nAbove 120\nRs. 114\nRs. 127\nRs 140\nRs. 165\nRs. 210\nType Sq. Mtr. Rate\nType V\nSr. Scale Officers\nUp to 150\n150 - 200\n200 - 250\n250 – 300\n300 - 350\nAbove 350\nRs. 260\nRs. 325\nRs 460\nRs. 525\nRs. 650\nRs. 780\nDAMAGE RENT W.E.F. 1.11.1997\n 79\n79", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Establishment Rules.pdf", + "document_name": "Railway Establishment Rules.pdf", + "document_path": "circulars/Railway Establishment Rules.pdf", + "doc_category": "circular", + "rule_type": "staff_rules", + "priority": 2, + "authority": "Indian Railways", + "description": "Establishment rules governing railway staff service matters", + "is_static": false, + "effective_year": null, + "page_number": 80, + "text": "RB'S No. F(X) 1-97/11/5 of 30.12.1997 \n Revised rates per Sq.Mtr of Plinth Area 1.11.97\nType Class-A Class-B Class-C\nI TO IV Rs. 49 Rs. 37 Rs. 33\nV & Above Rs. 72 Rs. 54 Rs. 48\nType (Old Cases Upto 31.10.97)\nType I TO V Rs. 42 Rs. 32 Rs. 28 \nAbove Type V Rs. 60 Rs. 45 Rs. 4 \n[RB'S NO.F(X)1-97/11/5-Of 30.12.97 (NEW RAISED W.E.F.1.11.97 ] \n[ F(X)1-93/11/2 dt.21.12.95 Old Rates Upto 31.10.97 ] \n 80\n80", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 1, + "text": "GOVERNMENT OF INDIA \nMINISTRY OF RAILWAYS \n(RAILWAY BOARD) \n \n \n \n \n \nINDIAN RAILWAYS \nTRACK MACHINE \nMANUAL \n \n \n \n \n \nSecond Edition \nSeptember, 2019", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 2, + "text": "GOVERNMENT OF INDIA \nMINISTRY OF RAILWAYS \n(RAILWAY BOARD) \n \n \n \n \nINDIAN RAILWAYS \nTRACK MACHINE MANUAL \n \n \n \nSecond Edition \nSeptember, 2019", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 3, + "text": "ii \n \nFOREWORD TO SECOND EDITION TO IRTMM (2019) \n \nIndian Railways Track Machine Manual was first published in March, \n2000. Many new types of Track Machines have since been inducted into Indian \nRailways which needed to be updated in the Manual. It was also being felt that \nsome of the topics like tamping technology, technical detail of machines, \nmaintenance infrastructure, organizational structure etc. need to be \ndeliberated in more detail for better apprehension by field staff. Accordingly, \nsecond revision of Indian Railways Track Machine Manual has been prepared \nafter including all types of machines working on Indian Railways, tamping \ntechnology, organizational structure of Track Machine\n and procedure for data \nentry in TMS. \nI am happy to note that now Indian Railways Track Machine Manual, \ncoverin g every aspect of the track machine working, is being published. It is \nhoped that this manual will be very useful to the officers and staff associated \nwith track machine as well as Permanent Way maintenance. \n \n \n \n \n \n \n \n \n \nNew Delhi \nSeptember, 2019 \nVishwesh Chaube \nMember Engineering \nRailway Board, New Delhi", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 4, + "text": "iii \n \nFOREWORD TO FIRST EDITION TO IRTMM \n \nMechanized track laying and maintenance has been introduced in a big \nway on Indian Railways to meet the challenges of growing traffic and changed \nsocio-economic conditions. \n Based on the field experience and recommendations by the machine \nmanufacturers, numbers of instructions have been issued from time to time by \nthe zonal railways and Railway Board. However, these were not documented at \none place. \n I am happy to note that now Indian Railways Track Machine Manual, \ncovering every aspect of the track machine working, has been published. It is \nhoped that this manual will be quite useful to the officers and staff associated \nwith track machine as well as Permanent Way maintenance. \n \nNew Delhi \n23rd March, 2000 \nV.K.Agnihotri \nMember Engineering \nRailway Board \nNew Delhi", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 5, + "text": "iv \n \nPREFACE TO SECOND EDITION \n“Indian Railways Track Machine Manual” was published in 2000 for the guidance \nof the officials of Track Machine and Open Line/Construction organization. \nMechanisation of track maintenance over IR s tated with induction of 4 nos. o f \n(B-60) on -track tamping machine of MATISA make d uring 1963. Now the fleet of track \nmachines on Indian Railways has grown from 4 No. (B -60) on -Track Tampers to 904 (as \non 01 -12-2018) track machines covering almost all spheres of track maintenance and \ntrack laying/renewal activities. Railway Board appoin ted a committee to review and \nrevise the Track Machine Manual – 2000 vide Letter No. 96/Track -III/TK/44 Vol. II dated \n02-11-2015 based on latest developments, provisions and working rules with due \nconsideration to provisions of IRPWM, G&SR and other codes/ manuals, \ninstructions/JPOs issues by Zonal Railways, instructions regarding operation, \nmaintenance, troubleshooting manuals etc. of OEMs & RDSO. \nFollowing members of committee as nominated by Railway Board either by \nname or by virtue of post participated during meetings and finalized the draft of this \nmanual – \nSl. No. Designation Name (S/Shri) \n1 Executive Director (TM), RDSO Brijesh Kumar \n Mudit Bhatnagar \n2 Senior Professor, Track, IRICEN Chandra Shekhar Sharma \n3 Chief Engineer/TM, Central Railway Naresh Lalwani \n Pradeep Kumar Garg \n4 Chief Engineer/TM, Western Railway Vivek Kumar Gupta \n5 Chief Engineer/TM, North Central Railway C. P. Gupta \n6 Chief Engineer/TM, South Central Railway Gautam Srinivas \n Rakesh Yadav \n7 Chief Engineer/TM, East Central Railway Vijay Kumar Sahu \nS/Shri Anil Choudhary/Director/TM -III/RDSO, Sanjay Asthana/Executive \nEngineer/NCR, Muslim Ahmed/Assistant Research Engineer/TM/RDSO and S. D. \nMahajan/Assistant Engineer /TM/ Western Railway rendered the v aluable assistance \nand contributions to committee during deliberations and preparation of this manual. \nThe committee also received valuable inputs and contribution from S/Sh. A.K. \nKhandelwal/Executive Director Track (MC)/Railway Board & Tushar Kant \nPandey/ Director Track (MC)/Railway Board. I hope this de tailed and reviewed version \nof m anual will be very useful for the field staff and will succeed in its purpose of \ndisseminating the art of track maintenance using sophisticated Track machines to the \nfield en gineers. \nAny comments and suggestions from the reader regarding any \ncorrection/further improvement for the manual will be highly appreciated. \n \nNew Delhi \nSeptember, 2019 \nRakesh Goyal \n Additional Member/Civil Engg. \nRailway Board, New Delhi", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 6, + "text": "v \n \nPREFACE TO FIRST EDITION \n Track Machines were introduced on Indian Railways during the early \nsixties. The use of the machines both for maintenance as well as track laying \nincreased with the introduction of heavy track structures. For working of these \nmachines, instructions had been issued by the Railway Board and Zonal \nRailways from time to time. However, no manual as such was issued on track \nmachines. Under these circumstances, Railway Board vide their letter \nno.96/Track -III/TK/84 dated 11 -12-96 appointed a committee for preparation of \nthe manual, of Director/IRICEN, Executive Director (TM)/RDSO, Executive \nDirector Track (MC)/Railway Board and Chief Track Engineer s (MC) of Northern, \nSouthern and South Central Railways. The following officers participated in the \ncommittee from time to time: - \nDesignation Name \nDirector, IRICEN \n(Chairman) \nShri Vinod Kumar \n \nExecutive Director (TM)/RDSO S/Shri \ni) A.P. Mishra \nii) O.P. Agrawal \niii) Dharm Singh \nExecutive Director Track (MC)/ \n Rly Board \nS/Shri \ni) R.N. Verma \nii) V. K. Agrawal \nChief Track Engineer (MC)/N.Rly S/Shri \ni) S. K. Vij \nii) A.P. Mishra \niii) Harjinder Singh \nChief Track Engineer (MC)/S.C.Rly S/Shri \ni) N. Ramasubramanian \nii) P.N. Ram \nChief Track Engineer(MC)/S.Rly S/Shri \ni) A.N. Parakalan \nii) S.ParameshwaraIyer \niii) K.J.S. Naidu", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 7, + "text": "vi \n \n The committee held its first meeting on 10- 04-97 at IRICEN/Pune. Subject \nmatter of various chapters of the manual was discussed by the committee \nduring subsequent sittings. Draft of the manual was finalised and circulated to \nZonal Railways for suggestions, vide Railway Board’s letter no. 96/Track -\nIII/TK/44 dated 08 -06-98. In the light of comments/suggestions received from \nthe railways, original draft was finalised with modifications as considered \nnecessary. The prevailing instructions in regard to working of track machines \nover different railways, instructions issued by Railway Board, provisions in the \nIRPWM, Indian Railway General Rules, other relevant codes/manuals and \ncirculars issued by RDSO, had also been kept in view while preparing this \nmanual. \n While every effort has been made to cover all a spects of track machine \nworking, the Chief Engineers of zonal railways may issue such supplementary \ninstructions as necessary to suit local conditions on the railways. Such \ninstructions, however, should not contravene any of the provision in this \nmanual and other codes. \n The committee was rendered valuable assistance and contributions by \nS/Shri C.P. Tayal, Sr. Processor/IRICEN; Hitesh Khanna, Director Track (MC)/Rly \nBoard an d J. S. Mahrok, Director/TM RDSO, during deliberation and preparation \nof this manual. \n Though every care has been taken in preparing this manual, any error or \nomission, if found, may be brought to the notice of Railway Board. Suggestions \nfor further improv ement in this manual will be welcome. \nThis manual has been issued in consultation with Finance and Traffic \nDirectorates of Railway Board. \n \nNew Delhi N. C. Bindlish \nMarch 10, 2000. Additional Member/Civil Engg. \n Railway Board, New Delhi.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 8, + "text": "vii \n \nCONTENTS \nPara Details Page No \n CHAPTER 1 \nORGANISATIONAL STRUCTURE, DUTIES AND INSPECTIONS \nPART A - ORGANISATIONAL STRUCTURE AND DUTIES \n \n \n1-17 \n101 Track Machine Organisation – Role 1 \n102 Functions and Organisation 2 \n (1) Functions of Track Machines Organisation \n (2) Organisation at Zonal Railway HQ \n (3) Field Organisation on Zonal Railway \n (4) Central Periodic Overhauling (CPOH) Workshop \n103 Duties of Executive (XEN)/Assistant Executive Engineer (AXEN)/TM/Line 3 \n (1) General \n (2) Observance of Rules and Regulations \n (3) Inspection by Higher Officers \n104 Duties of SSE/TM/SDI 5 \n105 Duties of SSE/TM(SD) 6 \n106 Duties of SSE/JE/TM Working on Machines 6 \n107 Duties of SSE/JE Machine In-Charge 7 \n108 Duties of SSE/JE/MCM/TMM in Control set up in HQ/ZMD/Division 8 \n109 Duties of Master Crafts Man (MCM) and Track Machine Maintainers (TMM) 8 \n110 Duties of Machine Assistant 8 \n111 Duties of Assistant Divisional Engineer (Open Line) ADEN 9 \n112 Duties of SSE/JE (P.Way) Deployed with the Machine 10 \n PART B – INSPECTION OF TRACK MACHINES \n113 Inspection Schedule of Track Machine Officials 11 \n114 Inspection Schedule of Open Line Officials 11 \n115 Items to be Inspected 12 \n (1) Inspecting Officials of TMO as well as Open Line \n (2) Inspecting Officials of TMO- Additional Items \n (3) Inspecting Official of Open line - Additional Items \n \n CHAPTER 2 \n TAMPING MACHINE AND DYNAMIC TRACK STABILIZER 18-98 \n201 General 18 \n202 Tamping Machine 18 \n (1) Functions \n (2) General Layout \n203 Important Assemblies of Tamping Machines 18 \n (1) Engine \n (2) Tamping Units \n (3) Tamping Tool", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 9, + "text": "viii \n \n (4) Lifting and Lining Unit \n (5) Satellite Unit \n (6) Trolleys \n (7) Brake System \n204 Types of Tamping Machines 21 \n (1) Tampers without Satellite Unit \n (2) Tampers with Satellite Unit \n205 Tamping Mechanism 23 \n206 Tamping Parameters 24 \n (1) Squeezing Pressure \n (2) Tamping Depth \n (3) Tamping Tool Vibration, Amplitude & Frequency \n (4) Vibration Pressure \n (5) Tamping Cycle & Squeezing Time \n (6) Tamping Tool Surface Area \n207 Optional Equipment 27 \n (1) Laser Beam System \n (2) Geometry Value Assessment (GVA) \n (3) Automatic Guiding Computer (ALC) System \n (4) Data Recording Processor (DRP) System \n (5) Computerized Measuring System (CMS) \n (6) Computerized Working System (CWS) \n208 Lining System 28 \n (1) Reference Rail \n (2) Lining Method \n209 4 Point Lining Method 29 \n (1) Lining Principle \n (2) Application of 4-Point Lining Method \n210 Corrections to be Applied in 4 Point Lining Method 31 \n (1) Correction (FD) \n (2) Versine Compensation (V) \n211 Modes of Tamping using 4-Point Lining Method (Only for curves) 38 \n (1) 4-Point Smoothening or Compensation Mode \n (2) 4- Point Design Lining \n212 3 Point Lining Method 39 \n (1) Lining Principle \n (2) Application of 3-Point Lining Method \n213 Corrections to be applied in 3- Point Lining 40 \n214 Determination of Target Versine Values for the 3-Point Lining Method 41 \n (1) Curve with Parabolic Transitions \n (2) Curve without Transition \n215 Mode of Tamping using 3-Point Lining Method 45 \n (1) 3- Point Elementary Mode Lining \n (2) 3- Point Design Mode Lining", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 10, + "text": "ix \n \n (3) Measuring Run (with ALC) Lining Modes \n216 Comparison between 3 Point and 4 Point Lining System 46 \n (1) 3-Point Lining elementary mode/4-point Lining Smoothening Mode \n (2) 3 -Point Lining /4-point Lining in Design Mode \n217 Levelling of Track 48 \n (1) Datum Rail and Cant Rail \n (2) Selector Switch \n218 Levelling and Lifting System 48 \n (1) Equipment \n (2) Working \n (3) Reduction Ratio \n (4) Reduction Ratio of Various Machines \n219 Mode of working for levelling 50 \n (1) Smoothening or Compensation Levelling Mode \n (2) Design or Precision Levelling mode \n (3) Measuring Run (ALC) Levelling Mode \n220 General Lift 51 \n (1) Deciding General Lift \n (2) Quantum of General Lift \n (3) General Lift on Curves \n221 Ramp in Ramp Out 52 \n (1) Value of Ramp \n (2) Method of Ramping \n (3) Feeding of Ramp Values \n222 Input of the Lifting Values 53 \n (1) Method of feeding of Cant in Curves \n (2) Correction (K) in Cross-Level \n (3) Attention to Vertical Curve \n223 Survey and working of Tamping Machines in Design Mode 57 \n224 Works required Before, During and After Tamping 57 \n (1) General \n (2) Preparatory Works \n (3) Pre-Tamping Works \n (4) Operations During Tamping \n (5) Post Tamping Operations \n225 Dynamic Track Stabilizer (DTS) 63 \n (1) General \n (2) General Layout \n \n \n(3) \n(4) \nAdvantages of DTS \nBrake System \n \n226 Working Principle of Dynamic Track Stabilizer 64 \n (1) Mechanism of DTS \n (2) Levelling System in DTS \n (3) Speed of Working of DTS", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 11, + "text": "x \n \n (4) Stabilization Achieved by DTS \n227 Modes of working of Dynamic Track Stabilizer 65 \n (1) Maximum Settlement/Constant Pre Load Mode \n (2) Controlled Settlement/Variable Pre Load Mode \n228 Types of Dynamic Track Stabilizer 65 \n (1) Types of DTS \n (2) Salient Features of Different DTS \n229 Working of DTS 67 \n (1) General \n (2) Precautions in DTS Working \n Annexure-2.1 : Position of Tamping Tools In Tamping Machines 70 \n Annexure 2.2 : Important Features/Dimensions of DUOMATIC & WST \nMETEX \n72 \n Annexure-2.3 : Important Features/Dimensions of Points & Crossing \nTamping Machine \n73 \n Annexure- 2.4 : Important Features/Dimensions of UNIMAT Split Head \nMFI & Multipurpose Tamping Machine \n74 \n Annexure- 2.5 : Important Features/Dimensions of Continuous Tamping \nMachine 09-32-CSM \n75 \n Annexure- 2.6 : Important Features/Dimensions of Tamping Express (09 -\n3X) (Plain Track Tampers) of Different Models \n76 \n Annexure- 2.7 : Laser Sighting System 77 \n Annexure- 2.8 : Automatic Guiding Computer (ALC) System 79 \n Annexure- 2.9 : Machine Trolley Distances 81 \n Annexure- 2.10 : Sample - Versine Compensation (V) 82 \n Annexure- 2.11 : Sample- F Values 83 \n Annexure- 2.12 : Example- Sequence of Tamping of Track by WST 08-32C 84 \n Annexure- 2.13 : Example – Ramp In and Ramp Out 88 \n Annexure- 2.14 : Sample - Correction (K) for Curvature 91 \n Annexure- 2.15 : Sample - Value of X for Vertical Curves 92 \n Annexure- 2.16 : Guidelines for Surveying of Track for getting Offset values \nfor Design Mode of Tamping \n93 \n Annexure- 2.17 : Sequence of Tamping of Different Points & Crossing \n(UNIMAT-2S) \n96 \n \n CHAPTER 3 \n BALLAST CLEANING AND HANDLING MACHINES 99-129 \n301 General 99 \n302 Ballast Cleaning Machines (BCM) 99 \n303 Important Assemblies of Ballast Cleaning Machines 100 \n (1) Engine \n (2) Excavating Unit \n (3) Screening Unit \n (4) Conveyer System for Distribution of Ballast and Disposal of Muck", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 12, + "text": "xi \n \n (5) Track Lifting and Slewing Unit \n (6) Recording Unit \n (7) Brake System \n304 Types of Ballast Cleaning Machines 101 \n (1) Plain Track Ballast Cleaning Machine \n (2) Points and Crossing Ballast Cleaning Machine \n (3) Plain Track and Points & Crossing Ballast Cleaning Machine \n305 Working Principle and Capability of Ballast Cleaning Machines 102 \n (1) Excavation Width \n (2) Excavation Depth \n (3) Lifting and Slewing of Track \n (4) Disposal of Muck \n (5) Screening Capacity of BCM \n (6) Controlled Ballast Distribution \n (7) Total Excavation \n (8) Deep Screening of Points and Crossing \n306 Works Required Before, During and After Deployment of Ballast Cleaning \nMachines \n106 \n (1) Introduction of Ballast Cleaning Machines for Plain Track and Turnouts \n (2) Preparatory Works \n (3) Operations During Traffic Block \n (4) Operations after Deployment of Machine \n307 Shoulder Ballast Cleaning Machine (SBCM) 111 \n308 Important Assemblies of Shoulder Ballast Cleaning Machines 111 \n (1) Engine \n (2) Excavating Unit \n (3) Screening Unit \n (4) Conveyor System for Distribution of Ballast and Disposal of Muck \n (5) Ballast Profiling Plough \n (6) Broom \n (7) Brake System \n309 Types of Shoulder Ballast Cleaning Machines 112 \n (1) Shoulder Ballast Cleaning Machine - FRM 80 \n (2) Shoulder Ballast Cleaning Machine - FRM 85 \n310 Capacity of Shoulder Ballast Cleaning Machines 112 \n (1) Width of Excavation \n (2) Depth of Excavation \n (3) Muck Disposal System \n (4) Ballast Distribution System \n (5) Screening Capacity \n (6) Total Excavation \n311 Works Required Before, During and After Deployment of Shoulder Ballast \nCleaning Machines \n113 \n (1) Operations Prior to Deployment of Machine", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 13, + "text": "xii \n \n (2) Operations During Block \n312 Ballast Regulating Machine (BRM) 114 \n313 Important Assemblies of Ballast Regulating Machines 114 \n (1) Shoulder Plough \n (2) Front Plough \n (3) Centre Plough \n (4) Broom \n (5) Hopper \n (6) Rail Fastening Sweepers \n (7) Welded-on-Tunnels for covering Rail and Fastenings \n (8) Brake System \n314 Types of BRM 115 \n (1) Without Hopper \n (2) With Hopper \n315 Working Principle and Capacity of Ballast Regulating Machines 116 \n (1) The Regulation Width \n (2) Ballast Handling Capacity \n316 Works Required Before and During Deployment of Ballast Regulating \nMachines \n119 \n (1) Operations Prior to Deployment of Machine \n (2) Operations During Block \n Annexure-3.1 : Important Features/Dimensions of Ballast Cleaning \nMachine (RM-80) \n121 \n Annexure-3.2 : Important Features/Dimensions of Ballast Cleaning \nMachine (RM-76 & RM-80-92U) \n122 \n Annexure-3.3 : Important Features/Dimensions of Shoulder Ballast \nCleaning Machine (FRM-80) \n123 \n Annexure-3.4 : Important Features/Dimensions of Shoulder Ballast \nCleaning Machine (FRM-85 F) \n124 \n Annexure-3.5 : Important Features/Dimensions of Ballast Regulating \nMachine (Model - 56-3 & 66-4) \n125 \n Annexure-3.6 : Important Features/Dimensions of Ballast Regulating \nMachine (Model BRM PBR 400R) \n126 \n Annexure-3.7 : Important Features/Dimensions of Ballast Regulating \nMachine (GEMAC) \n127 \n Annexure-3.8 : Important Features/Dimensions of Ballast Regulating \nMachine (BRM 2000 SWS) \n128 \n Annexure-3.9 : Important Features/Dimensions of Ballast Regulating \nMachine (BRM METEX) \n129 \n \n CHAPTER 4 \n TRACK RELAYING MACHINES 130-154 \n401 Track Relaying Machines 130 \n402 Planning for Working of Track Relaying Machines 130", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 14, + "text": "xiii \n \n403 Track Laying Equipment (TLE) 130 \n404 Important Assemblies of Track Laying Equipment (TLE) 130 \n (1) Side Frames \n (2) Bridge \n (3) Sleeper Gripper \n (4) Rail Clamps \n (5) Turn Table \n405 Types of Track Laying Equipment 131 \n406 Working Mechanism and Capability of Track Laying Equipment 131 \n407 Setting-up of TLE Base Depot 133 \n408 Pre-Relaying Operations 136 \n (1) At Base Depot \n (2) At Work-Site \n409 Operation During Block 138 \n410 Post Relaying Operations 139 \n411 Track Relaying Train (TRT) 139 \n (1) Functions of TRT \n (2) Works by TRT \n (3) Advantages of TRT \n (4) General Layout \n412 Important Units of TRT- Model No. P 811-S 140 \n (1) Beam Car \n (2) Handling Car \n (3) Power Car \n413 Working Mechanism of TRT 140 \n414 Operations Prior to Deployment of TRT 142 \n415 Operations During The Block of TRT 144 \n416 Post Block Operations for TRT 144 \n417 Precautions During TRT Working 145 \n418 Points and Crossing Laying/Changing Machine (PCCM) 145 \n419 Important Units of AMECA T-28 145 \n (1) Portal Crane \n (2) Trolleys \n (3) Jib Crane \n420 Working Mechanism and Capability of AMECA T- 28 147 \n (1) Longitudinal/Forward Launching \n (2) Transverse/Side Launching \n421 Pre-Block Operations of T-28 M/c 149 \n422 Operations During Block of T-28 M/c 150 \n423 Post Block Operations of T-28 M/c 151 \n424 Miscellaneous 151 \n Annexure- 4.1 : Important Features/Dimensions of Track Relaying \nMachine \n152 \n Annexure- 4.2 : Important Features/Dimensions of Track Relaying Train 153", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 15, + "text": "xiv \n \n Annexure -4.3 : Important Features/Dimensions of Points & Crossing \nChanging Machine (AMECA T-28) \n154 \n \nCHAPTER 5 \n \nSPECIAL PURPOSE MACHINES 155-183 \n501 Rail Grinding Machine (RGM) 155 \n (1) Purpose of Rail Grinding \n (2) Advantages of Rail Grinding \n502 Important Assemblies of RGM 156 \n (1) Components of RGM \n (2) Front Control Car (FCC) \n (3) Grind Car \n (4) Water Tank Wagon \n (5) Camp Coach Cum Rear Control Car (RCC) \n (6) Rail Corrugation Analyzer (RCA) \n (7) Obstacle Detection System \n (8) Rail Profile Measurement System (Optical) \n (9) Dust Collection System \n (10) Brake System \n503 Grinding Strategy 159 \n (1) Strategy \n (2) Corrective Grinding \n (3) Preventive Grinding \n (4) Preventive-Gradual Grinding \n (5) Target Rail Profiles \n (6) Patterns \n (7) Grind Data Management System (GDMS) \n (8) Grind Quality Index (GQI) \n504 Capability of RGM 161 \n505 Working Parameters of RGM 162 \n (1) General \n (2) Target Profile \n (3) Rail Wheel Contact Points \n (4) Selection of Target Profile \n (5) Grind Patterns \n (6) Grind Cycle \n506 Monitoring Equipment for Grind Quality 164 \n (1) MINIPROF \n (2) Bar Gauge \n (3) Star Gauge \n (4) Digital Inclinometer \n (5) Surface Roughness Measuring Gauge \n (6) Rail Hardness \n507 Working of RGM 165", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 16, + "text": "xv \n \n508 Quality Inspection of Grinding 165 \n (1) Test Site Monitoring \n (2) Other Quality Checks \n509 Preparatory Works for Introduction of RGM 167 \n510 Pre-Block Activity Before Deploying RGM 168 \n511 Operation During RGM Block 168 \n (1) On the Track \n (2) On the Machine \n512 Post Grinding Operation 170 \n513 Utility Track Vehicle 170 \n (1) General \n (2) Main Assemblies of UTV and their Functions \n (3) Models of UTVs \n514 Rail Borne Maintenance Vehicle 172 \n (1) General \n (2) Main Assemblies of RBMV and their Functions \n (3) Salient Features of RBMV \n515 Works Required Before, During and After Deployment of UTVs and RBMV’s 173 \n Annexure-5.1 : Important Features/Dimensions of RGI Control Car 175 \n Annexure-5.2 : Pattern Sheet 176 \n Annexure-5.3 : Proforma for Data to be Fed in GDMS 177 \n Annexure-5.4 : Rail Grinding Monitoring Proforma 179 \n Annexure-5.5 : Important Features/Dimensions of Utility Track Vehicle & \nRail Borne Maintenance Vehicle \n \n183 \nCHAPTER 6 \nPLANNING AND DEPLOYMENT 184-190 \n601 Planning 184 \n602 Pre-requisites for Deployment of Track Machines on Construction \nProjects/Other Agencies \n185 \n603 Inter- Railways Deployment 186 \n604 Line Blocks, Stipulated Corridors and Monitoring 187 \n605 Types of Blocks 187 \n (1) Regular Traffic Blocks \n (2) Blocks on Construction Projects and Multiple Lines \n (3) Special Blocks \n606 Minimum Duration of Blocks 188 \n607 Measures for Ensuring Block 189 \n608 Through Tamping and Spot Attention 189 \n (1) Types of Tamping \n (2) Tamping Frequency", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 17, + "text": "xvi \n \nCHAPTER 7 \nRULES FOR MOVEMENT AND BLOCK WORKING 191-232 \n701 General 191 \n (1) Categorization of Track Machines \n (2) Self-Propelled Track Machines \n (3) Provision of G&SR \n (4) Knowledge of G&SR \n (5) Manning of Track Machines and Possession of Safety Equipment \n (6) Salient information of Track Machine \n702 Operation and Working of Track Machine 192 \n (1) Responsibility of Track Machines \n (2) Supervision of work of Track Machines \n (3) Working – General \n703 Competencies of Track Machine Staff 194 \n (1) Medical Fitness and PME \n (2) Technical Training \n (3) G & SR Training \n (4) Route/Road Learning \n (5) Competency Certificate \n704 Safety Equipment 195 \n (1) General \n (2) Head and Tail Lights \n705 Rules for Operation – General 196 \n (1) Stabling of Track Machines \n (2) Shunting of Track Machines \n (3) Machine Ready Memo \n (4) Movement of Track Machines \n (5) Working in Group \n (6) Run Through Movement in Group \n (7) Working of Track Machine in Block \n (8) Working in Automatic Block Sections \n (9) Working in Integrated Traffic Blocks \n (10) Use of Cell Phone on Track Machine \n (11) Requirement of Pilot \n (12) SSE/JE(P.way) as Guard \n706 Working Of Track Machines In Single and Double Line Sections 198 \n (1) Single Line Section – Work and Proceed \n (2) Single Line Section – Work and Return \n (3) Double Line Section – Work and Proceed \n (4) Double Line Section - Work and Return \n707 Important Instructions and Precautions 201 \n (1) Protection of Work Site \n (2) Fouling of Adjacent Lines \n (3) Information to Level Crossings", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 18, + "text": "xvii \n \n (4) Safe Distance and Speed of Machine in Group \n (5) Setting of Points of Stabling Siding \n (6) Shunting in Line occupied by Track Machine \n (7) Safety of Men \n (8) Checking Infringement After Work \n708 Failure and Accidents of Track Machines 203 \n (1) Protection in case of Breakdown \n (2) Failures in Block Section \n (3) Accidents involving Track Machine \n (4) Action in case of Failure in Block \n (5) Request for ART/Breakdown \n709 Permissible Speed 204 \n710 Speed Certification for Track Machines 204 \n (1) Speed Certification for New type of Track Machine for Regular Movement \n (2) Sanction for running of Machine by other Zonal Railways \n (3) One Time Movement of New Machine \n711 Infringements 209 \n712 Special Precautions while working in Special Circumstances 210 \n (1) Working of Machines in Ghat Sections \n (2) Night Working \n Annexure- 7.1 : List of Standard Forms 212 \n Annexure- 7.2 : Personal Diary 214 \n Annexure -7.3 : Competency Certificate 219 \n Annexure- 7.4 : Proforma of Machine Ready Memo 220 \n Annexure -7.5 : Proforma of Block Permit 221 \n Annexure -7.6 : Instructions for Machine Working in Automatic Signalling \nSection \n222 \n Annexure -7.7 : Infringement to Indian Railways Schedule of Dimension by \nVarious Track Machines \n225 \n \nCHAPTER 8 \nPERIODICAL MAINTENANCE AND ASSOCIATED INFRASTRUCTURAL FACILITY 233-275 \n801 General 233 \n802 Maintenance Schedule for Track Machines 233 \n (1) Maintenance Schedule for Various Track Machine \n (2) Inspection of Wheel and Axle of On-Track Machine \n803 Types of Workshops 235 \n804 Central Periodical Overhauling Workshop (CPOH) 236 \n (1) Functions of CPOH \n (2) POH Planning for Track Machines to be Attended \n (3) POH Execution \n (4) Dispatch of Machine after POH \n805 Intermediate Overhauling Workshop (IOH)/Zonal Machine Depot (ZMD) 238 \n (1) Functions of ZMD", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 19, + "text": "xviii \n \n (2) Facilities at ZMD \n (3) Programme of IOH & POH \n (4) Planning of IOH \n806 Satellite Depot 240 \n (1) Functions of Satellite Depot \n (2) Facilities at Satellite Depot \n807 Mobile Workshop-cum-Transport Van 240 \n (1) Functions of Mobile Workshop \n (2) Facilities in Mobile Workshop \n808 Camping Coach Workshop 240 \n (1) Functions of Camping Coach Workshop \n (2) Facilities in Camping Coach Workshop \n809 Infrastructure Facility for Operation and Maintenance of Track Machines 241 \n (1) Infrastructural Facilities for CPOH, ZMD and Satellite Depot \n (2) Storage and Carriage Facilities for Fuel and Oil \n (3) Transportation of Spare Parts & Assemblies \n (4) Communication Facilities \n (5) Repairs and Stabling Facilities for Machines \n (6) Resting & Cooking Facilities for Staff \n810 Camp Coach Facilities 242 \n (1) Living Area \n (2) Kitchen \n (3) Bathing Area & Toilet \n (4) Electrification Plan \n (5) Store Management \n Annexure- 8.1 : Maintenance Schedule of Track machines 245 \n Annexure -8.2 : Formats for POH Planning 240 \n Annexure -8.3 : POH Flow Chart 247 \n Annexure -8.4 : Requirement of Facilities in Various Depots 248 \n Annexure -8.5 : Machine wise list of 'Masters' required for Calibration of \nParameters \n257 \n Annexure -8.6 : Format for Master Calibration 261 \n Annexure -8.7 : Format for Repair Summary Sheet for POH 262 \n Annexure -8.8 : Format for 90 Days Feedback of POH 263 \n Annexure -8.9 : Typical Facilities to be provide in a Mobile Workshop 265 \n Annexure -8.10 : List of Equipment to be kept in Camp Coach Workshop 266 \n Annexure -8.11 : Typical Layout of Track Machine Siding 267 \n Annexure -8.12 : Rest House for Track Machine Staff 268 \n Annexure -8.13 : Layout of Camping Coach (Based on RDSO Drg. No.CSC -\n1592) \n269 \n Annexure -8.14 : Layout of Camping Coach (Based on RDSO Drg. No.CSC -\n1640) \n270 \n Annexure -8.15 : Layout of Camping Coach (Based on RDSO Drg. No.CSC -\n1686) \n271", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 20, + "text": "xix \n \n Annexure -8.16 : Amenities to be provided in Camping Coaches 272 \n Annexure -8.17 : Paint Scheme for Camping Coach 274 \n Annexure -8.18 Electric Circuit Diagram of Camping Coach 275 \n \nCHAPTER 9 \nMANPOWER 276-285 \n901 General 276 \n902 Requirement of Manpower 276 \n903 Training 276 \n (1) Officers \n (2) SSEs/JEs/TM(s) \n (3) Technical Staff \n (4) Machine Assistant \n904 Roster 277 \n (1) Weekly Roster \n (2) Three Weeks Roster \n (3) Duty Hours for Field \n (4) Duty Hours for Zonal Depot and Satellite Depot \n (5) Duty Hours for HQ Office & Control \n Annexure- 9.1 : Weightage Factors for Track Machines and Yardsticks for \nstaff \n279 \n Annexure-9.2 : Scale of Staff for Repairs and Maintenance for POH - \nCPOH Workshop \n283 \n Annexure-9.3 : Man Power for POH of 24 Track Machine Units and 200 \nTamping Banks \n284 \n Annexure-9.4 : Man Power for POH of 50 Track Machine Units and 200 \nTamping Banks \n \n285 \nCHAPTER 10 \nSTORES AND CONTRACTS 286-294 \n1001 Store Depot 286 \n1002 Inventory Control 286 \n1003 Procurement of Consumables, Components and Spares 288 \n1004 Sourcing of Components & Spares and Procurement Procedure 288 \n1005 Inspection and Acceptance of Materials 290 \n1006 Modes of Procurement, Repairs and Maintenance 290 \n (1) Cash Imprest \n (2) Emergency Repairs/Purchase \n (3) Annual Maintenance Contract (AMCs) \n (4) Contracts other than AMCs \n1007 Condemnation of Track Machine 291 \n1008 Codal Life of Machines And POH/IOH Frequencies 291 \n1009 Calculation of Unit Cost of Working of Different Track Machines 292 \n (1) Capital Recovery Factor", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 21, + "text": "xx \n \n (2) Codal Life of Machines \n (3) Proportional POH and IOH Cost \n (4) Fixed and Variable Cost \n (5) Working and Approval of Unit Cost \n \n \nCHAPTER 11 \nMONITORING 295-311 \n1101 GENERAL 295 \n (1) Data Collection & Entry \n (2) Generation of Reports and Alerts \n (3) Periodical Meetings \n1102 Organization for Monitoring 298 \n (1) Track Machine Control at Headquarters \n (2) Track Machine Control at Zonal Maintenance Depot (ZMD) Level \n (3) Divisional Control \n (4) Satellite Depot (SD) \n1103 Functions of Divisional Control in respect of Track Machines 299 \n1104 Functions of Track Machine Control at ZMD Level 299 \n1105 Functions of Track Machine Control at Headquarter Level 300 \n1106 Monitoring Modules of Track Machines 301 \n (1) Parameters for Monitoring Productivity and Utilization of Machines \n (2) Parameters for Monitoring Health of Machine \n1107 Reports and Documentation for Track Machines 303 \n (1) Daily Performance Report \n (2) Daily Log \n (3) Breakdown Report \n (4) Monthly Appreciation Report \n (5) Monthly Summary \n (6) Record for 3 years \n1108 Track Management System (TMS) – Present Module 304 \n Annexure-11.1 : Track Machines Organization 306 \n Annexure-11.2 : Breakdown Report of Track Machine 309 \n Annexure-11.3 : Types of Reports in TMS \n \n310 \n LIST OF ABBREVIATIONS 312-316", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 22, + "text": "1 \n \nCHAPTER 1 \nORGANISATIONAL STRUCTURE, DUTIES AND INSPECTIONS \nPART A - ORGANISATIONAL STRUCTURE AND DUTIES \n101 Track Machine Organisation – Role \n(1) Track Machine Organisation on Zonal Railway will be the custodian of on -track \nmachines and will be responsible for making the machines available as per the \napproved deployment programme with requisite staff for efficient working of the \nmachines. Each zone shall have at least one zonal maintenance depot and each \ndivision shall have at least one satellite depot for overhauling, repair & \nmaintenance of machines. \n(2) Track Machine Organization will maintain machines in good condition. The \nperiodical schedules for maintenance of the machines shall be drawn out and the \ndivisions will be advised of the same in advance. IOH and POH should be catered for \nand shown in the annual deployment programme. Scheduled maintenance \nactivities could be combined with breakdown repair s wherever possible instead of \nidling the machine exclusively for such activities. \n(3) Track Machine Organisation will monitor the output of machines for quality and \nperformance with respect to blocks given. \n(4) Track Machine Organization shall strive for development of its officials and staff to \nbe technically sound, professionally competent, medically fit and safety conscious. \nAll efforts shall be made to impart necessary training – technical as well as G&SR, \nroad learning etc. timely and effectively. \n(5) Before giving the machine ready for block working, after daily schedule, the \nmachine shall be checked as per stipulations of OEM’s manuals/RDSO instructions \nfor ensuring trouble-free working. \n(6) Immediately after major schedules/repairs of the machine, performan ce of \nmachine shall be closely monitored for the first few blocks. \n(7) In the event of breakdowns of machine in block, immediate action should be taken \nto rectify the defect. In case it is not possible to rectify the defect in the block, all \nefforts should be made to clear the block section as early as possible to avoid \ndetention to trains. \n(8) Efforts shall be made to rush spares, staff and other assistance to site for \nimmediate repairing of the machine. Division shall provide necessary assistance \nlike transport of spares, welding equipment, gas cutting equipment, manpower etc. \nand assist in expediting the repairs. The objective is to reduce down time to \nminimum. \n(9) In case , it is necessary to bring the machine to satellite depot, division should \nensure its expeditio us movement to and from the depot. Decision on whether the", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 23, + "text": "2 \n \nmachine has to be brought to the depot for repairs shall be taken by Dy.CE/TM \n(line) considering relevant factors. \n(10) The track machines shall be worked as per divisionalised system of working with \ndivision managing all day to day affairs including fixation of roaster, minor repairs, \narrangement of consumables, staff matters and ensuring suitable working \nconditions for track machine staff. There may be some variations among the zonal \nrailways. \n(11) It shall be endeavour of Track Machine Organisation to utilize IT based applications \nto improve management of information of track machines. Modules for the same \nshall be provided in TMS to aim for paperless working. \n102 Functions and Organisation \n(1) Functions of Track Machines Organisation -Track Machine Organisation (TMO) \nshall be under the overall charge of Chief Engineer/Track Machines (CE/TM) of the \nZonal Railway. TMO shall be responsible for the following functions: \n(a) Manpower planning including training and development. \n(b) Planning, and deployment of track machines. \n(c) Operation and monitoring of track machines. \n(d) Repair and maintenance of track machines. \n(2) Organisation at Zonal Railway HQ \n(a) CE/TM shall be assisted by one or more Deputy Chief Engineer(s) at HQ , \n(b) Deputy Chief Engineer/TM/HQ in Headquarter shall be responsible for \ndeployment of machines, finalization of AMCs, planned procurement of \nspares and consumables, co-ordination with division etc. He shall be assisted \nby XEN/AXEN/TM/HQ(s) and SSE/JE/TM/HQ(s) working in HQ office and HQ \ncontrol. \n(3) Field Organisation on Zonal Railway \n(a) Deputy Chief Engineer/TM/Line, posted in Zonal Maintenance Depot, shall \nbe responsible for operation and maintenance of machines including \nemergency repairs and procu rement. He will ensure proper deployment of \nstaff, initiation of proposal for AMC as well as that of procurement of spares \nand consumables. The maintenance workshops in Zone i.e. Zonal \nMaintenance Depots (ZMD) and Satellite Depots (SD) in the divisions sha ll \nalso be under his control. He shall be assisted by XEN/AXEN/TM/ D for ZMD \nand XEN/AXEN/TM/Line for Satellite Depots and for monitoring of machines \nin field. He shall also have a 24x7 control set up in ZMD office. \n(b) XEN/AXEN/TM/D shall be assisted by SSE/JE /TM/D(s). One of the SSE/TM/D \nshall be nominated as Depot in -charge called SSE/TM/DI, who in turn, shall \nbe assisted by other SSE/JE/TM/D(s), MCMs, Track Machine Maintainers \n(TMMs) and Machine Assistants.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 24, + "text": "3 \n \n(c) XEN/AXEN/TM/Line will be assisted by SSE/TM /SDI who shall be in-charge of \nSatellite Depot and fleet of designated machines. He shall be assisted by \nSSE/JE/TM/SD, SSE/JE/TM(s) working on the Track Machines, MCMs, TMMs \nand Machine Assistants. SSE/JE/TM/SD can also be made in-charge of fleet of \ndesignated ma chines and will be assisted by SSE/JE/TM(s) working on the \ntrack machines, MCMs and TMMs and Machine Assistants. \n(d) Each machine will be manned by one or more SSE/JE/TM as per the \nyardsticks, of which one will be machine in -charge assisted by other \nSSE/JE/TM(s), MCMs, TMMs and Machine Assistants. \n(4) Central Periodic Overhauling (CPOH) Workshop \n(a) CPOH workshops will be setup on Indian Railways for carrying out Periodic \nOverhauling (POH) of Track Machines. These will function under CE/TM of \nthe respective railway. \n(b) Deputy Chief Engineer/TM/CPOH shall be in charge of CPOH workshop and \nwill be responsible for periodic overhauling of machines. He shall be assisted \nby XEN/AXEN/TM/CPOH(s) and SSE/JE/TM/CPOH(s), TMMs and Machine \nAssistants. \n103 Duties of Executive (XEN)/Assistant Executive Engineer (AXEN)/TM/Line \n(1) General – He shall be responsible for operation and maintenance of all the track \nmachines in his charge. He shall perform following duties: \n(a) Inspection and maintenance of all machines to ensure the se being in a \nsatisfactory, efficient and effective working condition. For this he shall \nensure availability of tools & gadgets for inspection of the machines. \n(b) Ensure adherence to stipulated maintenance schedules. \n(c) Ensure availability of necessary staff, consumables and spares of fast wearing \ncomponents and unit replacement assemblies etc. for the operation and \noptimum utilisation of machines. \n(d) Ensure achievement of stipulated targets in respect of both the quantity and \nquality of output. \n(e) Breakdown repairs shall be organised by him so as to ensure that idle time of \nmachine is minimum. \n(f) Initiate proposals and plan for major schedules, ensure their execution and \nsubmit completion reports for all such works. He shall personally supervise \nimportant schedules and major repairs. \n(g) Ensure co-ordination with other units of Engineering Department as well as \nthose of other departments as necessary. \n(h) Verification of stores held by the field units, once a year. He should ensure \nthat scraps and obsolete stores are returned to the zonal depot or disposed \noff.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 25, + "text": "4 \n \n(i) Ensure maintenance of various records and submission of various returns \npertaining to machines from the field units. \n(j) Satellite depot in the division will be under his control through \nSSE/JE/TM/SDI. \n(k) Training of Prob ationers – The Assistant/Executive Engineer shall take \ninterest in training of all probationers sent to him and see that training is \ngiven according to the specified programme. He should periodically examine \nthe notes made by them. \n(l) Staff Matters –He shall ensure that \n(i) Strict discipline is maintained within the framework of the rules. \n(ii) Service and leave records are maintained correctly and up -to-date. He \nwill ensure this by sample checks. \n(iii) Appeals and representations are dealt with promptly and welfare of \nstaff looked after. \n(iv) Assist Dy.CE/TM(Line) in selections for various skilled and semi -skilled \nposts so that the same are held in time and the posts are promptly \nfilled up. \n(v) All the SSE/JEs and other staff working under him possess necessary \nmedical, competency and other certificates, receive route learning and \nproper training in maintenance practices, safety and protection rules. \n(m) Ensure adoption of safe operation and maintenance practices and check \navailability and functioning of safety devices provided on the machines. \n(n) Ensure proper operation of Service Agreements in force. \n(o) Counselling of machine staff for immediate action to be taken in case of \nfailure. \n(2) Observance of rules and r egulations - He shall ensure observance of rules, \nregulations and procedures laid down in this Manual, G&S Rules, IRPW Manual, \nEngineering Code and other departmental codes, extant orders and circulars issued \nfrom time to time. He shall ensure that the staff under him possess these codes and \nmanuals and are acquainted with the relevant rules of operation and maintenance \nprocedures & stipulations connected with their duties and they perform duties, \naccordingly. \n(3) Inspection by higher officers - He shall accompany the high er officers during their \ninspections. Following records shall be made available by him during inspections: \n(a) History book of the machine, engine and major unit assemblies. \n(b) Failure registers. \n(c) Progress bar charts and analysis. \n(d) Unit cost statement. \n(e) Maintenance schedule register.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 26, + "text": "5 \n \n(f) Inspection notes of higher officers and compliance report. \n(g) Operation and maintenance instructions of the machines issued by \nOEM/RDSO. \n(h) Programme of deployment of machines. \n(i) Track Machine Manual and G&S Rules. \n(j) Record of the training given to supervisors and their competency certificates, \nroad learning and medical certificates. \n(k) Scale and Position of critical spares and consumables. \n(l) Inspection checklist and maintenance schedule instruction issued by \nOEM/RDSO. \n104 Duties of Senior Section Engineer/TM/SDI \n(1) SSE/TM (SDI) shall be responsible for the satisfactory operation, maintenance and \nproductivity of the fleet of machines under his charge and quality of work \nperformed. He shall inspect the machine(s) under his charge, as per laid down \nschedule and take re medial measures wherever required within reasonable time. \nHe shall submit the report of inspection to his next higher authority. He shall be \nable to work/operate the machine(s) under his charge when needed and shall be in \npossession of valid competency cer tificate, road learning and medical certificate. \nHe shall also ensure that the SSE/JE/TM working under him in the depot and on the \ntrack machines have valid competency certificates, road learning and medical \ncertificates etc. \n(2) He shall be well acquainted wi th the working systems, operating instructions, \nmaintenance schedules, specifications of the oils & lubricants to be used, critical \ncomponents etc. of machine(s) under his charge. He shall have thorough \nknowledge of the m anuals supplied by the manufacture rs of the machines and \nassociated instructions issued by RDSO. \n(3) He shall have thorough knowledge of the rules and regulations and procedures \nconcerning his work and duties as laid down in this Manual, G&S Rules, IRPWM, \nEngineering Code and other departmenta l codes, extant orders and circulars issued \nfrom time to time. He shall guide all the staff working under him in faultless \noperation and efficient maintenance practices pertaining to the machines in his \noverall charge and educate them in rules and regulat ions. He shall ensure that the \nstaff perform their duties efficiently. \n(4) He shall have in his possession up -to-date copies of the rule \nbooks/documents/manuals pertaining to the safe, efficient and trouble -free \nworking of the machines and also other codes an d books applicable and needed for \nthe day-to-day working. \n(5) He shall maintain the records in the depot, pertaining to the machines under his \ncharge and submit the prescribed returns regularly. He shall periodically verify the \nphysical condition and quantiti es of stock in his charge and arrange to submit", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 27, + "text": "6 \n \nperiodical returns/requisitions of Tools & Plant, spares, consumables and other \nstores, carry out verification of all stores including spares held by him, assist in \nstock verification by Stock Verifiers, and ensure compliance of Account/Audit \nReports etc. \n(6) He shall ensure discipline of the staff working under him within the framework of \nrules and endeavour to keep their moral high and look after their welfare. \n(7) He shall ensure proper handing over/taking over of the charge when \ntransfer/change of portfolio is affected. \n(8) He shall plan and ensure timely execution of the maintenance schedules of the \nmachines within the specified time. \n(9) He shall keep himself abreast of the various methods and techniques of \nreconditioning of components and availability status of spares at the Zonal \nMaintenance Depot for efficient re -commissioning of the machine during \nbreakdowns. He shall render technical assistance to the higher authorities in \ndevelopmental activities/import substitution and indigenisation activities. \n(10) He shall investigate major failures of the machine critically for corrective \nactions/remedial measures and also for fixing responsibilities in case of failures \noccurring due to lapses of staff. He shall obtain the first i nformation reports during \nbreakdowns, inspect the machines and take action for expeditious repairs. \n(11) He shall be conversant with the provisions in various Service Agreements/Contracts \nand organise the visits of Service Engineers (scheduled or break down). E ffective \nutilisation of expert advice and follow- up action on “Service Report Observations” \nshall form part of his duties. \n105 Duties of SSE/TM/SD - Where SSE/TM/SD is available in addition to SSE/TM/SDI \ndepending upon the machine units attached to satellite depot, he will carry out all the \nduties assigned to SSE/TM/SDI for the fleet of machines assigned to him except those \nrelated to stores. He shall follow the instructions of SSE/TM/SDI for improving effective \nutilization of machines and such other duties assigned to him. \n106 Duties of SSE/JE/TM working on m achines - Each machine shall be worked \nunder the direct charge of SSE/JE/TM during the movement and working of track \nmachine. He shall be in possession of the valid competency certificate, road learning and \nmedical fitness certificate for working the machine. He shall perform the following \nduties: \n(1) Operate the machine following the instructi ons issued by RDSO/OEM including \ncalculation and input of data as required. \n(2) Carrying out pre -block maintenance daily as per schedule, other maintenance \nschedules, and making the machine fit for working and give machine ready memo \nto SSE/JE/P.way or station master.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 28, + "text": "7 \n \n(3) Ensure proper functioning of all the systems and components and keeping a watch \non the controls/indicators/gauges. \n(4) Initial setting out for the block working and closing the work of the machine. \n(5) Taking precautions for Design Mode operations such as slewing, lifting etc. in case \nof tamping machines. \n(6) Deploying of MCMs, TMMs and Machine Assistants at respective places around the \nmachine for monitoring the work of various systems, maintenance activities during \nblock and also to attract attention of the SSE/JE/TM working in operating cabin and \nassist him in the event of malfunctioning of the machine or obstructions in track. \n(7) He shall ensure safety of staff working around the machine. \n(8) Participate in IOH and POH activities of the machine as required. \n(9) Assist SSE/JE/TM (in-charge) on the machine in all aspects of machine working and \nmaintenance within his competency. \n107 Duties of SSE/JE/ Machine In -Charge - One of the SSE/JE/TM on the machine, \nshall be nominated as the m achine-in-charge i.e. SSE/JE/TM/I. In addition to his normal \nwork as detailed in Para 106 above, he shall be responsible for the following functions in \nwhich he will be assisted by all the staff posted on the machine: \n(1) Carrying out the prescribed schedule of maintenance and keeping proper records \nof the same. \n(2) Safe custody, accountal and replacement of the spares, Tools & Plants and \nconsumables issued for the machine and returning of released spares to zonal \ndepot for reclamation/condemnation. \n(3) Keeping systems of the machine in working condit ion and ensuring the target \noutput, duly maintaining quality. \n(4) Maintaining log books and other records, sending daily and other periodical \nreports/statements using appropriate fastest mode of communication. \n(5) Liaison with the divisional officials and Engineering control for efficient working of \nhis machine, co -ordination with the permanent way staff and planning daily \nprogramme of machine work and interacting with the permanent way staff for \nworking e.g. working in design mode for slewing and lifting of track etc. \n(6) Actively associating during visit of firm’s Service Engineer, furnishing of such \ninformation as may be needed for proper examination of the machine and taking \nnecessary follow up action. \n(7) Furnishing ne cessary reports to and keeping SSE/TM/SDI or SD informed as the \ncase may be, about all the relevant aspects of the machines as also other records \nand details as asked by him and carry out necessary actions as directed for proper \noperation and maintenance of his machine. \n(8) In the event of breakdown of the machine, he will be responsible for setting right \nthe defect in shortest possible time with the help of machine and other staff. In", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 29, + "text": "8 \n \ncase the machine cannot be repaired in the block, he shall be responsible fo r \nwinding up using all resources including back -up systems and clear the block \nsection as early as possible. He shall be assisted by SSE/JE/P.Way and demand the \nengine/breakdown train through SSE/JE/P.Way, if required, without undue delay. \n108 Duties of SSE/JE/MCM/TMM in Control Set Up in HQ/ZMD/Division - The \nduties of the above staff in control offices are as given in Chapter 11. \n109 Duties of Master Crafts Man (MCM) and Track Machine Maintainers \n(TMM) - MCMs and TMMs attached with the machine(s) shall assist the SSE/JE/TM in \noperation and maintenance of track machines. Their main functions are: \n(1) To attend to the daily and weekly maintenance schedules of machine and record \nthe compliance in log book. To at tend and assist service checks by the service \nengineers. \n(2) To attend to breakdown and repairs of machines in block with due urgency. \n(3) To keep in his custody the various tools, plants and equipment necessary to attend \nrepairs and ensure their working condition. \n(4) To attend to the repairs and maintenance of machines including during IOH and \nPOH. \n(5) To guide and supervise the machine assistants and other staff in attending to the \nmaintenance/repairs. \n(6) To remain vigilant during movement and working of machine and to inform the \nconcerned SSE/JE/TM of any abnormalities. \n(7) To ensure safety of the machine and staff working at machine site. \n(8) Accompany the machines during shifting as directed, especially T -28 machine and \nPQRS portals. \n(9) Any other work assigned to him by the SSE/JE/TM. \n(10) MCMs and TMMs posted in depots and work areas other than machines will \nperform duties assigned by their controlling officials. \n110 Duties of Machine Assistant - He shall assist SSE/JE/TMs and TMMs in performing \ntheir functions and their main duties would be as below: \n(1) To keep the machine in neat and clean condition. \n(2) To replace spares like tamping tools as directed by SSE/JE/TM or TMMs. \n(3) To recoup HSD oil as required. \n(4) To assist TMM for carrying out daily and other specified schedule maint enance of \ntrack machine including that for IOH and POH. \n(5) Transportation of material, spares and consumables from depot to machine and \nvice versa.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 30, + "text": "9 \n \n(6) To bring all necessary tools and plants from coach to machine or otherwise as \nspecified by TMM or machine-in-charge. \n(7) To be vigilant during machine working and promptly inform machine -in-charge \nregarding any obstruction in track viz. SEJ, Level Crossing, Bridge, joggled fish plates \netc. boulders, rail pegs etc. so as to enable SSE/JE/TM to take necessary preventive \naction. \n(8) To warn for any abnormal sound, bursting of hose, breakage of any assembly etc. to \nmachine-in-charge. \n(9) To assist machine-in-charge in attending the failure in shortest possible time. \n(10) Extend help during service check by service engineer. \n(11) Ensure safety of self and colleagues during block. \n(12) Perform duty of watchman for machine and coach, if required. \n(13) Accompany the machines during shifting as directed, especially T -28 machine and \nPQRS portals. \n(14) At the end of the day, facilitate safe/proper stabling of machine in siding. \n(15) Any other duties assigned by TMO officers or SSE/JE/TM or TMM. \n(16) Machine assistants posted in depots and work areas other than machines will \nperform duties assigned by their controlling officials. \n111 Duties of Assistant Divisional Engineer (Open Line) ADEN - He shall perform \nfollowing duties regarding track machines working in his section: \n(1) He shall ensure that the pre-requisites for introduction of various track machines as \nspecified in this manual are complied with, well in advance of deployment of the \nmachine(s). \n(2) In the stretches where the requirement of tamping is more than the normal \ntamping cycle, the cause should be analysed and suitable remedial action taken to \nrestore the normal cycle. \n(3) He shall make arrangements for pre-block, during block and post block activities. \n(4) He shall ensure that machines are utilised in continuous stretches as per planned \nprogramme avoiding frequent shifting of the machines. \n(5) He shall ensure suitable accommodation for machine staff as require d with the \nfacility of water supply, power supply and resting arrangements. \n(6) He shall periodically inspect track machines working in his jurisdiction as per \nspecified schedule. \n(7) He shall arrange HSD for machines including transportation of consumables, spare s \netc. required by the machines from the depot to site of work. \n(8) He shall ensure adequate lighting arrangements when night working of machines is \ninvolved. \n(9) He shall monitor the output and quality of work done by the machines.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 31, + "text": "10 \n \n(10) He shall co-ordinate with other departments like Traffic, OHE and S&T in the field to \nfacilitate machine working. \n(11) In the eventuality of breakdown of machine, he shall take all possible actions to \nclear the block section expeditiously, once it is known that machine cannot be \nrepaired in the block. \n112 Duties of SSE/JE/P.Way Deployed with the Machine - He shall be the in-charge \nof the supervision of the work of track machine. He shall perform following duties: \n(1) He shall ensure that the pre-requisites for introduction of various track machines as \nspecified in IRTMM are complied with, well in advance of deployment of the \nmachine like collection of site details and computation of values to be fed for \ndesign mode of working. \n(2) He shall be responsible for pre -block operations, block operations (other than \nmachine operation) and post block operations as detailed for various machines. \n(3) During working of track machines, he shall check the track parameters and \ncondition of tr ack, attending to any shortcomings, ensuring that the track \nparameters are well within the tolerances. He shall also ensure that track is free of \nobstructions and infringements for safe passage of traffic before clearing the line \nblock. As required or stip ulated he shall allow traffic at suitable speed restriction \nbased on the condition of track after machine working. He shall be responsible for \nissue of all necessary caution orders for machine working. \n(4) Transportation of tamping tools to be reconditioned and bringing back \nreconditioned tamping tools will be his responsibility. Similarly, he will be \nresponsible for temporary storage and timely arrangement and transportation of \ndiesel oil, lub e oil, hydraulic oil and other consumables from the depots to various \nmachines working in his jurisdiction. \n(5) In case the quality of work done by the machine is not satisfactory, he shall \ninvestigate and take suitable remedial measures in coordination with SSE/JE/TM. \n(6) He is responsible for protection of the site of work and adjoining track wherever \nnecessary. He will be responsible for arranging adequate precautionary measures \nfor the safety of staff working with machine in the block section against danger of \ntrains on the adjoining line(s). He shall arrange for track protection and provide \nlook out men for safety at site. \n(7) He is responsible to ensure that the machine(s) are stabled in suitable sidings and \nat such stations as to minimise idle run of the machines as well as wastage of block \nhours in entering and clearing of the block section. \n(8) He shall provide all assistance to SSE/JE/TM for repairing of machine and winding \nup for expeditious clearing of the block section in case of failure of the track \nmachines in mid -section, duly calling for necessary assistance of light engine, \nbreakdown special etc. as necessary.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 32, + "text": "11 \n \n(9) He shall arrange for protecting and watching of stabled machines and he shall also \nensure that no sick vehicles etc. are pushed into the same siding af fecting the \ntaking out of the machines to avail blocks. \n(10) He shall co-ordinate with other departments like Traffic, OHE and S&T in the field to \nfacilitate working. \nPART B – INSPECTION OF TRACK MACHINES \n113 Inspection Schedule of Track Machine Officials - Track machines shall be \ninspected as per prescribed schedule in accordance with detailed checklist of individual \nmachines issued by RDSO. Periodicity of inspection for officers and supervisors of track \nmachine shall be as given below:\n \n(1) Inspection by Officials of Track Machine Organisation \nTable 1.1 \nTrack machine* Inspection frequency of Track Machine Officials \nDy.CE/TM/ Line AXEN /XEN/ \nTM/Line \nSSE/TM/SDI or SD \nRGM 3 months ( owning \nrailway) \nMonthly (owning \nrailway) \nFortnightly \n(owning railway) \nMonthly (working \nrailway) \nFortnightly \n(working railway) \nWeekly (working \nrailway) \nTRT 6 Months Monthly Fortnightly \nTLE/PCCM 1 Year 2 Months Fortnightly \nTEX/CSM/UNIMAT \nWST \n1 Year 3 Months Monthly \nBCM/SBCM 1 Year 2 Months Monthly \nMPT/DTS/BRM/ \nUTV/RBMV \nNeed Basis 4 Months 2 Months \n \n*The inspection schedule is for individual machine. e.g. if there are 3 BCMs under one \ndivision, then AEN/TM/Line shall inspect each BCM, once in 2 months \nThe inspecting officials shall issue inspection reports to their concerned immediate \nsubordinates with a copy marked to immediate concerned superior. \n114 Inspection Schedule of Open Line Officials - The schedule of inspection of Track \nMachines for open line officials shall be as here under:", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 33, + "text": "12 \n \nTable 1.2 \nTrack Machine Inspection frequency of open line officials \nSr.DEN ADEN SSE (P.Way) in-\ncharge \nJE (P.Way) \nsectional \nTEX, CSM, DTS, \nWST, UNIMAT \nand SBCM \n3 \nMonths \nFortnightly During supervision \nof pre-block, \nduring block and \npost-block works \nbut not less than \nonce a week \nDuring supervision \nof pre-block, during \nblock and post-\nblock works but \nnot less than once \na week \nRGM, TRT, TLE, \nPCCM and BCM \n2 \nMonths \nFortnightly \nMPT, BRM, UTV, \nRBMV etc. \nAs per \nneed \nOnce during \nthe \ndeployment \n \nSr. DEN/DEN and ADEN shall inspect the track machines as per above schedule, duly \ncovering other aspects like, adequacy of all allied track works, quality of machine work, \nsafety aspects involved, items pertaining to the welfare of machine staff, records s uch \nas programme of tamping, actual tamping, variations, repeated tamping, speed \nrestriction etc. \nCopy of inspection report of ADEN shall be sent to AEN/TM/Line and that of Sr. \nDEN/DEN shall also be sent to Chief Engineer/TM and Deputy Chief Engineer/TM/ Line \nand Dy.CE/TM/HQ in addition to concerned subordinate officials. \n115 Items to be Inspected - RDSO has issued checklist for inspection of each type of track \nmachine, which is available on the web site of RDSO. The list of the same is also given in \nChapter 8. However, the broad list of items to be checked and inspected by track \nmachine as well as open line officials is given below.\n \n(1) Inspecting Officials of TMO as well as Open Line \n(a) Pre Block Inspection - They shall reach the stabling siding or station at least \none hour before the block time. They shall check the following: \n(i) Staff accommodation/facilities. \n(ii) Infrastructural facilities like sidings, rest house, water supply and \nelectrical connection etc. \n(iii) Knowledge of safety rules of SSE/TM, MCM, TMM & machine \nassistants. \n(iv) Working of emergency backup system for clearing block in case of \nmachine failure. \n(v) Adequate safety of staff working in block section against danger of \nincoming trains on adjacent lines.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 34, + "text": "13 \n \n(vi) Staff attendance. \n(vii) Checking of competency certificates, route learning and medical \nfitness of staff, issues of field staff. \n(viii) Records of the machine failures and general health of machine. \n(ix) Availability of Codes and manuals with latest correction slips. \n(x) Availability of safety items/equipment as per prescribed norms. \n(xi) Availability and expiry date of detonators, fire extinguisher and first aid \nbox. \n(xii) Availability of machine deployment plan and the actual deployment \nvis-a-vis the plan. \n(xiii) Working of braking system. \nSSE/JE/P.Way shall inspect item (i) to (v). They will check the knowledge of safety \nrules for MCM, TMM and machine assistant. \n(b) During Block Working - Inspecting officials shall inspect working of the \nmachine(s) and safety precautions and practices observed, during traffic \nblock in addition to attention to pre -requisites, works to be done during and \npost machine -working activities. They shall record the results of their \ninspection and ensure compliance within a reasonable time. Immediate \naction shall be initiated in respect of areas where the condition of machine \nor track aspects needs quick attention. A report shall be submitted to the \nnext higher authority at the end of every month indicating inspections \ncarried out, deficiencies noticed and remedial actions taken. \n(c) Machine Specific Items - Items to be checked for different machines by TMO \nas well as open line officials are listed below: \n(i) TAMPERS \n• Adequacy of track data required for the selected mode of working. \n• Mode of working and its appropriateness. \n• Condition of tamping tools. \n• Tamping parameters like; tamping depth, squeezing time, \nsqueezing pressure, vibration pressure. \n• General lift, ramp in and ramp out, slew, lift, versine values, SE etc. \n• Tamping quality. \n(ii) BCM \n• Condition of cutting chain and its fingers. \n• Condition of Screens. \n• Pre-survey and removal of obstructions. \n• Quality of screening and ballast distribution.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 35, + "text": "14 \n \n• Waste conveyor safety switch operation. \n• Width and depth of cutting of ballast profile. \n• Safety precaution at closing of work. \n(iii) TRT \n• Condition of BFR, gantry rail and bridge rail. \n• Sleeper picking and laying system (NT and OT conveyor). \n• Sleeper spacing system (Index wheel). \n(iv) BRM \n• Functioning of all systems for dressing and distribution of ballast. \n• Condition of broom and conveyor belt. \n• Condition of different ploughs. \n• Working of hopper system where provided. \n• Quality of profiling done. \n(v) SBCM \n• Condition of cutting chain and its cap. \n• Condition of Screens. \n• Screening width. \n• Operations of waste conveyor safety switch. \n• Quality of screening. \n(vi) TLE \n• Proper laying of auxiliary track and its support system. \n• Working mode and working speed of machine. \n• Condition of BRNs. \n(vii) PCCM \n• Function of motorized trolleys. \n• Arrangement of wooden block support for crawler. \n• Proper hooking of turnout. \n• Condition of hooks and pins. \n• Quality of laying (alignment) by machine. \n(viii) UTV/RBMV \n• Condition of crane and its attachments for lifting materials. \n• Availability of all specified tools and plant and their condition. \n• Condition of BRNs.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 36, + "text": "15 \n \n(ix) RGM \n• Condition of Grinding stone and spark arrestors. \n• Check track data in GDMS format uploaded in m achine, \nparticularly direction of curve. \n• Grinding inputs (pattern) and input system. \n• Measurements at identified test locations wherever existing. \n• Sufficient water in water wagon and its discharge system. \n• Grinding quality and improvement in GQI. \n• Cleaning of machine of iron dust and its proper disposal. \n• Precautions at location of obstructions like points and crossing \ncurve with checkrail etc. \n(x) DTS \n• Frequency of Vibration and static load. \n• Working mode and working speed. \n• Track parameter after work. \n• Precautions taken on bridges, tunnels etc. \n(2) Inspecting Officials of TMO- Additional items - Track Machine officials shall carry \nout inspections as per laid down schedule and in accordance with detailed check \nlist issued by RDSO. Few important additional items to be checked are given below \nfor guidance. \n(a) General \n(i) Details of work done since last POH, IOH, and adherence to other \nmaintenance schedules of machines. \n(ii) Condition of camping coach. \n(iii) Availability of critical spares and consumables. \n(iv) Functioning of safety devices, control unit and measuring units and \ngeneral cleanliness of the machine. \n(v) Tightness of the nuts and bolts of all moving and vibrating items. \n(vi) Availability of tools and plants. \n(vii) Follow up action on Service Engineer’s reports. \n(viii) Availability and proper maintaining of records. \n• Log Book. \n• History Book. \n• Register of Periodical Maintenance Schedules. \n• Critical Spare part List.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 37, + "text": "16 \n \n• Failure register. \n• Follow up action on Service Engineer’s reports. \n• OEM manuals. \n(b) Engine \n(i) General condition of engine with respect to starting problem. \n(ii) Engine hours total, since last POH, and last attention given. \n(iii) Smoke condition. \n(iv) Belt condition and tension. \n(v) RPM. \n(vi) Oil pressure. \n(vii) Oil temperature. \n(viii) Oil leakages if any. \n(c) Hydraulic System \n(i) Measurement of hydraulic pressure of various units. \n(ii) Maximum hydraulic temperature. \n(iii) Condition of hydraulic cooler. \n(iv) Quality of fitment of hose assemblies, leakages. \n(v) Quality of hydraulic oil. \n(vi) Level of hydraulic oil etc. \n(d) Pneumatic System \n(i) Air pressure and leakages. \n(ii) Working of water separator. \n(iii) Functioning of air oiler and air dryer. \n(iv) Functioning of various valves. \n(v) Functioning of brakes. \n(vi) Condition of brake shoe and gap. \n(e) Electrical and Electronics \n(i) Condition of battery. \n(ii) Condition of self-starter and alternator. \n(iii) Condition of transducer. \n(iv) Condition of all gauges, meters. \n(v) Condition of lights, hooter. \n(vi) Condition of safety devices like limit switches etc. \n(vii) Condition of cable code and terminal code in junction box.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 38, + "text": "17 \n \n(f) Oil and Water Level – Level of oils like engine oil, diesel, transmission \ngearbox and other gearboxes oil, axles gear oil and coolant/water in radiator \netc. \n(g) Filters – Replacement/cleaning of air filters, air dryer filters, diesel filters, \nhydraulic filters and lube oil filters as per schedule. \n(h) Lubrication (Oiling and Greasing) –Adequacy of oiling and greasing of all ball \nand socket joints, movable parts and cardon shaft as per schedule. \n(i) Specific Items to be seen in Different Machines – Following items specific to \nmachines should also be checked in addition to that mentioned at Para 114 \n(1)(c) above: \n(i) TAMPERS – Condition of rail clamps, hooks, t rolleys, tamping bank, \ntool tilting system, lining & lifting system, s atellite, working of ALC, \nLaser, GVA system etc. \n(ii) BCM – Condition of cutter bar, s creens, wear plates, corner rollers, \nturret gear, plough, conveyors belts etc. \n(iii) TRT – Condition and working of c onveyer pads, sled, dynamic plough, \nclamping and guiding rollers etc. \n(iv) BRM – Condition of wear plates of different ploughs, ra il top clearing, \nrubber elements etc. \n(v) SBCM – Condition of conveyor belts, tooth bucket & ditcher wheel etc. \n(vi) TLE – Condition of sleeper gripper, rail clamps, sliding frames, simplex \nand duplex chains etc. \n(vii) PCCM – Condition of clamps, sliding frames, crawler and trolleys etc. \n(viii) UTV/RBMV – Condition of outrigger and lifting capacity of crane. \n(ix) RGM – Grind modules tilting system, dust collection system, working of \nall grind motors and automatic system of its operation linked with \ngrind stone, working of front and rear camera, functioning of \nobstruction detection system, working of buggy up and down system \nand its locking. \n(x) DTS- Roller clamp condition, working of vibration unit and preloading \nunit. \n(3) Inspecting Official of Open line - Additional Items -\n Open line officials shall look \nfor the following items also in addition to those listed above: \n(a) Output of the machine vis-a-vis traffic block. \n(b) In Tampers, they should check tamping charts and check reasons and suggest \nfor remedies to increase tamping cycle. \n(c) In BCM’s they shall ensure that depth of cutting is a judicious mix of l ifting \nand excavation based on advance survey and proposed L-section. \n(d) Check benchmarks & reference marks and obligatory points.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 39, + "text": "18 \n \nCHAPTER 2 \nTAMPING MACHINE AND DYNAMIC TRACK STABILIZER \n201 General - Purpose of tamping and stabilization of track (ballast bed) is to produce \nwell compacted s leeper supports in order to improve the load distribution across \nsleepers, restore track to correct geometry and have long lasting retentivity of \npacking. Tamping machines are used for correcting the track geometry and tamp \nthe ballast while Dynamic Track Stabilizer (DTS) is used for better anchoring of the \ntrack skeleton in the ballast bed to improve the durability of track geometry under \nrunning traffic. \n202 Tamping machine - Tamping machine measures the existing track parameters \nand lifts it to enable correction of the cross level and alignment, to achieve target \nor pre-determined parameter values, with an aim to improve the track geometry. \nIt simultaneously packs the ballast under sleeper(s), using tamping tools fitted on \ntamping unit, to provide well compacted ballast bed. \n(1) Functions - The main functions of tamping machines are- \n(a) Correction of alignment, \n(b) Correction of longitudinal and cross levels, \n(c) Tamping of ballast under the sleepers. \nSome of the tamping machines have additional fitments for track ballast \nstabilization also. \n(2) General Layout - General layout and important units of a t amping machine \n(09-32 CSM) are shown below- \n \nFig. 2.1 \n203 Important assemblies of tamping machines \n(1) Engine - Diesel engine is the main source of power. The engine converts \nchemical energy of fuel into mechanical energy, part of which is used directly \nREAR/WORKING \nTAMPING \nLIFTING AND LINING UNIT FRONT CABIN \nWORKING DIRECTION \nSATELLITE \nFRAME \nREAR \nREAR BOGIE \nWHEEL \nMEASURING \nTROLLEY \nSATELLITE WHEEL \nLINING TROLLEY FRONT BOGIE \nFRONT TROLLEY \nLEVELLING \nCHORD \nTROLLEY UNIT \nCABIN", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 40, + "text": "19 \n \nand remaining further converted into different forms of power for the \nworking of machine. \n(a) Mechanical power through gear b oxes - A part of mechanical power \ngenerated is used, by means of hydrodynamic gearboxes (in most of \nthe machines), for movement of tamping machine. Remaining \nmechanical power is converted to other forms as mentioned below. \n(b) Hydraulic power thr ough hydraulic p ump - Hydraulic power is \ngenerated by means of hydraulic pump driven by mechanical power. It \nprovides power for operations during working through various \nhydraulic motors and cylinders. \n(c) Pneumatic power through c ompressor - Pneumatic power is \ngenerated by means of compressor driven by mechanical power. It is \nused for brakes and locking/unlocking system of assemblies, up and \ndown movements of feelers, operation of bogies for datum selection, \nhorn operation and chord tension etc. \n(d) Electrical power through alternator and batteries - Electrical power is \ngenerated through alternator, or sourced from batteries. It is used to \nprovide electrical power for sensing devices, feedback of corrected \nparameters, signals to hydraulic units, like directional valves, \nproportional valve and servo valve for operations. \n(2) Tamping u nits - Two or more independent tamping units are provided in \ntamping machine (one or more for each rail depending on the make and \nmodel of the tamper). These are mounted on the machine frame by means \nof vertical guiding columns. In some of the machines, the tamping units are \nfitted to the satellite frame. \nThe tamping units on Indian Railways have the capability for tamping \none/two/three sleepers at a time depending upon type a nd model of the \ntamping machine. The tools are arranged in pairs and each of the two sides \nof sleeper is tamped by four such pairs, four numbers on either side of each \nrail. The units are held on horizontal guide columns in order to slide \nsideways, which allow their manual/automatic centering over the rails in \ncurves. The tools are vibrated by piston rods pivoted on eccentric shaft \ndriven by hydraulic motors. \nA typical layout of tamping unit and its different components are shown as \nFig 2.2 \nThe lifting and lowering of tamping units i s achieved by means of a hydraulic \ntamping units lifting/ lowering cylinder. The insertion depth of tamping tools \nand squeezing pressure can be varied for different types of sleepers. In case \nof simultaneous tamping of double/triple sleepers, the opening w idth of \ntamping tools can be changed pneumatically by changing the clapper piece \nto suit the sleeper opening and by pneumatic operation of clapper cylinders \nfor joint sleepers.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 41, + "text": "20 \n \n \n \nFig. 2.2 \n(3) Tamping Tool - The size & shape of the blade of tamping tool has a bearing \non the quality of compaction (tamping) of ballast. The size of tamping tools \ndiffers, depending on model/make of tamping machine. Tamping tool with \ncarbide shield called Tungsten Carbide Tamping Tool (TCTT ) are now being \nused for improving the performance of tools. The positions of tamping tools \n(TCTT) for various machines with important dimensions are depicted at \nAnnexure 2.1. \n(4) \nLifting and Lining unit - The lifting and lining unit is positioned in front of the \ntamping units. Lifting is carried out using one lifting cylinder with the help of \nroller clamps/hook on each side. \n \nThe lining operation starts simultaneously with the lifting operation. As soon \nas the target values are reached, lining and lifting operations are \nautomatically stopped. \n(5) Satellite unit - Continuous sleeper tamping machines have tamping & lifting \ncum lining unit, provided on the separate unit called satellite unit. Satellite \nunit is placed on an independent under -frame, which is mounted on wheels. \n1. TAMPING BANK \n2. CENTER PIN \n3. BIG TAMPING ARM \n4. BIG SQUEEZING CYLINDER \n5. GUIDE ROD \n6. OIL BATH \n 7. PLATE GUARD \n 8. CLAPPER CYLINDER \n 9. SQUEEZING PLATE \n10. SMALL SQUEEZING CYLINDER \n11. SMALL TAMPING ARM \n12. TAMPING TOOL", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 42, + "text": "21 \n \nIt can move independent of the main frame, capable of cyclic movement \nfrom sleeper to sleeper. \n(6) Trolleys - These are wheels mounted units provided with sensing feelers \nused for measurement and correction of the track parameters. Four trolleys \nare us ed in tamping machine, which are - front trolley, lining trolley, height \ntransducer trolley, measuring trolley and rear trolley. \n(7) Brake system - Following types of braking system are provided on tamping \nmachine- \n(a) Direct brake- It is applied only on machine during transit. \n(b) Indirect b rake-This brake is used for application on machine and \ncoupled camping coach/wagon while running. This brake system is \nprovided in machines with KE valve. KE valve is available in all new \ntamping machines. It works with single piping system. \n(c) Emergency b rake- This brake is applied on machine during transit \nalone or coupled with camping coach/wagon only when KE valve is in \n‘ON’ position. It is applied through indirect brake system. \n(d) Safety b rake- This brake is applied automatically by switching off \nhydrodynamic transmission gear (ZF Gear in Plasser machines). \nNormally this should not be used for service brake application. \n(e) Parking brake- This is hand operated mechanical brake, applied when \nmachine is stabled. \n204 Types of tamping machines \n(1) Tampers without Satellite u nit - The tamping unit and the lifting cum lining \nunit are mounted on the main frame of the machine itself. The machine \nmoves and stops at every sleeper for lining, levelling and tamping. One to \ntwo sleepers can be tamped simultaneously in one operation. Following \nmachines fall in this category. \n(a) Duomatic (Plain Track Tamper) - It is a Plain track tamper and with 32 \ntamping tools to pack two sleepers at a time. These machines are also \nreferred as Work Site Tampers (WST) for purpose of nomenclature. The \nnames of the models of Duomatic tamping machines presently in use \non Indian Railways; and the name of manufacturer, are given below- \n(i) 08-32 Duomatic (Plasser India). \n(ii) 08-32C Duomatic (Plasser India). \n(iii) 08-32 WST with flat car(Metex–JSC Moscow, Russia). \n(iv) VPR-02M without flat car(Kalugaputmash, Russia). \nThe important features/dimensions of these machines are given at \nAnnexure 2.2", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 43, + "text": "22 \n \n(b) UNIMAT (Points and Crossing Tamper) - This is primarily a points and \ncrossing tamping machine. Tamping unit of this machine is designed in \na manner to allow independent operation of individual tamping tool. \nThis helps in tamping of almost all the sleepers in points and crossings. \nTamping tool(s), which infringes any track component, can be tilted \nindividually or in pairs and rest of the tools tamp the sleepers . Tamping \nunit in most of these machines can be rotated to align with the \nsleepers, which are laid at an angle e.g. Fan Shaped Layout design. \nAdvanced models of UNIMAT have the arrangement for lifting of third \nrail and more advanced have the provision for both; lifting as well as \npacking under the third rail. Various models of UNIMAT machines \npresently in use on Indian Railways with the name of the \nmanufacturers are as under- \n(i) 08-275 UNIMAT (Plasser India). \n(ii) 08-275-3S UNIMAT (Plasser India) with arrangement only for \nlifting of third rail. \n(iii) 08-475-4S UNIMAT (Plasser India) with arrangement for lifting \nand packing under the third rail. \nThe important features/dimensions of these machines are given at \nAnnexure 2.3 \n(c) Multi-Purpose Tamper (Plain and Points and Crossing Tamper) - This \nmachine is designed for spot attention on plain track as well as point \nand crossing. These may have a flat platform at rear end with crane \nfacility for loading, unloading and transportation of P.way materials. \nVarious models of Multi -Purpose Tampers , presently in use on Indian \nRailways are as given below- \n(i) UNIMAT Compact (MPT) (Plasser India), \n(ii) UNIMAT Compact Split Head (MFI) (Plasser India). \nThe important features/dimensions of these machines are given at \nAnnexure 2.4 \n(2) Tampers with Satellite Unit - These machines are provided with a satellite \nunit, which moves independent of the main machine in working mode. \nComponents required for tamping, aligning and levelling of track are \nprovided on this satellite unit. While the main machine moves at a uniform \nspeed continuously, the satellite unit moves and stops at every sleeper \n(sleeper set) for lining, levelling and tamping. These machines do twist \ncorrection also. Different models of these types of machines can tamp \ntwo/three sleepers in one operation. The m achines falling in this category \nare- \n(a) 09-32 CSM (Plain Track Tampers) - It is a Plain track tamper designed \nfor lining, levelling, twist correction and tamping of sleepers. It has", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 44, + "text": "23 \n \ntamping unit with 32 tamping tools to tamp two sleepers at a time. \nSingle chord lining and double chord parallel levelling systems are used. \nThe imp ortant features/dimensions of this machine are given at \nAnnexure 2.5 \n(b) Tamping Express (09 -3X) (Plain Track Tampers) - It is a plain track \ntamper designed for lining, levelling, twist correction and tamping of \nsleepers. It has 48 tamping tools to tamp three sleepers at a time. \nSingle chord l ining and double chord parallel levelling systems are \nused. The important features/dimensions of these machines are given \nat Annexure 2.6 \n205 Tamping Mechanism - The tamping units work according to the asynchronous \nconstant pressure tamping principle. The tamping tools penetrate the ballast and \nperform a closing movement with sinusoidal vibrations, as shown in Fig 2.3. \n \n \n \nFig. 2.3 \n \nThe tamping tools continue to move, pressing the ballast till desired force is \nreached and thus each of the tools applies the same force on the ballast. Since \neach of the tools continue to move for different durations and presses the ballast \ntill the desired pressure is reached, the process is known as asynchronous constant \npressure tamping operation. Components of tamping unit are shown in Fig 2.3. \n All tamping tools, therefore, apply the same amount of pressure to the ballast \nbeing tamped; thus there is equilibrium of forc es between the individual tool pairs \nand the specific surface pressure of all tools. During tamping of ballast, resistance \ngets built up in front of each pair of tools. The movement of the tool is completely \nECCENTRIC \nVIBRATION \nSHAFT \n FIXED PIVOT TO PICKUP THE \nTAMPING REACTION FORCES \n ASYNCHRONOUS ACTION \nSQUEEZING \n15 - 20 mm \nSQUEEZING FORCES SQUEEZING FORCES", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 45, + "text": "24 \n \nindependent, according to the resistance encountered from the ballast. Once the \nresistance reaches the pre -selected value (hydraulic pressure in the squeezing \ncylinder), the corresponding tool pair stops squeezing automatically, however \nother tool pair(s) continue to squeeze till the resistance for thos e also becomes \nequal to preselected pressure. Individual tools may have different closing \nmovements as shown in Fig 2.4 \n \n \n206 Tamping parameters \n(1) Squeezing p ressure - Squeezing force per unit effective area of squeezing \npiston is called squeezing pressure. The force at face of tamping tool for \nconsolidation of ballast will correspond to this squeezing force. \nFor tamping units, presently available with Indian Railways, t he squeezing \npressure for different track structure is as below: \nTable 2.1 \nType of Track and Sleeper Squeezing Pressure \nPlain Track (CST9) 90-100 Kg/cm2 \nPlain track (ST& wooden) 100-110 Kg/cm2 \nPlain track (PSC) 110-120 Kg/cm2 \nP & C (ST/Wooden) 110-115 Kg/ cm2 \nP & C (PSC) 125-135 Kg/ cm2 \nThe squeezing pressure should be kept on higher side of the stipulated range \nfor caked ballast, however for deep screening sites and newly laid tracks with \nunconsolidated ballast bed, it could be on lower end of the range. \n(2) Tamping d epth - For effective tamping of the ballast below the sleeper \nbottom, under the rail seat, the gap between top edge of the tamping tool \nblade and bottom edge of sleeper in closed position of the tamping tool \nshould be adjusted depending upon the type of rail and sleeper. The \ndesirable gap between top edge of the tamping tool blade and bottom edge \nof sleeper for different types of sleepers will be as under- \nW1 W2 W3 W4 \nFig. 2.4", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 46, + "text": "25 \n \n \n \n \n \n \n \nTo obtain the correct depth of tamping tool during packing of sleepers, the \ninitial (Zero) position of tamping tool is set as shown in Fig 2.5 \n \n \n \nFig. 2.5 \nTamping tool depth is calculated as: \nTamping tool depth = Sleeper depth at the rail seat location + Rail \nheight + rubber pad thickness \nExample 2.1: \nFor a track with 60 Kg rail and sleepers, the tamping depth will be \n= 172 mm (rail height) + 210 mm (sleeper depth) +6 mm (thickness of \nrubber pad to drawing no. RDSO T-3711) \n = 388 mm (Fig 2.6) \n \n \n \n \n \nFig. 2.6 \n(3) Tamping Tool Vibration, Amplitude & Frequency - The tamping tools are \nvibrated by piston rods pivoted on eccentric shaft driven by hydraulic motors \nwith following parameters- \nTable 2.2 \nType of Sleeper Desirable gap between top edge of the tamping \ntool blade and bottom edge of sleeper \nFlat bottom sleeper 15-20 mm \nMetal sleeper 22-25 mm", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 47, + "text": "26 \n \nTable 2.3 \nParameters Value \nRate of revolution of vibration shaft 2000 to 2100 RPM (approx.) \nVibration frequency of tamping tool 33 to 35Hz. (approx.) \nAmplitude of oscillation 3-5 mm \nThese values may vary depending on design/model/make of tamping \nmachine. Technical manual of the machine may be referred for details of all \nsuch parameters. \n(4) Vibration pressure - The vibration pressure of tamping tool is so adjusted \nthat vibration does not slow down or stop even while penetrating the \nballast. The vibration pressure varies from machine -to-machine and ranges \nfrom 150 to 210 Kg/cm\n2. \n(5) Tamping cycle & squeezing time - A complete tamping cycle involves \nlowering of tamping unit to the desired depth, squeezing of ballast (till all \ntool pairs reach pre-defined squeezing pressure), holding of tamping tools in \nthat position, releasing and lifting of tamping unit & travelling of tamping \nunit to the next sleeper location. Time taken in squeezing the ballast with \npreset pressure is called the squeezing time.\n \nNormal setting of machine is su ch that lifting and lining of track starts when \nthe tamping unit is lowered by about 100 mm from its zero position. \nSqueezing action commences about 30 mm before the tool reaches the \ntarget depth. Squeezing \n \n \nFig. 2.7 \nSQUEEZING \n \nLIFTING & LINING \nSQUEEZING & HOLDING \n100M\n \n 30MM \nTAMPING \nDEPTH \nLOWERING \nOF T/UNIT \nLIFTING OF \nT/UNIT \nTRAVELLING \nAHEAD \nTIME \nTAMPING CYCLE", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 48, + "text": "27 \n \ncircuit is cut-off as the preset squeezing time is completed. The tamping unit \nis then lifted in succession. Lifting and lining circuit is cut- off when tamping \nunit, while in lifting operation, is 100 mm before the Zero position . For \nmaintenance packing, squeezing time of 0.8 second to 1.2 second should \nnormally be adequate. Higher value of the above range of squeezing time is \nrequired for track with caked up ballast. \n(6) Tamping tool surface a rea - Surface area of tamping tools blade of different \nmachines is given in Annexure 2.1. Tools with more than 20% wear of the \noriginal surface area should not be used. The worn out tools are to be \nreconditioned/replaced. \n207 Optional equipment - The use of optional equipment like Laser Beam System, \nGeometry Value Assessment (GVA) , and ALC etc. simplifies working and reduces \nerror-proneness associated with manual system of data collection and feeding. \nThese systems are briefly described below- \n(1) Laser beam s ystem - A p air of photocells mounted on tamping machine \nreceives a fanned -out laser beam from laser emitter. In case of unbalanced \nlaser input received by photocells, a corresponding differential signal \nactivates an electric motor, to move the whole receiver assembly along with \nfront end of the chord to the centre of the laser beam. Thus, front tower end \nof chord is shifted laterally by the amount of error to enable design lining \nand levelling. Working of Laser Beam system is explained in Annexure 2.7. \n(2) Geometry Value Assessment (GVA) - It is a small computer, which eliminates \nthe feeding of adjustment values from tables and marking on sleepers. The \nlocations of main points of curve i.e. starting of transition, transition length, \nradius, super elevation data etc. are fed into the computer. \nThe use of GVA eliminates the necessity of attention by operator for feeding \nvalues and thus avoids possible mistakes in calculations and/or feeding, \nwhich result in better progress with improved quality. \n(3) Automatic Guiding Computer (ALC) System - It is advanced system, which \nautomatically calculates the values of various track parameters, to be fed \ninto machine on the basis of target track geometry. It has the capability to \nmeasure and record existing track parameters during a measuring run, in \nadvance of working, and also allows flexibility to choose the desired track \ngeometry. It also saves the operator from entering various parameters to be \nfed, as it does automatic feeding of parameters. The detailed wor king of this \nsystem is explained in Annexure2.8. ALC’s are being provided with fault \nfinding diagnostic software also. \n(4) Data Recording Processor (DRP) System - It is a system for recording track \nparameters during working operation, at the working speed of the machine. \nIt records the parameter of tamped track, like unevenness, alignment, cross -\nlevel, twist. The measuring sensors are so mounted that tamped track \nparameters are recorded in the working direction of the machine. It has a", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 49, + "text": "28 \n \nsystem to predefine the l imits of individual parameters and it is possible to \nevaluate and classify the measurement results. The parameters can also be \ndisplayed graphically along with calculated standard deviations of different \nparameters in small lengths (say 200 meter section). Apart from the track \nparameters, it can also be designed to record the machine working \nparameters like squeezing time, squeezing pressure and squeezing depth. \n(5) Computerized Measuring System (CMS) - This is on board computer used for \ndisplaying track parame ters measured i.e. super elevation, v ersine and \nLongitudinal level etc. It also displays the nominal value fed by the operator. \nIt also displays lifting and lining values fed manually, through Laser system \nand through ALC separately. It is used for digital calibration of lining and \nlevelling system (For calibration of systems controlled by servo valve) & \ndiagnosis of signals for proper working of these units. \n(6) Computerized Working System (CWS) - This computer receives the various \nmachine working parameter (controlled by proportional valve) from its \ncircuit some of which are listed below and displays it on monitor- \n(a) Driving: RPM of engine, work drive speed, run drive speed etc. \n(b) Tamping: tamping depth, tamping position, speed of up and down of \ntamping unit, squeezing pressure, squeezing time etc. \n(c) Satellite drive (if provided): satellite speed etc. \n(d) Automatic positioning : Sleeper distance setting during automatic \nworking. \nIt is also used for setting of the above parameters i.e. tamping parameter \nlike tamping depth, squeezing time, squeezing pressure, satellite forward \nand reverse speeds etc. \n208 Lining s ystem - Lining system is for measuring and correction of track \nalignment. Single chord lining system is used in all tampers working on Indian \nRailways. The chord stretched between front and rear trolley is used for \nmeasuring alignment of track by means of measuring transducers. The track is, \nthen slewed by lifting-cum-lining unit to the target alignment. \nFor the purpose of lining - \n• Machine measures alignment of only one pre-selected reference rail \nand rectifies that rail i.e. reference rail. \n• The alignment of other rail, being fixed with the sleeper, \nautomatically gets rectified except for correcting the gauge defect. \n• Versine on curved track depends on radius of curves, chord length \nfor measurement and location of measurement. \n(1) Reference Rail - The reference rail for carrying out attentions to alignment \nshould be selected as given below-", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 50, + "text": "29 \n \n(a) On curved track – outer rail (however, if outer rail is highly worn out, \ninner rail should be taken as reference rail). \n(b) On straight track on single, double and middle line in multiple line \nsection –Any of the two rails of the track being tamped, which is less \ndisturbed. \n(2) Lining method - Tamping machines follow two methods of alignment \ncorrection; 3-point & 4-point. Some of the latest machines have provision for \nonly 3-point lining method. \n(a) 4- Point Lining m ethod - The selected reference rail is measured at four \npoints on the curve taking two measurements for versines. These values are \nthen compared to correct the geometry. This method reduces existing error \nsignificantly to improve the track alignment. \n(b) 3- Point Lining m ethod - The selected reference rail is measured using 3 -\npoints and the lining is performed until the measurement at middle \nmeasuring point reaches the target versine value. This method restores the \ngeometry to almost perfect provided correct measurements are fed. \n209 4 Point Lining method \n(1) Lining principle - This method can be used for correcting alignment of only \nthe curved track. In this method track is measured at 4 references point and \nversines measurements of two intermediate points are compared (using \ngeometrical versine ratio relation) to control the li ning. The principle \nfollowed is that, in a circular curve, versines measured at two pre -decided \nlocations on a chord of given length will have a fixed ratio, depending on the \nposition of measuring points. This versine ratio is constant and is \nindependent of the radius of the circular curve . The four points in machines \nare as below- \n \nFig. 2.8 \nHere A is the rear trolley location, B is the location of measuring trolley \n(where versine is measured), C is lining trolley (where also versine is \nmeasured and correction is done), and D is the front trolley location. \nTAMPING UNIT LIFTING & LINING UNIT \nMEASURING POINT \nLINING POINT TARGATED CURVE \nCHORD EXISTING CURVE \nB C D A \nH2 H1 \nDIRECTION OF WORK \nFRONT TROLLEY \nREAR TROLLEY", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 51, + "text": "30 \n \nTrolleys at A, B, C and D are pneumatically pressed against the outer rail \n(reference rail selected for alignment). A wire forming the chord is stretched \nbetween A and D representing the ‘base Line'. The transmitting \npotentiometers (transducers), which are fixed to the measuring trolley B and \nlining trolley C are connected to this wire by means of forks and the wire \ndrives for measurement of versines. The geometrical property used in this \nmethod is explained below- \n \n \nFig 2.9 \nFrom the above figure, \nTheoretical Versine H1 = \n𝑨𝑨𝑨𝑨.𝑨𝑨𝑪𝑪\n𝟐𝟐𝟐𝟐 \nTheoretical Versine H2 = \n𝑨𝑨𝑨𝑨.𝑨𝑨𝑪𝑪\n𝟐𝟐𝟐𝟐 \nVersine Ratio i = \n𝑯𝑯𝑯𝑯\n𝑯𝑯𝟐𝟐 = \n𝑨𝑨𝑨𝑨.𝑨𝑨𝑪𝑪\n𝑨𝑨𝑨𝑨.𝑨𝑨𝑪𝑪 (is independent of radius of the curve) \n \n𝑯𝑯𝑯𝑯 = 𝒊𝒊. 𝑯𝑯𝟐𝟐 \nMachine does the curve correction by slewing point C, until Versine H 1 is in \nthe correct ratio to H 2 (H1 =i.H2). The Versine Ratio ‘i’ is the property of \nmachine and depends on respective distance between the trolleys. The value \nof ‘i’ for various machines are listed in Annexure 2.9 \nIn a four point lining system, location of A is taken as first reference point for \nsubsequent corrections. It is, therefore, important to choose initial point, on \nthe track with correct geometry, as pre -existing error at the initial point will \nget transmitted to track location being corrected. All subsequent corrections \nwill also have accumulated errors. \nPoints A & B of the machine always remain on the corrected track (corrected \nw.r.t previous positions). Point D always remains on the portion of track, \nwhich is yet to be corrected. Lining correction is done at p oint C. The \nmachine system feeds H\n2 in system, where it is multiplied with constant i , to \ngive H1. This value (H 1) is then fed in difference amplifier and error, if any, is \nindicated on the galvanometer. The alignment is corrected at C by lining \nA B C D \nR H2 H1 \nDIRECTION OF WORK", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 52, + "text": "31 \n \nunits so that H1 becomes equal to H 2.i or the ratio H1/ H2 = i is maintained \nand galvanometer indicates zero reading. \nIn the machine having satellite units, the constant value ‘i’ may vary due to \nrelative movement of position C. To overcome this problem a compensation \nsystem is provided to automatically adjust for measuring locations. \n(2) Application of 4-Point Lining Method - 4- point lining method can be used in \nfollowing situations- \n(a) When theoretical track geometry is either not known or not required \nto be kno wn, track is aligned according to geometrical properties of \nexisting curve. \n(b) When, due to the location of track defects, the track slewing values are \nexpected to be so large that they cannot be implemented without \nadditional measures, and it is decided to smoothen the curve and \nrather than bringing it to the targeted/design profile. \nLining can also be carried out according to reference points or previously set \nslewing values, as explained below- \n210 Corrections to be applied in 4 Point Lining method - The curve to be \ncorrected as explained above has to be further compensated for following errors- \n• The error due to front trolley being on disturbed track, \n• At variable curvature where front trolley and rear trolley are on curve of \ndifferent radii and the ratio of H 1/H2 equal to ‘i’ does not remain true, like \ntransitions portion of the curve or while exiting and entering from one \ncurve to another. \n(1) Correction (FD) in 4 Point Lining due to Front trolley on Disturbed track \n \nFig. 2.10 \nIn figure 2.10, curve marked 1 shows the targeted alignment, 2 shows \nexisting position of track (disturbed) being attended and 3 is corrected \nalignment with front trolley on disturbed track.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 53, + "text": "32 \n \nPoints A and B in figure 2.10 are on the previously aligned track, po int D is \nthe front end of the chord i.e. front trolley is on the disturbed track with an \nerror FD, resulting in incorrect measurement of versine H 2. Point C is slewed \nuntil H1 is in the correct ratio to incorrectly measured H2. Depending on the \ndistances of the measuring points (which are fixed for a given machine), an \nerror remains at lining Point C, as shown in the figure, which is also called left \nover error or residual error ‘FR’. \nLeft over error FR = 𝑭𝑭𝑪𝑪/𝒏𝒏𝟒𝟒𝟒𝟒𝟒𝟒 \nError reducing ratio n4pt = \n𝑨𝑨𝑪𝑪.𝑨𝑨𝑪𝑪\n𝑨𝑨𝑨𝑨.𝑨𝑨𝑨𝑨 \nValue n4pt depends on trolley distances and its value for various machines \nare given in Annexure 2.9. \nA Correction equal to F D in the direction opposite to it needs to be fed in \nfront tower to eliminate this left over error, to apply FR at lining trolley. \nThe FD value has to be computed from the readings taken during field survey \nto be done prior to tamping. Either of the two methods may be adopted for \nthe field survey. \n• Measurement of versine on reference rail of the track (which is \ngenerally termed as disturbed track) and calculating slews by suitable \nsoftware for realignment of curves, for deciding target curve which \nwill be termed as desired curve. \n• Survey with respect to fixed references like reference post, OHE masts \netc. This is to bring the track on targeted alignment which is termed \nas design lining. \n(2) Versine Compensation (V) in 4 Point Lining at location with changing \ncurvature \nFor simple curves with transition at either end, the corrections are applied at \nfollowing sections of the curves: \n• For entry of m achine from straight to transition and exi sting from \ntransition to straight. \n• Machine working in transition. \n• For entry of machine from transition to circular curve and exis ting \nfrom circular to transition curve. \nWhen machine enters from straight to (leading) transition with front trolley \non transition and rear trolley on straight, the measurement of H\n2 and H1 are \nas shown below:", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 54, + "text": "33 \n \n \nFig. 2.11 \n \nThe correct versine at C will be H 2.i +V, where V is the versine compensation \nrequired to bring track to target position. In the above curve, this \ncompensation wil l be towards outside of the curve. The value of \ncompensation increases as transition curve is parabolic of third degree and \nwill become maximum (V\nm) when entire machine is on transition curve and \nwill then remain constant. \nWhen the machine enters from leading transition to circular curve, the \ncompensation reduces from V m and will eventually become zero when the \nentire machine enters the circular curve. Similarly , when the machine enters \nfrom curve to trailing transition and from trailing transition to straight, the \nversine compensation is applied in opposite direction as shown below: \n \n \n \n \nFig. 2.12 \nNote: Versine correction is applied at trolley C but is to be fed by operator in \nfront cabin and therefore to be written for front trolley D location i.e CD \ndistance ahead of where it is applied. The above graph has been made \naccordingly. \nTC \nCT \nTS \nCORRECTION FOR TRANSITION CURVES WITH LINEAR CURVATURE \nL1 L2 \nR \nVm1 Vm2 \nST \nCIRCULAR \nLo \nLo \nLo \nLo \nDIRECTION OF WORK \nA B \n \n C D \nV \nH1=H2xi \nH2 \nDIRECTION OF WORK", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 55, + "text": "34 \n \n Here R is the radius of circular curve, L1 and L2 are the transition length at \neither end, L o is the chord length of machine, and Vm1 and Vm2 are \nmaximum versine compensations at the two ends. \nThe value of Vm depends on 3 factors i.e. position of different trolleys of the \ntamping machine, length of transition and radius of circular curve and \nworked out by formula: \n𝑽𝑽𝑽𝑽 = 𝑴𝑴𝑴𝑴𝑴𝑴𝑴𝑴𝒊𝒊𝒏𝒏𝑴𝑴 𝑨𝑨𝑪𝑪𝒏𝒏𝑪𝑪𝟒𝟒𝑴𝑴𝒏𝒏𝟒𝟒/𝑳𝑳. 𝟐𝟐 \n𝑴𝑴𝑴𝑴𝑴𝑴𝑴𝑴𝒊𝒊𝒏𝒏𝑴𝑴 𝑨𝑨𝑪𝑪𝒏𝒏𝑪𝑪𝟒𝟒𝑴𝑴𝒏𝒏𝟒𝟒 = (𝑨𝑨𝑨𝑨. 𝑨𝑨𝑪𝑪. 𝑨𝑨𝑨𝑨)/𝟔𝟔(AC, CD, BC are shown in Fig 2.8) \nVariation of V is not linear from zero to maximum value (V\nm). The value of Vm \nfor different lengths of transitions and radii of curves along with \ncorresponding values of V at intermediate locations are given in machine \nmanufacturer’s instruction manual. \nA sample distribution for V in the c hord length of Lo as given manufacturer’s \ninstruction manual is given in Annexure 2.10 for guidance. \nIn machines with ALC, radius of curve and transition length can be fed into \nALC, and feeding of V value is done by ALC itself. \nExample-2.2 below explains the method of calculating V and Vm value. \nExample 2.2: \nTo attend a curve of radius R=583 m with transition length 70 m by \nDUOMATIC 08-32C using 4 Point method. \nFor DUOMATIC 08-32C from Annexure 2.9 \nAB=5.0 m, BC=5.3 m, CD=9.35 m, AC=10.3 m, BD=14.65 m and AD=19.65 m. \nMachine constant= (10.3x9.35x5.3)/6=85.06, \nHence Vm=85.06/70x583=0.002 m i.e. 2.0 mm \nFrom Annexure 2.10 \nV value from straight to transition- \nDistance from ST \nand CT (Meter) \n0 to 8 m 9 to 13 m 14 to 19.7m \nV in mm 0 1 2 \n \nDistance from TC \nand TS (Meter) \n0 to 8 m 9 to 13 m 14 to 19.7m \nV in mm 2 1 0 \nST, CT, TC and TS stands for straight to transition, curve to transition, \ntransition to curve and transition to straight respectively", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 56, + "text": "35 \n \nFor remaining portion of transition length V=V m should be fed. Direction of \nfeeding will be as shown in Fig 2.12. \nNote: These values are to be written on sleeper s to be fed in versine \npotentiometer in front cabin when front trolley is above that location \nThe general principle followed in deciding the direction of feeding (toggle \nswitch) versine compensation is as below: \nIf machine is entering:- \n From large radius (straight has infinite radius) to low radius \n­towards outside \n From Low radius to large radius ­towards inside \nVersine compensation and its direction in different curve layout are as \nbelow: \n(a) Curve with Transition \n(i) Straight to Transition to Curve to Transition to Straight \n \n \n \nFig. 2.13 \n \n \n \n \n \n \n \n \n \n \n \nFig. 2.14 \n \n \n \nTRANSITION “L” STRAIGHT \nSTART OF TRANSITION \nDIRECTION OF \nADJUSTMENT \nEND OF \nTRANSITION \nVm \nCHORD LENGTH \nCHORD LENGTH \nST TC \nDIRECTION OF WORK \nCURVE \nSTRAIGHT TRANSITION CURVE \nDIRECTION OF WORK \nSTRAIGHT \nCHORD \nLENGTH CHORD \nLENGTH \nCT TS \nDIRECTION OF \nADJUSTMENT END OF \nTRANSITIO\n \nSTART OF \nTRANSITION \n \nVM \nCURVE TRANSITION STRAIGHT \nTRANSITION “L”", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 57, + "text": "36 \n \n \n(ii) Compound Curve \n• R1>R2 V0=V2-V1 \n \nFig.2.15 \n \n• If R1R2) Fm0=Fm2-Fm1 (Fm1 and \nFm2 are corrections as given by machine manufacturer \nfor curve 1 and 2 respectively)", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 59, + "text": "38 \n \n \nFig. 2.19 \n• CURVE 1 TO CURVE 2 (R1 1.25o 60 Kg/52 Kg HRS \nHigh mild ≤ 1.25o 60 Kg/52 Kg HRM \nLow sharp ≤ 1.25o 60 Kg CPF \nLow mild > 1.25o 60 Kg CPC \nTangent UP/DN 52 Kg CPC \nLow sharp and mild UP/DN 52 Kg CPC \nFor the straight track, 2 profiles have been designed. CPC would be used on ‘Down’ \ntrack and CPF will be used for ‘UP’ track. The idea is to have half of the straight \ntrack with CPC and the balance with CPF. In case of long stretches of single line \ntrack, half of it will be demarcated for CPC and the other half for CPF. \n(5) Grind Patterns – Loram in consultation with NRC Canada has designed 49 patterns \nfor Indian Railways for grinding. Since the target rail profile changes from straight to \na curved track and will also be different for the high rail and the low rail of curved \ntrack, the pattern to be selected will also be different for all such situations. The \npatterns are shown in Annexure 5.2. \nOnly one pass is generally done for straight track and 3 passe s are done for curved \ntrack. 3 passes on curved track are done in the same block by stopping the machine \nafter first pass, doing second pass by running the machine in reverse direction, again \nstopping the machine after second pass on curve followed by thir d pass in normal \ndirection. For the first pass on curves, pattern suggested by Loramis used. The \npattern for second and third grinding passes on curves is suggested by GDMS from \nthe list of patterns on the basis of profile achieved after first grinding pas s and \nknown target profile. Target profile is known to machine on the basis of track data \nwith detail of tangent, curve, starting and end of curve etc. fed in GDMS in advance. \nThe patterns suggested in Annexure 5.2 are only for first cycle of grinding on t he \nsection. For subsequent cycles of grinding, the patterns are required to be revised. \n(6) Grind Cycle – The grind cycle suggested by M/s Loram for preventive -gradual \ngrinding is as below \nTable 5.2 \nCumulative \nGMT in the \nsection from \nstart of \ngrinding Cycle # \nTrack Classification \nTangent \n(Straight) \nTrack Mild Curves Sharp Curves Test Sites \n0 Grind 1 Single Pass at \n15 kmph \n3 passes at 18 \nkmph \n 3 passes at 18 \nkmph \nMonitor \nProfile \n25 \n(Approx) \nGrind 2 Single Pass at \n15 kmph \n3 passes at 18 \nkmph \n3 passes at 18 \nkmph \nMonitor \nProfile \nand RCF", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 185, + "text": "164 \n \n75 \n(Approx) \nGrind 3 Single Pass at \n15 kmph \n3 passes at 18 \nkmph \n3 passes at 18 \nkmph \nMonitor \nProfile \nand RCF \n125 & so on \n(Approx) \nGrind 4 \n& so on \nSingle Pass at \n15 kmph \n3 passes at 18 \nkmph \n3 passes at 18 \nkmph \nMonitor \nProfile \nand RCF \nThe grind cycle may vary for some special sections like KK line, for which separate guidelines \nwill be issued by RDSO. \nWhere more than one pass is required (generally on curves), speed and patterns for the second \nand the third pass will be as suggested by GDMS software. \n506 Monitoring Equipment for Grind Quality \n(1) MINIPROF – MINIPROF is an equipment to measure the profile of the railhead to the \naccuracy of 0.054 mm. This is contact type rail profile measuring system. The \nMINIPROF data is useful for knowing the wear of rail due to traffic and wear of the \nrail due to grinding. It is als o used to compare the post grind profile to the target \nprofile to assess the appropriateness of the grinding parameters. \n(2) Bar Gauge – This is a hand held instrument used for measuring of profile of the \nrailhead. Four templates are attached to this gauge for 4 target profiles, namely CPC, \nCPF, HRS and HRM. Deviation of existing profile from target profile is quickly known \nby putting one of the templates over the railhead and then using taper gauge to \nmeasure the gaps. The tolerances to the template are given in table 5.3. \nTable 5.3 \nTolerances to Templates \nTemplate Lower Gauge \nCorner (+600 to \n+160) in mm \nMid Gauge \nCorner (+600 to \n+60) in mm \nField (oo) mm Far Field >oo \nMm \nHS +0 to -0.6 +0 to -0.6 +0.3 to -0.3 +0.3 to -0.3 \nHM +0 to -0.6 +0 to -0.6 +0.3 to -0.3 +0.3 to -0.3 \nLS-CPF +0.3 to -0.3 +0.3 to -0.3 +0.3 to -0.3 +0.3 to -0.3 \nLM-CPC +0.3 to -0.3 +0.3 to -0.3 +0.3 to -0.3 +0.3 to -0.3 \nT-CPC +0.3 to -0.3 +0.3 to -0.3 +0.3 to -0.3 +0.3 to -0.3 \nT-CPF +0.3 to -0.3 +0.3 to -0.3 +0.3 to -0.3 +0.3 to -0.3 \n +0.3 to -0.3 +0.3 to -0.3 +0.3 to -0.3 +0.3 to -0.3 \n(3) Star Gauge – This gauge is in the form of template having five different rail top radii. \nThis instrument is used to make a quick check to compare the actual radius of the \nrail top, before and after grinding operation. \n(4) Digital Inclinometer – This is used to know the angle of grinding stone at a particular \npoint on the rail surface. By simply keeping the instrument at a particular location, \nthe angle will be known in digital form. \n(5) Surface Roughness Measuring Gauge – Roughness after grinding is high. This gauge \nmeasures the ro ughness of rail. Roughness after grinding should be within \nacceptable limits (less than 12 micron).", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 186, + "text": "165 \n \n(6) Rail Hardness – The grinding should not cut the head hardened layer from rail top \ncompletely. This will increase wear rate after grinding. This instrument is used to \nmeasure hardness before and after grinding. \n507 Working of RGM \n(1) Feeding of Track Data- \n(a) The track, prior to grinding, is surveyed and track data fed in anexcel sheet, as \nper proforma enclosed at Annexure 5.3, and e-mailed to RDSO. \n(b) The formatting of field data to GDMS format for use in RGM is done by RDSO. \n(2) Patterns and target profiles are pre-fed in the machine. Thesecan be modified, if \nrequired. \n(3) Pattern for first pass is as recommended by Loram. Curves require 3 passes during \nthe same block. The pattern for second and third pass on curves is suggested by \nGDMS on the basis of Rail profile achieved after previous pass and final target rail \nprofile (CPC/CPF/HRS/HRM) desired for the track geometry at that location. \n(4) RGM can work in either direction. Therefore, direction of machine is not required to \nbe changed for second and third pass in curves. \n(5) Since lot of sparks are generated during grinding and there is fire hazard associated \nwith grinding, due precautions should be taken in this regard. \n508 Quality Inspection of Grinding - It is essential to monitor quality of grinding. \nFollowing methods are used for asse ssing the benefit of grinding and grind quality \nachieved. \n(1) Test Site Monitoring – A typical test site is represented in the Fig 5.6 below. It \nconsists of stretch of track covering three sleeper spacings divided into three parts – \nfirst for measuring rail p rofile by MINIPROF (Marked as MP), second for taking \nsurface photographs and the third for doing Dye Penetration Test and taking DPT \nphotographs. \n \nFig. 5.6 \nMP \nSURFACE \nPHOTOGRAPHS \nDYE \nPENETRATION", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 187, + "text": "166 \n \n(a) Test Site – Each test site is selected so as to be representative of 20 or 50 km \nlength of track. Inter-distance of the test sites will depend on the variation in \nthe features in that section as explained below, along with some more \nrequirements of test site: \n(i) Separate test sites should be chosen for differe nt track structures (52 \nkg/60kg. \n(ii) For any major change in gradient or formation structure, separate test \nsite should be selected, \n(iii) Typically one SSE/ P.Way section should have minimum one test site \neach for mild curve, sharp curve and tangent track. \n(iv) Test site should be accessible by road for ease of taking \nmeasurements. \n(v) The rail of the test site should not be due for renewal in next 3-4 years. \n(vi) It should be away fr om signals, l evel crossing, yards, bridges etc. so \nthat it is on a stretch on which traffic normally moves at normal speed \nof the section. \n(b) Measurement by MINIP ROF – The first portion of the test site is marked as \n‘MP’ and an arrow is painted here. This is the location where rail profile will \nbe measured every time before and after the grinding. The closer is the \nachieved profile of the rail to the target profile afte r grinding; the more will \nbe the benefits accruing from it. It is essential to monitor the deviation of \nthe post grinding profile with the target profile. This will also help in making \na decision on the choice of the pattern for the future grindings. \n(c) Monitoring Contact Band – The location of contact of the wheel on the rail \nshould change after the grinding. The rail -wheel contact band indicates this. \nMost of the wheels should make a contact on rail in a desired width on the \nrailhead. Therefore, a clear chan ge in contact band location and size \nshouldbe visible after the grinding. The contact band is to be monitored in \ncurve and on straight track before and after grinding. Identification of \ncontact band on railhead is done by spraying paint or making chalk marks on \nrail surface and allow a freight train pass over it. This will manifest in a form \nof erasing of the paint or chalk covered area in a band like formation. Details \nof location, date, width of contact band, distance from gauge face etc. \nShouldbe written and a photograph showing contact band and details \nwritten on rail foot is taken for record. \n(d) Dye Penetration Test – At the second portion of the test site, dye \npenetration test is done, so that the damage on the rail surface including the \ncracks will become prominent. Dye penetration test is carried out before and \nafter grinding. Extent of reduction in number and length of cracks indicates \nthe efficacy of the grinding.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 188, + "text": "167 \n \n(1) Other Quality Checks \n(a) Monitoring Rail Surface Finish – The condition of the rail top after grinding \ngives a lot of clues about the quality of grinding. A good finish should have \nregular grind marks of the grinding stones (these are known as facets) with \nsilver finish. A bad finish will have irregular marks or skipped grinding at \nregular interval or blue colour on rails at certain locations (known as blueing \ndefect) or irregular facet width etc. The facet width (the width of the marks \nleft by grinding wheels) should be about 10 mm in the centre of the rail and \n4 mm at the corners. \n(b) Surface Roughness after Grinding – The rail surface should not become too \nrough after the grinding. The surface roughness level should not go be yond \n12 microns after grinding. \n(c) GQI before & after Grinding – GQI stands for Grind Quality Index, which is a \nmeasure of the efficacy of the grinding with respect to the target rail profile. \nThe GQI value 100 indicates that the target profile has been achieved fully. \nThe lower the value, the more is the deviation from the target profile. During \nthe run, GDMS screen displays GQI for both the rails before and after \ngrinding separately. GQI of 80 and above is considered acceptable. \n(d) Crown radius – Crown radius of the railhead is measured before and after \ngrinding by star gauge. The crown radius should be closer to 250 mm at \ncentre of railhead after grinding. \n(e) Monitoring at RDSO – Performa enclosed as Annexure 5.4 is to be filled by \nfield units and sent to RDSO every time before and after grinding. RDSO shall \nstudy the data received from different railways and decide on appropriate \ngrinding parameters and grinding cycle. The proforma may be revised by \nRDSO, based on the experience gained. \n509 Preparatory Works for Introduction of RGM \n(1) Arrange for proper stabling facilities for the machine at about every 50 km distance. \n(2) Identify the Railway Consumer Depots (RCDs) and plan for timely supply of diesel to \nthe machine. \n(3) Make the arrangements for supply of water (75000 litres) to the machine. \n(4) Plan for the adequate traffic blocks for the working of the machine. \n(5) Arrange for all the equipment for taking the required measurements. \n(6) Collect the track data for feeding in GDMS software installed in the machine. \n(7) Note down chainages of the level crossings, SEJs, Points & Xings, Axle Counters, start \nand end of c urves. Direction of track measurements for collecting details should be \nconsidered in the direction of increasing km, irrespective of direction of m ovement \nof traffic on that line.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 189, + "text": "168 \n \n(8) Find out history of the rail wear, surface damage on the rail, USFD defects, rail/weld \nfailures etc. in the section where grinding is being done and study the changes in \nthese parameters as the grinding is done. \n(9) Identify the stretches of the track which will be skipped during grinding like rails \nplanned for renewal in next two years, e.g. rails having severe corrosion and liner \nbite corrosion etc. \n(10) Establish test sites. \n(11) Open a separate file for each test site in your section. \n510 Pre-Block Activity Before Deploying RGM \n(1) Paint the sle eper prominently on either side of the SEJs, axle counter, points and \ncrossings, level crossings and at the start and end of the curve for easy \nidentification by the SSE/JE/TM while grinding. \n(2) Ensure effective communication between FCC, RCC and staff on the ground. \n(3) Counsel the staff and gatemen to keep everyone away from the machine during its \nworking to avoid injury from flying sparks and iron dust. \n(4) Counsel the staff working on track as well as the RGM to use safety gadgets such as \nhelmet, goggles, reflective jackets, shoes etc. during RGM working. \n(5) Measure the rail profile with MINIPROF, carry out DPT and take surface \nphotographs at each test site before grinding (say around 15 days prior). Keep \nthese details in the file chronological. \n(6) While filling diesel, ensure that diesel does not spill onto the rubberized spark \nguards, which may cause fire during grinding. \n511 Operation During RGM Block \n(1) On the Track \n(a) Follow on a motor trolley behind the grinding machine and lookout for the \nfire in track or on cess and take necessary action. \n(b) Check for the quality of surface finish visually for any irregular grinding, \nblueing of the rail, skipped grinding etc. \n(c) See the facet (grinding marks band) width is about 4 mm at the corners and \nabout 10 mm at the centre of the rail. \n(d) Check the surface roughness at bad locations and see that it is not exceeding \n12 microns. \n(e) Check the profile at few places on straight and in curves after grinding with \nbar gauge and check how close or away are these from the target profile. \nSee whether the profiles are within prescribed tolerances or not. \n(f) Check the rail crown radius with the star gauge, the desirable radius being \nabout 250 mm.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 190, + "text": "169 \n \n(g) Check the contact band in straight and curve track at one or two locations \nbefore and after grinding using paint/chalk in every block in addition to test \nsite. Take a photograph and keep for record. \n(h) See that the dust collection system is working properly. \n(i) Inform any irregularity noticed to the SSE/JE/TM, and get it rectified. \n(j) Ensure that a train with inflamma ble material is not allowed on adjacent \ntrack during the grinding operation, in case of double/multiple lines. \n(2) On the Machine (SSE/JE/TM) \n(a) Check whether the angles of motor, calibration of tachometer and \ncalibration of Optical rail profile measuring device (KLD) has been done by \nthe SSE/JE/TM as per the schedule. \n(b) Check the proper functioning of the water pump and water cannons etc. \n(c) Check that all the motors are working properly thro ugh the indication on \nHMI panel. \n(d) Make a chart in advance for the pattern to be selected during the first pass \nof the grinding. \n(e) Synchronize the chainage of the track on the machine before starting and \nduring the working, as required. \n(f) Check that the patterns being selected by the SSE/JE/TM are correct. \n(g) See that the grinding speed is correct. \n(h) Check that the SSE/JE/TM sequences the motors up and down correctly and \npromptly at the location of obstructions. \n(i) Check whether the direction of the curve in GDMS software is same as \nexisting on the ground. Do not use GDMS suggested patte rns for the second \nand the third pass on the curve in case the direction is wrong as it may spoil \nthe surface profile. Choose the pattern manually. \n(j) Make sure to remember to get the GDMS data corrected if the direction of \ncurve is found to be wrong, so that the similar problem is not repeated \nduring the next cycle. \n(k) See that the patterns are changed promptly by the SSE/JE/TM on entry and \nexit of the curves. \n(l) Check the GQI before and after grinding to check that there is im provement \nin GQI after grinding. \n(m) Learn the working of GDMS software including recommendation for the \npattern and speed for the second and third pass on curves. \n(n) Check the pattern in use on the monitor, in real time. \n(o) Look for any alarm on HMI of the machine and see that the SSE/JE/TM t akes \ncorrective action promptly.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 191, + "text": "170 \n \n(p) While starting the grinding, the buggies should be lowered on straight track \nonly to ensure that the buggy wheels sit properly on rails. In case of curve, \ndue to different wheel base of the buggy as compared to the wagon, the \nwheels may go off the rail on lowering. For the same reason, the raising of \nthe buggies is also done on straight track only. \n512 Post Grinding Operation \n(1) Take rail profile after grinding not later than 15 days at the test sites. \n(2) Carryout DPT test at test site within 10 –15 days after grinding and take a \nphotograph. Keep in file. \n(3) Take a surface photo at test site within 10-15 days after grinding and keep in file. \n(4) Preserve the soft copies of MINIPROF measurements and photographs. \n(5) Superimpose the rail profiles before grinding and after grinding taken by \nMINIPROF on target rail profiles and analyze the results to calculate the metal cut \nand deviation from target profile. \n(6) Ensure safe disposal of the grind dust in a yard. \n513 Utility Track Vehicle \n(1) General – It is a self -propelled 4-wheeler vehicle with crane used for loading and \nunloading and transportation of P.way materials like rail, sleeper and other heavy \nmaterials. It has the capability to attach and haul one BFR or similar r ailway wagon \nfor holding the material. Sketch of UTV with main components can be seen in \nfigure 5.7. \n \nFig. 5.7 \n(2) Main Assemblies of UTV and their Functions \n(a) Cabin – Cabin is provided on one side only. The cabin has seating \narrangement for staff. \n(b) Platform – Platform is the flat portion of the UTV, where material can be \nstacked. Loading and unloading of materials can be done either on the \nplatform or on railway flat wagon attached with UTV. \nCABIN \nENGINE \nPOWER TRANSMISSION \nCRANE", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 192, + "text": "171 \n \n(c) Crane – There are different models of UTVs. Some of the earlier model s of \nUTV had mobile crane (crane with tyred wheels mounted on flat wagon) of \ncapacity of 1.5 t at 7.5 m radius. Current models have fixed type of crane. It \nis installed on platform, having multi stage extension. Crane has its own \npower pack for its operation. The crane capacities of some machines are 1.5t \nat 7.5 m radius i.e. 11.25 tm while of others is 2 t at 7.5 m radius. It is further \nplanned to increase the crane capacity for handling a set of stock and tongue \nrail (3 t at 7.5 m i.e. 22.5 tm). \n(d) Engine – The vehicle has one diesel -operated prime mover with water-\ncooled engine for the driving the vehicle and also for crane operation. \n(e) Power Transmission – Hydrodynamic power transmission system provided \nfor transit driving and for working in the section. Both axles of vehicle are \npowered. \n(f) Brake System – Following brake system is provided on UTV Machine: \n(i) Direct Brake (service brake) – This brake is applied directly by hand \noperated valve (SA9) to all brake cylinders of both the axles through \npneumatic relay (C2W) when machine is running. \n(ii) Indirect Brake for Coupled Coach/Wagon – Indirect brake (A9) is \napplied on both machine and coupled coaches/wagon in new machine. \nIn old machine, this brake is applied separately for camping \ncoach/wagon, in addition to machine brake. \n(iii) Parking Brake – Two spring loaded separate cylinders are mounted on \nboth the wheels of one axle of the machine. This brake is applied \nautomatically when air of these cylinders released or when air system \npressure drops below 3.5 bar. \n(iv) Emergency Brake – This is applied d irectly on the machine in the case \nof emergency for immediate stopping. \n(v) Vacuum Brake – A separate power pack with own circuit is provided \nand applied when camping coach/wagon is having vacuum brake \nsystem. \n(3) Models of UTVs – Presently 7 models of UTV‘s of di fferent manufacturers are \nworking over Indian R ailways. The sketch of each machines with dimensional detail \nis enclosed at Annexure-5.5 \n(a) UTV-502 with mobile cranes by Tamper Corporation, USA. \n(b) UTV with fixed crane (11.25 tm capacity) by Phooltas Tamper, India. \n(c) UTV with mobile crane (11.25 tm capacity) by Phooltas Tamper, India. \n(d) UTV with fixed crane (15 tm capacity) by Phooltas Harsco, India. \n(e) UTV by BEML India. \n(f) UTV by BHEL India.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 193, + "text": "172 \n \n(g) UTV by OEPL India. \n(h) UTV by Trident Engineering (11.25 tm). \n(i) UTV by SAN Engineering (11.25 tm). \n514 Rail Borne Maintenance Vehicle \n(1) General – Indian Railway RBMV manufactured by Phooltas. This is an 8 wheelers \nvehicle designed for running at maximum speed of 105 kmph. This is designed to \ncarry men, material and tools and plant to worksite for attention of track. Sketch of \nRBMV with main units are shown in Fig 5. 8. The dimensional detail of RBMV in \nIndian Railways is given in Annexure 5.6 \n \n \nFig.5.8 \n(2) Main Assemblies of RBMV and their Functions \n(a) Drive Cabin – One driving cabin each is provided at both ends of the vehicle \nfor driving ineither direction. \n(b) Cabin for Men and Material – Two additional cabins are prov ided, one for \nkeeping P. Way materials, tools and plant and other for crane operating \ncabin with staff seating arrangement. 12 Nos. of staff can be accommodated \nin the staff cabin. \n(c) Crane – One hydraulic pillar jib crane is installed on this vehicle in the middle \nof flat platform, having multi-stage extension. Crane has its own power pack \nfor operation. Loading and unloading of materials is done on own platform \nas no BFR can be attached with RBMV. \n(d) Engine – The vehicle has two diesel engines, which are in u nder slung \nposition; Cummins model No. NTA855R. Each engine drives one bogie \nthrough independent power transmission. \n(e) Power Transmission – RBMV has two hydrodynamic power transmission \nsystems provided for driving as well as working in the section. These \ntransmission systems are powered by independent prime movers giving \npower to each transmission gearbox. \n(f) Brake System – Following brake system are provided on RBMV Machine: \nCABIN 1 \nFOR MEN \nAIR CLEANER \nSEAT \nTOOL BOX FOLDABLE SIDE WALL \nCABIN 2 \nFOR MATERIAL \nTRANSMISSION \nENGINE \nDRIVER'S \nCABIN 2 \nDRIVER'S \nCABIN 1 \nCUSHIONED \nRADIATOR \nCRANE", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 194, + "text": "173 \n \n(i) Direct Brake (service brake) – This brake is applied by control lever SA9 \non the both bogies of the machine through pneumatic relay C2W while \nrunning. \n(ii) Indirect Brake – This is indirect brake is applied on machine with \ncoupled camping coach /wagon automatically through pneumatic relay \nC2W when air pressure of BP line releases through valve A9 or drops. \n(iii) Parking Brake – Two springs loaded separate cylinders are mounted on \neach bogie of machine. This brake is applied automatically when air of \nthese cylinders released or when air system pre ssure drops below 3.5 \nbar. \n(iv) Emergency Brake – This is applied directly on the machine in the case \nof emergency for immediate stopping. \n(3) Salient Features of RBMV \n(a) It has payload capacity of 15 t. \n(b) It has space for carrying 2 rails of 13 m length of 60 kg or two sets of switch \nand stock rail assembly along with fittings. \n(c) One cabin to hold small track machines, tools and equipment, P.Way \nmaterials as listed for Mobile Maintenance Unit (MMU). \n(d) Seating arrangement (12) for officials accompanying RBMV in the other \ncabin. \n(e) Fitted with hydraulic crane for material handling with 1 t at 8 m lifting \ncapacity. \n(f) Has diesel operated Portable generator of 5 KVA for general lighting, welding \n& other works. \n515 Works required Before, During and After Deployment of UTVs and RBMVs \n(1) P.Way materials to be handled should be collected and stacked at locations within \nthe reach of crane boom in advance. \n(2) Availability of material handling slings and other such attachments should be \nchecked and ensured before going for the block. \n(3) Support posts in flat wagons with UTV’s /foldable side wall in RBMV’s which infringe \nin loading of material shall be lowered before starting material handling at site. \n(4) Centre line of rail piece to be handled shall be marked. \n(5) Longer rails shall be cut to pieces of less than 13 m length. \n(6) It should be ensured that the vehicle is stabilised and parking brakes are O N before \noperation of the crane. \n(7) The crane should not be used in strong wind blowing at more than 50 kmph. \n(8) The operator should have a clear view of the work area and ensure that no one is \nthere within the operating radius of the crane.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 195, + "text": "174 \n \n(9) The stability of the crane vehicle should be constantl y checked during the \nmanoeuvres. \n(10) The operator should check the details of load to be lifted and the radius of \noperation as per the load distance diagram. \n(11) The operator should be careful while working near electric power cables. \n(12) The operator should never leave the machine unattended when boom is extended \nand the load is lifted from the ground. If it becomes unavoidable, he must \nmanoeuvre the load to ground and turn-off the vehicle. \n(13) Loading/unloading and material handling should preferably be done to/from cess \nside of track. In case of handling material in between two tracks or beyond on \nadjacent running track side, proper track p rotection o n adjacent track should be \ndone. \n(14) Crane movement to infringing side shall be locked during working. \n(15) The single point slinging should be avoided to avoid risk of bending and damage to \nrail surface. The overhang should not be more than one half the distances between \ntwo lifting points. \n(16) Loading of rails and sleepers on BFR in UTV’s & on RBMV’s should normally be \nlimited to 4 and 3 layers respectively. \n(17) The rails should be kept horizontal and straight while lifting/moving. \n(18) Support posts/foldable side wall if any shall be lifted up or rails shall be tied up with \nchain to secure rails after completion of loading, before movement. \n(19) Loading should be uniformly distributed and eccentric loading should be avoided. \n(20) Crane shall be handled carefully in the electrified territory and station yards. \n(21) The staff should not stand below the suspended load for their safety. \n(22) The staff should wear protective gloves and industrial shoes to minimise the risk of \ninjury. \n(23) Items specific to UTVs \n(a) SSE/JE(P.Way) should work as guard on the machine. The guard along with the \nmachine staff should be deputed on the BRN for safety when the machine \nmoves towards the crane side with an attached BRN. \n(b) The flat wagon should have a valid BPC for the movement. \n(c) BRN should be provided with detachable hand brake operating lever. \n(24) Items specific to RBMVs \n(a) All tools and plants as prescribed for Mobile Maintenance Unit (MMU) should \nbe available in working order. \n(b) Pay Load should not be more than 15 t. \nThe staff should wear d istinctive colour helmets and clothing for easy identification by \ncrane and machine drivers to avoid accidents.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 196, + "text": "175 \n \nAnnexure 5.1 \nImportant Features/Dimensions of RGI Control Car \n \n \n \n \n \n \nWHEEL DIA LOAD WIDTH AXLE NAME OF MACHINE \nRGI GRIND CAR 19304 \nA B C D E F G \n2000 3099 4013 4231 1683 1000 20.0t \nRGI GRIND CAR \nMAX \nFLOOR \nF \nC \nB D \nG \nA D B \nC \nE \nRGI CONTROL CAR \nWHEEL DIA LOAD WIDTH AXLE NAME OF MACHINE \nRGI CONTROL CAR 19304 \nA B C D E F G \n2743 13114 3095 4104 1683 1000 22.75t \nA \nB D \nE \nC D \nF \nMAX \nFLOOR", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 197, + "text": "176 \n \nAnnexure 5.2 \nPattern Sheet", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 198, + "text": "177 \n \nAnnexure 5.3 \nPerforma for Data to be fed in GDMS \nId \nLine Seg \nRegion \nDivision \nSubdivision \nTrack \nStart \nEnd \nKm \nStart M \nLength \nCurve Num \nST \nTC \nCT \nTS \nVersine \nSuper Elev \nDegree \nCurve Dir \nCX Num \nCx Loc \nCx Width \nStation \nSta Loc \n1 \n2 \nPrefix: \nSub Division Start & End Length Cx Loc/Width \nAEN Sub Div Section Sub Div Sec KM KM Chainage in mtrs Level Crossing Location & Width \nPrefix: \nST TC CT TS \nStart Transition Start Circular Curve End Circular Curve Transition to Straight \n Transition End Start Transition End Transition \n \nNote: Consider following steps: \n1. Curve details in km point in meter format up to 3 digits \n2. In compound curve both curve bifurcate by at least 1 m. \n3. For UP and DN track complete details in increasing km \n4. Transition-Curve-Transition should be at least 1 m apart. \n5. Single curve is in 1 line (starting km). \n6. Complete GDMS Data in sample of 25 column format considering prefix details given in sample \nformat. \n \nColumn Data \nColumn \nData Type Importance \n1. Id Text Recommended The row number in the file. An aid to editing. \n2. LineSeg Text Required User provided name of the track line \nsegment. Names should be letters, numbers, \nunderscore or dash. \n3. Region Text Required Railroad Region. \n4. Division Text Required Railroad Division \n5. Sub Division Text Required Railroad Subdivision \n6. Track Text Required Track Name. Typically UP, DN, SL, 1, 2, 3, etc. \n7. Start Float Not Used The start Sta+Off of track segment.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 199, + "text": "178 \n \nColumn Data \nColumn \nData Type Importance \n8. End Float Not Used The end Sta+Off of track segment. \n9. Km Int Required An integer value specifying the kilometer \nlocation. \n10. StartM Int Not Used \n11. Length Float Required The length in meters of the specified \nkilometer. \n12. CurveNum Text Not Used Curves are named by the program based on \nthe curve start point. \n13. ST Sta+Off Required The first point of the curve. \n14. TC Sta+Off Required The second point of the curve. \n15. CT Sta+Off Required The third point of the curve. \n16. TS Sta+Off Required The fourth point of the curve. \n17. Versine Float Required The Versine of the curve. \n18. Super Elev Float Not Used \n19. Degree Float Required The degree of the curve. \n20. CurveDir Text Required Either RH or LH indicating the direction of the \ncurve. \n21. CXNum Text Optional The crossing name. Ignore if Cx Loc is missing. \nIf missing and a Cx Loc is provided, the \ncrossing is given a unique number. \n22. Cx Loc Sta+Off Optional The crossing location. \n23. Cx Width Text Optional The crossing width of description. \n24. Station Text Optional The name of the station. Ignored if Sta Loc is \nmissing. If missing and a Sta Loc is provided, \nthe station is given a unique number. \n25. Sta Loc Sta+Off Optional The location of the station. \n \nRULES: \nUnknown data fields should be left blank. Do NOT enter periods (.), dashes (-), etc. \nSta+Off-Track positions are entered in station+offset format. Where offsets are less than 1000 meters \nfloating point format is also allowed, For example, a crossing located at 781 meters past kilometer post \n4 could be entered either as 4+781 or 4.781, however a curve point located at 1025 meters past km post \n12 must be entered as 12+1025. Curve point (ST , TC, CT, TS0 must be in ascending or descending order \nand cannot be equal. Adjacent curves must be s eparated by at least 1 meter. The body of the curve (TC -\nCT) should be at least 20 meters. Names of LineSeg, Region, Division, Subdivision and Track are case –\nsensitive. The Versine and Degree of curve must match within one half a degree.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 200, + "text": "179 \n \n \nAnnexure5.4 \nRail Grinding Monitoring Proforma \n(A) For Sites Identified for Monitoring \nRly……………Divn……………. ………. Section……………… Km/TP……………… \nRail Section/ UTS……… Type of sleeper……………Sleeper Density……… Ballast cushion………… \nTangent/Curved Track……….. Degree of Curve………………....Line(UP/DN)……………………..Axle Load……… \nTotal GMT carried………… GMT( Current)………………. Date of last Grinding……………Gauge(in mm)….……… \n \nS.No. Item Observations on Left \nRail \nObservations on \nRight Rail \nRemarks \nBefore \nGrinding \nAfter \nGrinding \nBefore \nGrinding \nAfter \nGrinding \nA Visual Inspection * \n1.Gauge corner chipping. \n2.Flow of rail top / Burring \n3.Gauge corner fatigue cracks \na) Pitch(mm) \nb) Length(mm) \n4.Wheel burns and Scabbing \n5.Any other defect observed \nB Corrugation \n1.Pitch (mm) \nC Hunting \nPitch of cycle \nD \n \nType of contact of wheel on \nRail \n \nOne point contact \na)Width (mm) \nb) Position (Centre line) from \ngauge face side (mm) \n \nTwo point contact \na)Width (mm) \nb) Position (Centre line) from \ngauge face side (mm) \n \nMultiple point contact \na)Width (mm) \nb) Position (Centre line) from \ngauge face side (mm) \n \n Contact patch \n a)Width (mm) \n b) Position (Centre line) from \ngauge face side (mm)", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 201, + "text": "180 \n \nS.No. Item Observations on Left \nRail \nObservations on \nRight Rail \nRemarks \nBefore \nGrinding \nAfter \nGrinding \nBefore \nGrinding \nAfter \nGrinding \n \nE Wear pattern of rail To be \nmeasured by \nMiniProf Rail \nProfile \nmeasuring \nequipment \nand soft \ncopies of rail \nprofiles be \nsent. \n 1.Gauge face \n 2.Top table \nF Track Geometry \n Gauge \n Cross level \n Unevenness \n Alignment \n \n*Photograph of the test locations after DPT indicating condition of rail be sent.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 202, + "text": "181 \n \nRail Grinding Monitoring Proforma \n(B) Route Specific \n \nRly……….. Divn………… Section………. From Km/TP………To Km/TP… Line(UP/DN)……. Type of \nRails…………Vintage of rails … …Type of sleeper…… …Sleeper density…………. Ballast cushion………… \nDate of last Grinding………… Total GMT carried …………. Annual GMT……………….. Axle Load…………………. \n \nS. \nNo. \nItem Tangent Track Curved Track Remarks \nLeft Rail Right \nRail \nDegree \nof \ncurve \nOuter \nrail \nInner rail \nA Full details of \nLocations of Rolling \nContact fatigue (Head \nchecks), Corrugations, \nand Hunting on Left \nRail and Right Rail for \ncomplete route \n Details be \nenclosed as per \nthe format in \nterms of Km/TP \nand chainage \nex Km/TP. \nB USFD Testing # \n1. No. of IMR defects \nin rail \n \n2. No. of OBS defects \nin rail \n \n3. No. of IMRW \ndefects in weld \n \n4. No. of OBSW \ndefects in weld \n \n5. Defect generation \nrate (DGR) of \nrails/km/ GMT \n \n4. Defect generation \nrate (DGR) of \nwelds/km/ GMT \n \nC No. of fractures # \n1. Rail \n2. AT weld", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 203, + "text": "182 \n \n3. FB weld \nS. \nNo. \nItem Tangent Track Curved Track Remarks \nLeft Rail Right \nRail \nDegree \nof \ncurve \nOuter \nrail \nInner rail \nD Track Geometry \n1. SD of Gauge \n2. SD of Cross level \n3. SD of \nUnevenness \n \n4. SD of Alignment \nE Wear pattern of \nWheels \nTo be measured by MiniProf Wheel Profile measuring equipment and \nsoft copies of wheel profiles be sent. \n \n# The details shall be provided for the duration between two grinding cycles. In case of first round of \ngrinding, data for same duration preceding grinding operation be given.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 204, + "text": "183 \n \n \nAnnexure 5.5 \nImportant Features/Dimensions of Utility Track Vehicle &Rail Borne \nMaintenance Vehicle \n \nCABIN 1 AIRCLEANER \nRADIATER \nCUSHIONED SEAT \nTOOL BOX FOLDABLE \n SIDE WALL \nCABIN 2 \nRAIL BORNE MAINTENANCE VEHICLE \nNAME OF \n RAIL BOUND \nMAINTENANCE VEHICLE \nPILLAR JIB CRANE HYDRAULICALLY \nOPERATED (TELESCOPE \n \nHINGE WITH \n \nA B C D E F \n22270 21000 14783 2896 1105 4125 \nALL DIMENSIONS ARE IN mm. \nWHEEL \n \nAXLE \nLOAD WIDTH \n952 18.25t 3245 \nA \nB \nC \nD D \nE \nF \nNAME OF \nMACHINE \nUTV(BEML) \nA B C D E F WHEEL \nDIA \nAXLE \nLOAD WIDTH REMARKS \n9770 8500 6100 635 4115 1092 \n13.5t \n3050 \nALL DIMENSIONS ARE IN mm. \nWITHOUT \nMOBILE CRANES \n13170 11900 8000 635 1050 3950 915 20.0t 3000 WITH MOBILE \nCRANES \n13170 11900 8000 635 1050 3550 915 20.0t 3000 \n2900 915 10270 9000 6500 635 1067 3830 \n20.0t \n12120 10850 7000 635 1150 3550 915 3002 15.0t \nUTV(PHOOLTAS) \nUTV(PHOOLTAS) \nUTV(OEPL) \nUTV(BHEL) \nE \nF \nA \nB \nC \nD \nUTILITY TRACK VEHICLE", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 205, + "text": "184 \n \nCHAPTER 6 \nPLANNING AND DEPLOYMENT \n601 Planning \n(1) Working and deployment of all track machines in a Zonal R ailway shall be under \noverall control of CE/TM. \n(2) By 5 th Feb every y ear (after the Budget), Sr. DEN /Co-ordination of divisions will \nsend to CE/TM, their requirement plan for the track machines, for a period of 18 \nmonths starting from 1st April of coming year, based on maintenance needs, track \nrenewal needs, etc., keeping in view the various aspects deta iled below. Likewise, \nthe construction organizations, PSUs and other agencies will also project their \nrequirement for the coming financial year. Draft deployment program for CTR/TSR \nshall be drawn out by the office of CE/TM once the targets are prepared an d \ndiscussed with Railway Board and this shall be sent to the divisions and other units. \n(3) The annual programme shall be prepared for the period of 18 months – firm \nprogramme for 12 months commencing from 1st Apr of the first year and tentative \nprogram for 6 months of second year starting from 1st April of second year i.e. \nprogramme drawn in Feb’17 will be up to 30th Sep’18 – firm programme for 12 \nmonth period from 1st Apr’17 to 31st Mar’18 and tentative for 6 months period \nfrom 1st Apr’18 to 30th Sep’18. This will help the divisions to finalize the tenders \nfor support activities in time. \n(4) In drawing the programme, the following aspects shall be taken into consideration \n(a) Base depot locations for TLE/TRT etc. \n(b) Loco requirements, and loco power availability. \n(c) Block requirements, and block availability. \n(d) Ballast needs and supply prospects. \n(e) Speed restrictions. \n(f) Working season. \n(g) Output of individual machines. \n(h) Effective availability of machines, taking into account slots for POH/IOH , \nmajor repairs and shifting, etc. \n(i) Priorities/targets for completion of projects/works. \n(j) Co-ordination with and requirement of S&T and TRD branches. \n(k) Any other factor having a bearing on machine utilization. \n(5) Targets – Annual targets for each type of machine are fixed by Railway Board in \nconsultation with zonal railways. The factors which are to be taken in deciding the \ntargets is: \n(a) Track maintenance works due at the beginning of the year.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 206, + "text": "185 \n \n(b) Track renewal targets. \n(c) Availability of machines on the railway taking into consideration the planned \nmaintenance operations like POH and IOH. \n(d) Availability of traffic blocks including corridor blocks. \n(e) Progress per machine per month for past 3 years on the railway. \n(f) Progress per machine per month for past 3 years on Indian Railway. \n(g) Age of the machine. \n(6) Requirement of the divisions, construction organizations, PSUs and other agencies \netc. shall be examined by CE/TM in consultation with the CTE at t he Zonal HQ and \ndraft deployment program for 18 months – firm program for 12 months in addition \nto tentative program for 6 months shall be issued by 25 thFeb every year. The \ndivision should study and inform of any changes and/or correction to draft \ndeployment plan within 15 days. CE/TM will issue the final deployment \nprogramme, after examining the suggestions by the divisions. \n(7) The Divisions and Construction units on receipt of the deployment plan shall \ninitiate all preliminary works such as development of base depots, finalization of \ncontracts, arranging blocks, locomotive, drawing MOUs, collection of matching \nmaterials, ballast collection, co -ordination with other branches, machine staff \naccommodation, procurement of consumables like diesel oil etc. so that no time is \nwasted once the machines reach the site. \n(8) The machines on arrival in the section/divisions/construction units shall be \ndeployed as per the approved deployment program, their progress closely \nmonitored, works completed in time and machines handed over to the next work \nsite as per the program. Any deviation from the approved program, which should \nbe an exception, shall be got approved by CTE or CE/TM in advance. Copy of \ndeployment program at HQ and divisions shall be corrected accordingly. \n(9) Sr.DEN/Co shall arrange for expeditious movement of machines in their respective \ndivisions as per the approved program. Sr.DEN/DEN of the section shall ensure \ntimely completion of all preparatory works in the section whe re the machine is \ndue to arrive. \n(10) Whenever mac hines of other Divisions/Railway are passing through a division, \nSr.DEN/Co of that division shall arrange for expeditious movement of machines in \nhis division. \n602 Pre-requisites for Deployment of Track Machines on Construction \nProjects/Other Agencies \n(1) Requisite track geometry standards shall be ensured before deployment of track \nmachines on construction projects: - \n(a) Track laying standards in respect of gauge, joints, expansion gaps and spacing \nof sleepers for the new track as specified in Para 316 of IRP WM should be \nfollowed.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 207, + "text": "186 \n \n(b) A minimum clean ballast cushion of 250 mm on main line and 150 mm for \nyard line along with adequate ballast on shoulders and cribs should be \nensured before deploying the tamping machines. \n(c) Proper recording of levels and versines should be done by a trained \npersonnel and lift & slews values should also be calculated in advance for \nlining/ levelling for design mode of tamping. \n(d) The track geometry prior to deployment of track machines for new works of \nnew line, doubling, gauge conversion etc. should be as under: - \nPeak value of Unevenness \n 15 mm on 3.6 m Chord \nPeak value of Twist 15 mm on 3.6 m Chord \nPeak value of Alignment 15 mm on 7.2 m Chord \n(e) The above track geometry standards are not safety/slow down tolerances \nbut are only a prerequisite for deployment of track tamping machines for \nbetter machine productivity and their optimum utilization. \n(f) For achieving the track geometry parameters as above, suitable small track \nmachines such as off -track tampers etc. may be used. Recording of achieved \ntrack parameters should be done using motorized trolleys. \n(2) The track should be certified fit for a speed of 30 kmph before deploying tamping \nmachine. \n(3) On receipt of request from Dy. CE/(C), Sr.DEN will direct joint inspection of track to \nbe done by AEN(C) and AEN/XEN/TM. \n(4) Based on the joint inspection, Dy. CE (C) shall certify the track geometry as \nmentioned above, before deploying the track machines, after attending to \ndeficiencies, if any. Sectional Sr.DEN/DEN shall confirm suitability of track for \ndeployment of machine(s) by field verification or other wise before machine is \ndeployed. \n(5) Two rounds of tamping along with consolidation by DTS should be carrie d out at \nconstruction projects prior to opening of section. \n(6) After opening of section for traffic, another round of t amping along with \nconsolidation by DTS may be done on need basis. \n603 Inter- Railways Deployment \n(1) All Inter- Railway transfer of machines will be done with the approval of Railway \nBoard only. \n(2) When machines are deployed to work in other Railways for short duration (up to a \nperiod of 2-3 months), the \"Owning Railway\" shall send the machine with necessary \nstaff required for working. The zone receiving the machine shall associate its staff to \npilot the machine for movement in its jurisdiction. Oils and consumables and spares \nrequired for operation shall be supplied by the user Railway. Major repairs shall be", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 208, + "text": "187 \n \nthe responsibility of owning railway. It is thus implied that the machines to be \ndeployed on other railways should be in good condition, not needing any major \nrepairs. User r ailway shall also be responsible for optimum utilization of machines \nand feeding the progress in TMS and reporting of progres s. In case of deployment \nfor longer durations, the user railway shall take over the machine and arrange \nrequired staff for operation & maintenance. \n604 Line Blocks, Stipulated Corridors and Monitoring \n(1) Stipulated block hours (SBH) are blocks machine has to avail every month for \ndesired utilization. SBH for all machines shall be 100 hours per month except for \nTRT, TLE and PCCM. SBH for TRT and TLE will be 64 hours and that for PCCM is 36 \nhours per month. Non -availability of machines on account of planned mainten ance \noperations of POH and IOH shall be considered in arriving at the figures of SBH. \n(2) Demanded block hours (DBH) are minimum specified block hours to be demanded \ndaily so as to achieve a minimum of SBH on an average in the year. As a general rule \nDBH shall be as follows: \nAll track machines except PCCM 4 x No. of days block demanded* \nPCCM 3 x No. of days block demanded* \n• *No. of days block demanded shall be actual No. of days block is demanded excluding \nthe days lost due to rest, holiday, machine under repair /maintenance /overhauling, \nshifting, no planning etc. \n• Actual Block hours (ABH) is the actual blocks granted in hours. \n• DBH/SBH expressed in % gives the availability of track machine. \n• ABH/DBH expressed in % gives the machine utilization. \n605 Types of Blocks - As stipulated by the Railway Board, on -track machines should work \nunder traffic blocks as per the following options depending upon the track maintenance \nrequirement and traffic patterns: \n(1) Regular Traffic Blocks \n(a) On Single Line Section - Either one block of at least 4 hours or 2 blocks of 2-\n1/2 hours or in exceptional cases minimum two hours wherever 2 -1/2 hours \nare not possible. \n(b) On Double Line Section \n(i) One spell of 4 hours on \"Up\" or ‘’Dn\" line daily. \n(ii) Two 2-1/2 hours split blocks on \"Up\" or \"Dn\" line on alternate days. (5 \nhours daily on one of the lines) \n(2) Blocks on Construction Projects and Multiple Lines – On construction projects and \nmultiple lines, additional working hours/blocks should be planned. \n(3) Special Blocks – In addition to regular traffic blocks, special blocks as envisaged in \nEngineering and O perating JPOs issued by Railway Board from time to time should", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 209, + "text": "188 \n \nbe considered. \n(a) Mega Block Running into Several Days/Weeks - Major maintenance/ \nrehabilitation of assets in identified block section in a double line traffic \nsections shall be carried out for pre -decided long block running into several \ndays/weeks by blocking of one line and conversion of do uble line into single \nline with suitable modifications in signalling system to complete the entire \nwork. This shall result into expeditious completion with better quality of work. \nDetailed scheme for each section to be undertaken for the temporary \nconversion based on requirement of work and local conditions shall be \nprepared by Zonal Railways as laid down in joint circular issued by R ailway \nBoard. \n(b) Mega Block of 6 Hours Duration or More \n(i) On single line/double line section – Mega blocks of minimum duration of \n6 hours up to twice a week depending upon requirement of work shall be \nmade available. Cancellation of few passenger trains may be resorted to, \nif required. \n(ii) On multiple line section – On multiple line sections having more than two \nlines, pre-planned assured mega block of 6 hours shall be made available, \nparticularly in context of incidences of track man being run over while \nmoving to another track or otherwise during performance of duties. \n606 Minimum Duration of B locks - Minimum duration of blocks for effective working, \nineffective time and ideal stipulated output per effective hour shall be as follows: \n(1) Track machines are deployed for variety of track works and t heir proper utilization \nhas to be ensured by making available minimum duration of blocks for smooth, safe \nand effective working. Minimum duration of block is fixed based on setting \nup/winding up time, ineffective time and progress per effective hour. Minim um \nblock duration etc. for different types of machines is given in table below: \nM/c Type Minimum Block (hr.) \n(min) \nIneffective time (hr.) \n(min) \nOutput / eff. Hr. \nDUO 2.50 (150 min) 0.50 (30 min) 800 m \nCSM 2.50 (150 min) 0.50 (30 min) 1200 m \nTEX 2.50 (150 min) 0.50 (30 min) 1600 m \nUNIMAT 2.50* (150 min) 0.50 (30 min) 1 turnout \nBCM(Plain) 3.00 (180 min) 1.00 (60 min) 200 m \nBCM (P&C) 4.50 (270 min) 3.00 (180 min) # One turnout =750 m track \nSBCM 2:30 (150 min) 0.50 (30 min) 400 m \nTLE 3.00 (180 min) 0.75 (45 min) 200 m \nTRT 4.00 (240 min) 1.25 (75 min) 400 m \nRGM 2.00 (120 min) 0.75 (45 min) 10 – 12** km", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 210, + "text": "189 \n \n• *Time for turnout is for main line & turnout side and connection and disconnection time \nrequired for S&T \n• **Depending on the length on curves in the section \n• # For deep screening of P&C, ineffective time includes movement, preparatory works \nand S&T works \n• Output may vary depending upon the age of the machine and track features \n• For output less than 90% of the normal output, the reason should be analyzed and \ncorrective action taken, if any \n• MPT is used for spot attention of both plain track and Points and Crossing, hence \nrequirement will vary depending on work to be performed. \n(2) Group working can be adopted to reduce total block requirement if assured and \nlonger duration blocks are granted. \n(a) BCMs can be deployed in a group; in blocks of 4 hours and more as working \ntime of the second machine reduces. This time loss for trailing machine is \naround 30 min. In addition, output is also compromised on regular basis due \nto conservative estimate of patches left between the two machine work \nlocations. Thus, for group working of BCMs the ineffective time will have to be \nincreased by 30 min for second machine and so on for third machine. \n(b) Tamping machines can also be deployed in groups. More than one plain track \ntamper can also be combined with UNIMAT. \n607 Measures for E nsuring Block - Principal Chief Engineer (PCE) and Chief Operating \nManager (COM) of the railway shall ensure that the identified corridor blocks as above \nare incorporated in the working timetables and their availability shall be ensured. \nFollowing are the measures for ensuring availability of blocks: \n(a) Inclusion of engineering maintena nce corridor blocks in the Working Time \nTables and updating it every year duly providing alternate corridors for those \naffected by the newly introduced trains. \n(b) Resorting to TSL (Temporary Single Line) working, rescheduling/regulation \n/cancellation of trains to ensure adequate blocks for track machines. \n(c) Identifying double line sections for introduction of system of Single Line \nsignalled working for days/weeks. \n(d) Periodic Monitoring – Daily monitoring of blocks and performance at DRM’s \nlevel in divisions and CTE at HQ and weekly review at PCE, COM and GM's \nlevel at headquarters is essential to monitor the utilization of track machine \nand blocks granted. \n608 Through Tamping and Spot Attention \n(1) Types of Tamping – Tamping has been categorised in two types: - \n(a) Through Tamping – This is maintenance tamping as per pre decided \nprogramme drawn in beginning of year and covers long continuous stretches", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 211, + "text": "190 \n \nof the track from one end of the block section to the other. Frequency of \nthrough tamping depends on the tamping cycle fixed by the ra ilway based on \nfactors as enumerated below with the approval of CTE. \n(b) Spot Attention – Tamping of track of shorter stretches, say 200 m or longer, is \nsometimes necessitated due to various reasons such as bad running location, \nwork spot etc. The annual progr amme shall have provision of Spot attention \nto be done with the approval of Sr.DEN/Co. The quantum of spot attention in \nterms of approximate length in kms, should be incorporated in the \ndeployment programme issued by CE/TM. \n(2) Tamping Frequency - The requirement and periodicity of through tamping \ndepends on many factors, as mentioned below: \n(i) Traffic density (GMT) on the route, Axle Loads and maximum permissible \nSpeed of trains. \n(ii) Track geometry i.e. gradients & curvature. \n(iii) Track structures and condition of track components. \n(iv) Depth of ballast cushion, a vailability of clean cushion below sleeper and \non shoulders, and drainage characteristics. \n(v) Type of formation i.e. embankment or cutting, type of soil, and condition \nand stability of the formation. \n(vi) Climate condition such as rainfall, snowfall etc. \n(vii) Local conditions, such as adjoining built -up area, tress passing, drainage \nproblems etc. \n(viii) Mode of tamping on previous occasion i.e. smoothening mode or design \nmode. \nTamping frequency has to be fixed with the purpose to achieve track with required \ngeometrical parameters and sound condition of packing for the end result of \nhaving good riding comfort (quality). Considering the wide variations in aforesaid \nfactors on different sections, it is not feasible to fix frequency of tamping \nuniversally and each Zonal Railway would fix the frequency with the approval of \nCTE. \nAs a general guideline, the frequency of tamping would be 1 year and above. \nTamping of track having bad formation and other factors necessitating more \nfrequent tamping should be called spot attention. TMS module should have the \nprovision for feeding such spot attentions. \nFrequency of tamping may be reviewed, as and when one or more of the above \nfactors get modified.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 212, + "text": "CHAPTER 7 \nRULES FOR MOVEMENT AND BLOCK WORKING \n \n701 General \n(1) Categorization of Track Machines - For the purpose of movement and \nworking, track machines are classified in two categories \n(a) Track Machines Hauled by Locomotive - TLE, TRT, PCCM, MDU are the \nmachines generally falling in this category. Rules for movement for \nmaterial trains will apply to these categories of machines. Details of \nmovement and working are elaborated in this chapter. Other track \nmachines when attached with the train/locomotive wil l also fall in the \nsame category. \n(b) Self-propelled Track Machines - Rules for movement and working of \nself-propelled track machines are detailed in this chapter. This category \nof track machines may also work with the non -self-propelled track \nmachine as in ( a) above for effective block utilization, in the same block \nsection. \n(2) Self-propelled Track Machines - For movement, these shall be worked as a \ntrain but will not need a guard or a brake van. One camping coach or one BRN \nwagon or another self -propelled track machine, which may be un -braked, \nshall permitted to be hauled by the self -propelled track machine. SSE/JE/TM \noperating the machine shall ensure safe running. \n(3) Provision of G&SR - Provisions as contained in GR 4.65 supplemented by SR \nframed by the Zon al Railways, shall be applicable for working of track \nmachines. Presently, SRs of Zonal Railways are not uniform. Objective should \nbe to have common or unified SR for all Zonal Railways for common aspects of \ntrack machines working. Specific provisions in r espective SRs shall deal with \nspecial circumstances prevailing in individual Zonal Railways. \n(4) Knowledge of G&SR - Track machine staff shall be conversant with the \nrelevant provisions of G&SR. Adequate knowledge of provisions of G&SR shall \nbe imparted durin g the initial and refresher training courses conducted in \nZRTIs. The list of standard forms is given in Annexure7.1. \n(5) Manning of Track Machines and Possession of Safety Equipment - All track \nmachines shall be manned by a competent railway servant authorize d to work \nthe machine. These machines shall also be equipped with prescribed set of \nsafety equipment to ensure safe movement and working. \n(6) Salient Information of Track Machine - Following information shall be painted \non the track machine at pre-decided locations: \n(a) Designation of Controlling Officer (Dy.CE/TM/Line). \n(b) Name of owning Railway. \n \n \n191", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 213, + "text": "(c) Track Machine No. with model. \n(d) Transportation Code. \n(e) Month and Year of commissioning. \n(f) Date of last POH and last IOH done. \n(g) Maximum permissible speed when self -propelled, coupled with other \ntrack machine and when attached with train formation as per speed \ncertificate of RDSO sanctioned by Railway Board. \n(h) Maximum height and width of track machine in closed condition. \n(i) Axle load, wheel base and overall length of machine. \n(j) Jacking point i.e. lift here. \n702 Operation and Working of Track Machine \n(1) Responsibility of Track Machines - For the purpose of operation, each \nmachine shall be under the direct charge of SSE/JE/TM. He shall be in -charge \nof the track machine and shall be responsible for safe movement and working \nof track machine. All SSE/JE/TM posted on the machine shall have the \nknowledge of movement and working of track machines and shall possess \nvalid competency certificates. Total number of persons including railway staff, \nallowed in the driving cab of each machine, shall not normally exceed five. \n(2) Supervision of Work of Track Machine(s) - The track machine(s) shall work \nunder the direct supervision of an engineering official, not below the rank of \nSSE/JE (P.Way), who will be responsible for taking the traffic block, \ncoordinating for shunting in the yard, entry of machine(s) into the block \nsection, protection of the line while the work is in progress and timely \nclearance of block and track machines f rom the section to the station, after \nthe completion of the work, ensuring the safety of the track(s). He shall also \nbe responsible for coordination with divisional officials for clearance of \nsection in event of breakdown of machine. SSE/JE (P.Way) shall a lso associate \nhimself and co -ordinate with station master for shunting of the track \nmachine(s). \n(3) Working - General \n(a) The machine staff and P. Way staff shall work as a team towards the \ncommon goal of ensuring optimum utilization of the machine and \nmanpower. \n(b) The machine staff shall ensure adequate attention to the machine in \ntime as prescribed in RDSO and manufacturer's manuals in respect of \ntheir machines and keep the machines ready for availing stipulated \nblocks. They should, in consultation with the P. wa y staff/Engineering \nController/Track Machine Control, be aware of corridor block/MOU \nprovisions and line block spell and plan out their maintenance activities \nin such a manner that blocks are availed without any lapse. The machine \n \n192", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 214, + "text": "in-charge shall invariably inform SSE/JE (P.Way) and if not available, to \nSM or Engineering Control about readiness or otherwise of the machine \nfor working every day well in time. \n(c) The machine shall be berthed in the sidings safely as stipulated in the \nG&SR and the P.Way staff shall arrange for watchman for the machine \nduring the non-working shift. The watchman for the machine should not \nbe frequently changed. \n(d) The machine in -charge on arrival shall check up the condition of the \nmachine and report any unusu al features observed by him such as \ndisturbance to the machine at the berthing place, missing of parts etc. \nand initiate appropriate action as per extant rules. \n(e) The machine in -charge and SSE/JE (P.Way) shall jointly inspect and \nfinalize the week's work in advance and discuss the day's programme \nand share with each other all information required for the working. \n(f) SSE/JE (P.Way) shall ensure availability of requisite men and tools & \nplant to work with the machine and for rendering possible assistance to \nclear the section in case of breakdowns. \n(g) SSE/JE (P. Way) shall be responsible for arranging necessary lighting etc. \nfor night works and also coordinate with other divisional staff such as \nSignal/OHE etc. \n(h) It should be ensured by the machine in-charge that no person climbs to \nthe top of any machine without OHE block in electrified sections. \n(i) The machine in -charge shall ensure that all precautionary measures are \ntaken for safety of the staff while working on double/multiple line block \nsection against the danger of trains moving on adjacent lines. SSE/JE (P. \nWay) should provide lookout-men at the site of machine working as per \nrequirements, including protection as per IRPWM and GR 6.03. \n(j) SE/JE (P Way), after completion of work shall inspect the worksite \nattended by track machine thoroughly and ensure track fitness for \nrunning of trains with or without speed restriction, as appropriate. He \nshall ensure that no infringement, obstructions have been caused to \nsafe train running during working of track machine. \n(k) SM wil l liaison with Section Controller/Controller to ensure that at the \nend of work, the machine is brought to the base station and placed in \nthe nominated berthing line at the earliest to enable post block \nmaintenance of the machine being undertaken. SSE/JE (P.Way) shall also \nprovide necessary assistance as required. \n(l) Due to non -availability of path etc., it may not be possible to bring the \nmachine back to the siding where camping coach of machine is stabled, \nin some of the busy sections. In such eventuality, Sr. DEN/DEN/AEN shall \nhave the powers and provision to hire the road vehicle to bring the staff \n \n193", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 215, + "text": "back to machine stabling station. \n703 Competencies of Track Machine Staff - SSE/JE/TM shall be competent to \nwork the machine and he should pos sess adequate knowledge, which would be \nimparted during initial and refresher courses. Competent authority shall duly certify \nhim for his competence. Each SSE/JE/TM shall have a diary as per proforma given in \nAnnexure 7.2 of this manual and the details of these competencies/fitness shall be \nrecorded therein by SSE/TM/DI or SSE/TM/SDI, as per the system on Railway; in \naddition to other relevant information. Road learning will be recorded by LI or \nnominated supervisor. \n(1) Medical Fitness and PME - SSE/JE/TM shall be fit in A -3 medical category. If \nwearing spectacles, he shall carry one extra pair while on duty. Technicians \nand helpers working on track Machines shall be fit in A-3 medical category. \nThis shall be recorded in certificate of medical fitness at the time of joining \nand certificate of periodical medical examination (PME) during the course of \nservice. The employee will inform his immediate superior 60 days in advance \nof expiry of his medical certificate. Employee will be expeditiously booked for \nPME. \n(2) Technical Training - All SSE/JE/TMs are to undergo initial as well as refresher \ntechnical training imparted by IRTMTC, Allahabad; successfully. Refresher \ntechnical training shall be done every 3 years. Certificate of satisfactory \ncompletion of training sho uld be kept in the personal custody of the official \nand produced when required. \n(3) G & SR Training - All SSE/JE/TMs are to undergo initial as well as refresher \ntraining in G&SR; successfully. Refresher G & SR training shall be done every 3 \nyears. Certificate of satisfactory completion of training should be kept in the \npersonal custody of the official and produced when required. \n(4) Route/Road Learning - It will be the responsibility of the SSE/JE/TM working \nthe machine to acquaint himself with the system of working, location of \nsignals and other local conditions affecting running of trains on a section(s) of \nthe railway over which he is to work and if he is not so acquainted with any \nportion of the railway over which he is to work, obtain the services of \nqualified railway servant who is conversant with it to assist him by requesting \nthe office of Dy.CE/TM Line. \nSSE/JE/TM will make trips in the cab of locomotive of a train for initial road \nlearning for acquainting with the section as well as subsequent, if required, for \nreacquainting with the section as stipulated in G&SR of the railway. Entry to \nthis effect shall be made in the diary by the employee and countersigned by LI \nor SSE/TM/SDI of concerned satellite depot. For this purpose, posting of at \nleast one LI in each division, depending on the number of machines i.e. \nnumber of SSE/JE/TM, shall be ensured. \n(5) Competency Certificate - SSE/JE/TM shall be considered competent to \noperate the machine only if he possesses valid machine competency \n \n194", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 216, + "text": "certificate. Machine competency certificate is to be issued to SSE/JE/TM by \nDy.CE/TM Line or an officer authorized by him. This certificate will be issued \nas per proforma given in Annexure 7.3 after ascertaining the successful \ncompletion of technical training, G & SR training and his medical fitness. The \nvalidity of this certificate will be up to the earliest expiry date of the three i.e. \n(i) Technical training (ii) G & SR training and (iii) PME. \nFor automatic block section, separate competency is required to be issued as \nper the practice in the Zonal Railway. \n704 Safety Equipment \n(1) General - SSE/JE/TM in -charge shall be responsible to ensure that the \nfollowing equipment in working condition are available on the track machine: \n(a) Two red and one green hand signal flags. \n(b) Two tri-colour hand signal lamps /LED torch. \n(c) Two chains with padlocks. \n(d) One fire extinguisher in each cabin. \n(e) Two hooters (manually controlled). \n(f) Two jacks10 t. \n(g) Four wooden blocks. \n(h) Four crow bars. \n(i) One hydraulic hand pump. \n(j) Emergency pneumatic/hydraulic hose off sizes suiting to different \nmachines (Complete with end fitting). \n(k) Wire rope with close loops at both ends 2 m and 9 m long for BCM: One \nof each length. \n(l) Machine specific equipment, if any, listed in Chapter 2, 3, 4 and 5. \n(m) Ten fog signals (detonators) in a tin case. \n(n) A copy of the working timetable of the section where the machine is \nworking. \n(o) G & SR book with up to date amendment slips. \n(p) One 4 cell flasher light LED lamp cum flasher light (rechargeable). \n(q) Two banner flags. \n(r) One first aid box. \n(s) Two skids. \n(t) Safety helmets for all machine staff. \n(u) Protective clothing, safety shoes and safety gloves. \n(v) Walkie talkie with frequency of SM, Guard and Loco Pilots. \n \n \n195", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 217, + "text": "(w) Internal communication system like walkie-talkie and/or head mounted \nsystem. \n(x) Track Machine Manual with up to date correction slips. \n(y) Accident Manual. \n(z) Tail lamp. \n(2) Head and Tail Lights – Each track machine must be equipped with prescribed \nhead and tail lights, marker lights and flasher lights as per GR 4.14, 4.15 & \n4.16 and SRs thereof. Each machine shall display LV board/tail lamp when \nmoving alone. While moving in conveyor coupled, the LV board/tail lamp \nshall be fixed on the last vehicle; in the direction of movement. \n705 Rules for Operation – General \n(1) Stabling of Track Machines - When the track machine(s) is/are stabled at a \nstation, SSE/JE/TM in -charge shall ensure that it is clear of fouling marks and \ntraps and necessary precautions against rolling down such as pinning down \nhand brakes, chaining and provisio n of skids; is taken in accordance with \nG&SR. \n(2) Shunting of Track Machines - No track machine shall be moved between a \nrunning line and the siding/stabling line without the written permission of the \nStation Master on duty in the form of shunting order/shunt signals. \n(3) Machine Ready Memo - SSE/JE/TM shall issue a written machine ready memo \n(as per Annexure 7.4) after necessary maintenance/repairs/schedules and \nBrake Power testing and other stipulated checks, if any, to on duty SM, \nindicating time and date, und er advice to SSE/JE/P.Way deputed to work with \nthe machine. \n(4) Movement of Track Machines - When the track machine is required to move \nfrom one station to another station, SSE/JE/TM shall run the machine only \nwith proper authority to proceed and all necessary permits, notices and \ncautions as specified in G&SR. When track machine is to move on wrong road \n(against the direction of traffic), the speed of track machine shall not exceed \nmore than 25 kmph and flasher light shall be kept “ON”. \n(5) Working in Group \n(a) When more than one machine is required to work within the same block \nsection, these machines may be allowed to move into the block section \nin a group under one authority as detailed in this chapter. In such \nsituation all the track machines must leave and enter the section \nsimultaneously one after another keeping adequate distance among \nthem and with proper authority as detailed further in the following \nparas. \n(b) Total number of the machines shall be clearly mentioned in the line \nclear/block authority message with exchange of private numbers. For \n \n \n196", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 218, + "text": "this purpose, two coupled self -propelled track machines are to be \ntreated as single machine. Track machine with one BFR, like UTV, shall \nalso be treated as a single machine. \n(c) In case of group machines, entering into the block section for working, \nand back and entering the station after working, the first machine shall \npass the dispatch/reception/last stop signal, as the case may be, in OFF \nposition (where signal is given) and all other machines shall be piloted \nby competent railway servant following first machine with signal in ON \nposition. In case where the machines are allowed on paper authority \ninstead of signals, SSE/JE/P.Way or SSE/JE/TM in the first machine will \nreceive the authority and o ther machines will follow duly piloted by \ncompetent railway servant. \n(d) Normally machines shall not work in a group while visibility of track is \nrestricted due to sharp curves and steep gradients. Where the working \nof track machines in group is indispensable i.e. like deep screening, track \nrelaying site etc., the necessary block protection shall be done as per \npara 806 of IRPWM and special precaution shall be taken as per para \n811 of IRPWM for the first machine facing the direction of traffic in \ndouble line s ection and for the front and rear most machines in single \nline section. \n(6) Run through movement in Group - Run through movement of the track \nmachines in-group is not allowed. They can however transit as coupled vehicle \nunder one authority. However, the machi nes can move in group by taking a \nshort duration block and rules as for group movement for block shall be \nfollowed. \n(7) Working of Track Machine in Block \n(a) The track machine(s) shall work under line block only. The SSE/JE (P. \nWay) shall give the requisition for block in duplicate to Station Master \non duty, as per proforma in Annexure 7.5, indicating therein specific \nlocation where the machine(s) will work, th e road i.e. UP/DN etc., the \nnumber of track machine(s) that will work along with individual \nnumber(s) and sequence (order in which machines will leave the \nstation), the duration of block required and whether the machine(s) will \nproceed to the next station or return back to the starting station after \nthe work. The SM shall then contact the control and ascertain the \nmovement of trains before granting line block. \n(b) After the block is granted, the Station Master will return the original \ncopy of requisition endorsing the duration and other special instructions \nlike work and proceed, work and return via right or wrong direction, \ncaution order, if any SSE/JE (P. Way) shall accompany the machine(s) to \nthe work site. \n(c) SSE/JE (P.Way), shall get the requisition so returned by station master \n \n197", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 219, + "text": "(also called as track machine permit), signed from the SSE/JE/TM in-\ncharges of track machines. \n(d) On reaching the station as mentioned in track machine permit, after the \ncompletion of work, SSE/JE (P.Way) will hand over the token, track \nmachine permit and the key etc. if any, after all the machine have \ncleared the block section. He will also certify that the track is fit for train \nmovement. Then only the Station Master will clear the line for normal \ntrain operation subject to the observations of speed restriction, if any. \n(8) Working in Automatic Block Sections – Automatic signalling territory involves \nspecial features in working and the special instructions for working of track \nmachine are elaborated in Annexure 7.6 \n(9) Working in Integrated Traffic Blocks - If the track machines are working in an \nintegrated traffic block where other machines and staff engaged by other \ndepartments are also working, the relevant instructions issued by Zonal \nRailway for integrated block working should be followed. \n(10) Use of Cell Phone on Track Machine - All supervisory staff in the track \nmachine and as well as at the track machine site is prohibited from use of \nmobile phones during movement and working of track machine, except in \nemergencies or when it is extremely necessary. \n(11) Requirement of Pilot - If the SSE/JE/TM is not acquainted with the section, \nwhere the track machine has to work, a Pilot (Loco Pilot/ALP) shall be \nprovided for movement as well as block working as per the specific reques t in \nadvance. SSE/JE (P.Way) may also work as pilot in his jurisdiction, in case of \nemergent situations. \n(12) SSE/JE(P.way) as Guard - In emergent and special situations, SSE/JE/P.Way \nshall work as the guard. SSE/JE/P.Way shall perform the limited functions of a \nguard required for working and movement of UTV, which has only one SSE/JE; \nas it has one BFR and direct visibility of points from the driving cabin may not \nbe there in one direction. \n706 Working Of Track Machines In Single and Double Line Sections \n(1) Single Line Section – Work and Proceed \n(a) Station Master will obtain line clear from station in advance, take off \nlast stop signal, issue track machine permit and handover the token, if \nany, to SSE/JE (P.Way), SSE/JE (P.Way) shall travel in the last track \nmachine. \n(b) On completion of the work, the machine(s) will be received by taking off \nreception signals. Competent railway servant should display green hand \nsignal at the foot of first stop signal till the last machine enters the \nstation. \n(c) Station Master will clear th e line for normal train operation only after \nSSE/JE (P.Way) has returned the track machine permit etc. and certified \n \n198", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 220, + "text": "the track fit for train movement. \n(2) Single Line Section – Work and Return \n(a) With token / tablet instruments \n(i) Station Master will obtain line clear from station in advance; take \noff last stop signal, issue track machine permit along with \ntoken/tablet to SSE/JE (P.Way). SSE/JE (P. Way) shall travel in the \nfirst track machine. \n(ii) On completion of the work, the machine(s) will be rec eived by \ntaking off reception signals. Competent railway servant shall \ndisplay green flag/signals at the foot of first stop signal till the last \nmachine enters the station. \n(iii) Station Master will clear the line for normal train operation only \nafter SSE/JE (P .Way) has returned the track machine permit etc. \nand certified the track fit for train movement. \n(b) With token less Block Instrument \n(i) Station Master will block back the section, take out the shunting \nkey, issue track machine permit, and shunting key to SSE/JE \n(P.Way) In addition requisite written authority will be issued for \npassing the last stop signal at danger for all machines SSE/JE \n(P.Way) shall travel in the first track machine. \n(ii) On completion of the work, the machine(s) will be received by \ntaking off reception signals. Competent railway servant shall \ndisplay green hand signals at the foot of first stop signal till the last \nmachine enters the station. \n(iii) Station Master will clear the line for normal train operation only \nafter SSE/JE (P.Way) has returned the track machine permit etc. \nand certified the track fit for train movement. \n(3) Double Line Section – Work and Proceed \n(a) Via Right Direction \n(i) Station Master will obtain line clear from station in advance, take \noff last stop signal, issue track machine permit SSE/JE (P.Way) shall \ntravel on the last track machine. \n(ii) On completion of the work, the machines will be received by \ntaking off reception signals; competent railway servant shall \ndisplay green flag/signals at the foot of first stop signal till the last \nmachine enters the station. \n(iii) Station Master will clear the line for normal train operation only \nafter SSE/JE (P.Way) has returned the track machine permit etc. \nand certified the track fit for train movement. \n \n \n \n199", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 221, + "text": "(b) Via WrongStationDirection \n \n(i) Master will take the line clear from station in rear on block \ntelephone, prepare paper line clear ticket, issue track machine \npermit, to SSE/JE (P.Way), SSE/JE (P. Way) shall travel on the last \nmachine. \n(ii) The machine(s) shall be piloted out of th e station on a written \nauthority issued by the Station Master after all the facing points \nhave been correctly set and locked and trailing points correctly set \nover which the machine(s) will pass. \n(iii) On approaching the next station after completion of the wor k, \nSSE/JE/TM shall bring their machines to stop opposite the first \nstop signal pertaining to the right line or at the last stop signal \npertaining to the wrong line (on which they are running) \nwhichever they come across first and wait and proceed as piloted \nor follow GR 4.44. \n(iv) The Station Master at the other end of the block section shall \ndepute a railway staff in uniform at the foot of the signal \n(whichever the machines would encounter first) who shall stop \nthe machines on danger hand signal and thereafter pilot them into \nthe station on a written authority issued by the Station Master. \n(v) If the operators find that no railway servant in uniform has been \ndeputed at the foot of the signal to pilot the machine(s) into the \nstation, GR 4.44 shall be observed. \n(vi) All the crossover points in the facing direction, over which the \nmachines shall proceed, shall be clamped and pad locked. This fact \nwill be mentioned in the authority in prescribed form issued by \nstation master, through the competent railway servant. \n(vii) Station Master will clear the line for normal train operation only \nafter SSE/JE (P.Way) has returned the paper line clear ticket, track \nmachine permit etc. and certified the track fit for train movement. \n(4) Double Line Section - Work and Return \n(a) Via Right Direction \n(i) Station Master will block forward the section and arrange to put \nthe needle of the block instrument directly to \"Train on Line\", take \nout the shunting key in case of 'Daido' Double Line Block \nInstrument, issue track machine permit along with the shunting \nkey, if any, to SSE/JE (P.Way). In addition, requisite written \nauthority will be issued for passing the last stop signal at danger. \nSSE/JE (P. Way) shall travel in the first track machine. \n(ii) On completion of the work, SSE/JE/TM shall bring their machine to \nstop opposite first stop signal pertaining to the right line or at the \n \n200", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 222, + "text": "last stop signal pertaining to the wrong line, whichever they comes \nacross first. \n(iii) Station Master shall depute a railway servant in uniform at the \nfoot of the signal (whichever the machine would encounter first) \nwho shall stop the machine(s) on danger signals and thereafter \npilot them into the station on a written authority issued by the \nStation Master. \n(iv) If SSE/JE/TM find that no railway servant has been deputed to \npilot the machine(s), GR 4.44 shall be observed. \n(v) All the crossover points in the facing direction over which the \nmachines shall proceed, shall be clamped and pad locked. \n(vi) Station Master will clear the line for normal train operation only \nafter SSE/JE/P.Way has returned the track machine permit etc. \nand certified the track fit for train movement. \n(b) Via Wrong Direction \n(i) Station Master will block back the section as per extant \ninstructions, put the needle of the block instrument directly to \n\"Train on Line\" take out the shunting key in case of 'Daido' Double \nLine Block Instrument issue track machine permit special caution \norder indicating the number of track machine(s), station where \nthey will return etc. which will be signed by the operators and \nthen will be hand ed over along with the shunting key, if any to \nSSE/JE (P.Way). SSE/JE (P.Way) shall travel in the first track \nmachine. \n(ii) The machines shall be piloted out of the station on a written \nauthority issued by the Station Master after all the facing points \nhave been correctly set and locked and trailing points correctly set \nover which the machines will pass. \n(iii) On completion of the work the machines will be received by \nlowering reception signals. Competent railway servant shall \ndisplay green flag/hand signal at the f oot of first stop signal till the \nlast machine enters the station. \n(iv) Station Master will clear the line for normal train operation only \nafter SSE/JE (P.Way) has returned the track machine permit etc. \nand certified the track fit for train movement. \n707 Important Instructions and Precautions \n(1) Protection of Work Site - SSE/JE (P.Way) shall be responsible for protection of \nthe site of work and also protection of adjoining track(s) in case of \ninfringement. He shall be conversant with the infringing condition s of the \nvarious machines. He shall also be responsible for safe condition of track \nbefore clearing the block after machine working. \n \n201", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 223, + "text": "(2) Fouling of Adjacent Lines - Some machines like BRM, PCCM etc. tend to foul \nthe adjacent line, while workin g on double line section or in yard. If any part \nof a machine is likely to foul the adjacent line(s) while working, SSE/JE (P.Way) \nshall request Station Master in writing to block such line(s) likely to infringe. \nSuch work shall only be undertaken if block ing of such adjoining line(s) has \nbeen permitted by the control and the Station Master and such adjoining lines \nhave been protected. Efforts shall be made to ensure the blocking of other \nlines for minimum duration. \n(3) Information to Level Crossings - While exchanging private numbers with level \ncrossings, the Station Master on either side shall inform all the level crossings \nequipped with telephones falling in the block section. \n(4) Safe Distance and Speed of Machine in Group - The minimum distance \nbetween the machines when working in a group shall be 50 m to avoid \ncollision between machines and danger to life of machine and P.Way staff \nworking with machine. While the track machines are moving in the block \nsection in group, it will be the responsibility of SSE/J E/TM of these machines \nto maintain a minimum safe distance of 200 m from each other. The speed of \nmovement of track machines shall be the lowest of the permissible speed \namong all track machines. The leading track machine shall observe this speed. \nIf any o f the machines is required to slowdown or stop due to some reason, \nSSE/JE/TM driving the machine should ensure that red hand signal is displayed \nby waving vigorously. Where visibility is poor such as on curves and in \ncuttings, appropriate speeds and safe d istance should be maintained to \nensure safety. While approaching the level crossings, SSE/JE/TM driving the \ntrack machines shall keep a vigil for any obstruction and whistle freely till the \nmachine passes the level crossing. \n(5) Setting of Points of Stabling Siding - The concerned points of non -signalled \nsidings shall be set against the line on which the track machine is stabled and \nsuch points shall be secured with clamps or cotter bolts and pad locks as \nstipulated in G&SR. The k eys of such padlocks shall be kept in the personal \ncustody of Station Master until the machine is ready to leave from siding or \nrunning line. SSE/JE/TM in -charge shall not relinquish charge until he has \nsatisfied himself that the machine has been properly secured and protected as \nprescribed herein. \n(6) Shunting in Line occupied by Track Machine - During shunting on a line \noccupied by track machines, station master shall ensure that no machine is \nshunted without the presence of SSE/JE/TM. \n(7) Safety of Men \n(a) Working of certain track machines creates conditions jeopardizing safety \nof man and material, if adequate precautions are not enforced at site of \nwork. BCM is likely to produce a dusty atmosphere impairing visibility in \nthe vicinity of machine and also heavy noise. TLE and TRT \n \n202", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 224, + "text": "involve large number of labour working with the machine. Hence, extra \ncare is necessary as detailed below, to ensure safety of workers. \n(b) Hooters should be provided on the track machines. These hooters \nshould be used to warn the staff working on/around the track machine \nabout approaching train on adjoining track. Remote controlled hooters \nshall also be deployed as an added precaution by SSE/JE/P.Way so that \nlookout man standing around 150 m away from the track machine can \nalso operate the hooter to warn the staff suitably. SSE/JE/TM shall also \nput on the flasher light on as an added precaution till the train on \nadjacent line has passed the site of work. \n(c) Caution order of 30 to 50 kmph with instructions to whistle freely \nshould be imposed on the adjacent line, during the duration of block, \nfor the safety of workmen, depending upon the site conditions and \nvisibility. \n(8) Checking Infringement After Work - The vertical and lateral clearance for \nOHE, signal post and any other structur e should be checked and adjusted \nbefore clearing the block. It shall be ensured by SSE/JE (P.Way) working with \ntrack machine that there should be no infringement to signal post, OHE and \nany other structure as per schedule of dimensions. \n708 Failure and Accidents of Track Machines \n(1) Protection in case of Breakdown - In the event of breakdown, the track \nmachines shall be protected as per GR 6.03 and SR there to by the machine \nstaff, as directed by machine in-charge. \n(2) Failures in Block Section - Failures in block sections of the track machines will \nbe treated as accident under class 'J – Equipment failure'. \n(3) Accidents involving Track Machine - Accidents involving track machines shall \nbe treated as train accidents under the appropriate class and action shall be \ntaken as per the rules in force. \n(4) Action in case of Failure in Block - In case of failure of track machine in block \nsection, immediate information with details should be conveyed to the \nADEN/DEN/Sr.DEN of the section and the AXEN/XEN/Dy.CE/Line/TM. \nSE/JE/TM should decide in consultation with SSE/JE (P. Way), the action to be \ntaken to clear the section. They may decide to push the disabled unit to the \nnearest station provided the brake power is in good condition. Otherwise, \nintimation shall be sent to the ne arest Station Master asking for a light engine \nto tow the unit. \n(5) Request for ART/Breakdown - In case, SSE/JE (P. Way) and/or SSE/JE/TM feels \nclearance of section is going to take long time, the assistance of Road Break -\ndown or Accident Relief Train shall b e asked for immediately. Meanwhile \nSSE/JE/TM in-charge on the machine shall take necessary action to rectify the \ndefect(s). SSE/JE (P. Way) shall provide all necessary assistance. \n \n203", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 225, + "text": "709 Permissible Speed - Each machine will run within the maximum permissible \nspeed sanctioned for that type of machine on a given section of the Railway. \n710 Speed Certification for Track Machines - Railway Board Policy Circular No. 6 \ngoverns procedure for certification of permissible speed for new rolling stock. The \nprovisions of the circular relevant to track machines are summarized below: \n(1) Speed Certification for New type of Track Machine for Regular Movement \nAny new type and model of track machine introduced on Indian Railway is \nallowed to run on Zonal Railways at a speed specified in the provisional speed \ncertificate issued by RDSO. This can be done only after the approval of Railway \nBoard processed through Chief Commissioner of Railway safety on the \napplication processed by the RDSO (Gazette notification no.945(E)). \nFinal speed certificate for the track machine is also issued by RDSO, after \nconducting detail oscillation trials. For conducting trial, on the advice of RDSO \nto test track machine, General Manager of the concerned railway shall allow \nconducting the tr ials on their system on the test section identified by RDSO, \nafter obtaining permission from CRS in case trial is to be done on passenger \nrunning lines with Joint Safety Certificate duly signed by the Principal Chief \nEngineer, Principal Chief Mechanical En gineer, Principal Chief Operating \nManager and Principal Chief Signal & Telecommunication Engineer (Principal \nChief Electrical Engineer also in case of locomotive or involvement of \nelectrified section). \nGM sanction for such trials shall be valid for two ye ars, after which it shall \nrequire revalidation by the General Manager on the advice of RDSO. With \nregard to a stock already operating on provisional speed certificate, while \nrevalidating the permission for oscillation trial, any adverse performance or \nspecial observations made during service, if any, shall be commented upon. \nSanction of Railway Board for final maximum permissible speed through Chief \nCommissioner of Railway safety (CCRS) is also required to be obtained in a \nsimilar manner as above. The procedure to be followed is detailed below: \n(a) Determination of Provisional Maximum Permissible Speed/ Final \nMaximum Permissible Speed by RDSO \n(i) Provisional maximum permissible speed \n The provisional maximum permissible speed for new type of \ntrack machine shall be determined on the basis of design \nfeatures and other details supplied by the OEM. Guidance \ncan also be taken from the permissible speed of similar type \nof machine already in service.\n The provisional speed will normally be lower than the design \nor proje cted maximum permissible speed but shall not be \nmore than 65 kmph. However, for track machines, whose \nsuspension and other relevant characteristics such as axle\n \n204", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 226, + "text": "load, track loading density etc. are similar to stock already in \nservice, maximum permissible speed may be increased to 75 \nkmph by Executive Director Standards (Motive Power)/RDSO \nin consultation with Executive Director Standards (Track) \nand Executive Director (Bridges & Structure) and other \nconcerned Directorates. \n The provisional speed certificate will be valid for five years \nexcept when it is superseded by final maximum permissible \nspeed certificate issued following the procedures described \nbelow:\n(ii) Final maximum permissible speed \n The final maximum permissible speed shall be determined \non the basis of detailed oscillation trials for assessing the \nriding quality and/or stability. However, for such stock \nwhose suspension and other relevant characteristics such as \naxle load, track loading density etc. are not basically \ndifferent from those of the existing ones, the detailed \noscillation trial may be dispensed by Executive Director \nStandards (Motive Power)/RDSO in consultation with \nExecutive Director Standards (Track) and Executive Director \n(Bridges & Structure) and other concerned Directorates. In \ncase of difference of opinion, the matter shall be referred to \nthe Railway Board for final order.\n For conducting oscillation trials, a separate provisional speed \ncertificate for oscillation trials, shall be issued by RDSO \nspecifying the section where trial is to be conducted.\n General Manager of the concerned railway shall allow \nconducting the trials on their system on the test section \nidentified by RDSO, after obtaining permission from CRS in \ncase trial is to be done on passenger running lines with Joint \nSafety Certificate duly signed by the Principal Chief Engineer, \nPrincipal Chief Mechanical Engineer, Principal Chief \nOperating Manager and Principal Chief Signal & \nTelecommunication Engineer (Principal Chief Electrical \nEngineer also in cas e of locomotive or involvement of \nelectrified section).\n Oscillation trial is conducted under the supervision of by \nRDSO.\n Final maximum permissible speed certificate shall be issued \nby RDSO based on the results of detail oscillation trial \nconducted.\n \n \n205", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 227, + "text": "(b) Application for Sanction by RDSO for introduction of Machine \n1) The RDSO shall apply, for introduction of machine different from \nthose already running on any section or division of zonal railway \nfor use by any zonal railway to the Railway Board through the \nChief Commissioner of Railway safety (CCRS). \nAny increase in sanctioned maximum speed of machine shall be \ntreated as introduction of new types of locomotives or rolling \nstock. \n2) The application shall be accompanied by- \na) such diagrams as may be necessary to give full particulars of \nthe axle loads, wheel spacing, length over buffers and other \nprincipal dimensions of the machine for which sanction is \nrequired. \nb) provisional speed certificate or final speed certificate, as the \ncase may be, issued by the RDSO. \n3) The application shall be scrutinized by the Commissioner and his \nrecommendations thereon shall be submitted to the Railway \nBoard for its orders. \n4) A machine have different principal dimension or a different bogie \ndesign or new designs of braking system or suspension details like \naxle load, track loading density, unsprung mass being different \nshall be regarded as new machine. \nProvided that any minor change of equipment design or change of \ninternal equipment layout on the machine or minor change of axle \nload or minor change of track loading density or minor change in \nunsprung mass shall not be regarded as new machine, unless such \nchanges are likely to significantly affect weight distribution, centre \nof gravity or riding behaviour of the machine. \n5) In case of any difference of opinion in the RDSO, whether or not \nany change or modification is to be regarded as a new rolling \nstock, the RDSO shall, through the Commissioner, refer the matter \nto the Railway Board for final decision thereon. \n(c) Railway Board’s Sanction for introduction of Machine – Railway Board \ngrants sanction for provisional introduction of machine at \nProvisional/Final speed on the basis of recommendation of Chief \nCommissioner of Railway Safety. \n(2) Use of Machine by Zonal Railways \n(1) The General Manager of Zonal Railway may sanction the use of machine \nalready introduced on Indian Railway by the Railway Board on any section \nor division of railway under his control. \n \n \n206", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 228, + "text": "(2) The proposal for sanction of the General Manager of a Zonal Railway \naccompanied by- \n(i) Such diagrams as may be necessary to give full particulars of the \naxle loads, wheel spacing, length over buffers and other principal \ndimensions of the rolling stock for which sanction is required. \n(ii) the provisional speed certificate or final speed certificate, as the \ncase may be, issued by the RDSO. \n(iii) the sanction of the Railway Board for introduction of the machine \nor increase in sanctioned maximum speed of machine. \n(iv) the calculations and stress sheets showing- \na) the conclusions arrived at. \nb) the external forces on which the stress calculations are based. \nc) the stresses which will be produced in the various bridges over \nwhich the proposed rolling stock will run. \nd) the effects which the said rolling stock will have on various \nstructures or tracks as compared with those caused by the \nmachine already in use, or allowed by the existing orders. \nProvided that the calculations and stress sheets under this \nclause must show as to what allowance has been made for any \nsecondary or deformation stresses in a ddition to the primary \nstresses caused by external forces and what relief of stress, if \nany, has been included. \n(v) the cost of modification to signalling and telecommunication \ninstallations necessitated by the use, if any, of chopper or thyristor \ncontrol systems. \n(vi) an approximate estimate of the cost of such improvements in \nexisting structures or track as the use of the proposed rolling stock \nis likely to render necessary on the concerned railway, whether \nimmediately or in the near future. \n(vii) a certificate si gned by the Chief Engineer, the Chief Mechanical \nEngineer and the Chief Electrical Engineer (for electric stock) of the \nconcerned railway in the following proforma, namely- \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n207", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 229, + "text": "CERTIFICATE \nCertified that it is safe to run------------ (particulars of locomotive or \nrolling stock proposed to run)not exceeding-------------- units(in the case \nof locomotive) coupled together on the section --------- (station) to --------- \n-(station) from -------------(km) to ------------------ (km) of the ---------------- \nRailway at a maximum speed of ------------ (km/h) against a maximum \nspeed of ------------- (km/h) certified by Research Design and Standards \nOrganization, subject to the following speed restrictions and \nconditions;- \n(a) Speed restrictions: - \nSl. From Km to Nature of Brief Reason for \nNo. Km speed restriction \n restriction \n \n \n \n \n(b) Special Conditions- \n1)…………………………………………………………………………………………… \n2) …………………………………………………………………………………………… \n3) …………………………………………………………………………………………… \n4) …………………………………………………………………………………………… \n_____________________________________________________________ \nTo be signed by- \n1. The Chief Mechanical Engineer………. 2. The Chief Engineer………. \n3. The Chief Electrical Engineer………. 4. The Chief Operation Manager………. \n5. The Chief Signalling and Telecommunications Engineer………. \n_________________________________________________________________ \n(3) The certificate referred to shall indicate- \n(a) Clearly that the speed certified does not exceed the limits laid down by \nthe Research Designs and Standard Organization; and \n(4) The General Manager of the zonal railway shall communicate the sanction \nto the Commissioner for his information ten days in advance of the actual \nuse of machine over the railway. \n(3) One Time Movement of New Machine \na) The maximum permissible speed for the limited purpose of movement of \nmachine from the manufacturer’s works/docks to destination or to the \n \n \n208", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 230, + "text": "testing point or from the destination/testing point back to manufacturer’s \nworks shall be determined and certified by Executive Director Standards \n(Motive Power) in consultation with Executive Director Standards (Track) \nand Executive Director(Bridges & Structures) and other concerned \nDirectorates. The speed for thi s purpose shall not be higher than the \nprovisional speed determined by RDSO. \nb) The maximum permissible speed prescribed by the RDSO shall be subject \nto approval by the Principal Chief Engineer and Principal Chief Mechanical \nEngineer (Principal Chief Electrical Engineer also in case of locomotive or \ninvolvement of electrified section) of the concerned Zonal Railways in the \nform of JSC, who shall ensure that the track, bridges and OHE in the \nsections concerned are suitable for the new stock at the speed permitted. \nHowever, if a new machine infringes the Indian Railway Schedule of \nDimensions or axle loads are more than that permitted on the section; JSC \nduly signed by Principal Chief Engineer, Principal Chief Signal & Telecom \nEngineer and Principal Chief Mechanical Engineer (Principal Chief Electrical \nEngineer also in case of locomotive or involvement of electrified section) \nof the concerned Zonal Railways, should deal these issues and prior \napproval of GM shall be taken. \nc) In such cases, Commissioner of Ra ilway Safety shall be kept informed for \nthe movement, but, no formal approval of the Commissioner of Railway \nSafety is essential. However, in case it becomes necessary to move the \nvehicle attached to a passenger carrying train, sanction of the \nCommissioner of Railway Safety shall be taken. \nd) For each single movement of any machine not covered above, joint safety \ncertificate shall be signed by Principal Chief Engineer, Principal Chief \nMechanical Engineer, Principal Chief Operating Manager and Principal \nChief Signal & Telecommunication Engineer (Principal Chief Electrical \nEngineer also in case of locomotive or involvement of electrified section) \nand submitted to CRS for his permission. CRS while permitting such \nmovement may impose any special stipulations as de emed necessary for \nsuch movement. \n711 Infringements - The Railway Board is the final safety controlling authority for the \nIndian Railways and it is the final authority for regulating and sanctioning speeds of \nall rolling stocks under the Indian Railways Act. For permitting any vehicle on Indian \nRailways, if any of the dimensions of machines is infringing the Indian Railway \nSchedule of Dimension, it shall have to be first condoned by Railway Board. The \napplication for such condonation shall be initiated by RDSO through Chief \nCommissioner of Railway Safety. \nDetails of such condonations for older machines condoned under Schedule of \nDimension– 1939 and new machines infringing Schedule of Dimensions –2004 are \ngiven in Annexure -7.7, machine-wise \n \n \n209", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 231, + "text": "712 Special Precautions while working in Special Circumstances \n(1) Working of Machines in Ghat Section - The following precautions are \nessential for safe driving of the machine in sections involving steep gradients, \nsharp curves, deep cuttings high embankments etc. \n(a) Ghat Section – means “ A part of block section between any station of \nIndian Railway route which consists of 70 % in length or more that \ngoes through hilly areas with significant continuous gradients i.e. 1 in \n100 or steeper shall be called as Ghat section”. \n(b) SSE/JE/TM shall have Block Competency Certificate for ghat section \nworking or a pilot driver having knowledge of ghat section where track \nmachine(s) has to work, shall be deputed on track machine(s). \n(c) Before offering readiness, brake power, hand brake & emergency \nbrake shall be tested. \n(d) SSE/JE/TM shall not leave driving/working cabin of track machine in \nghat section. \n(e) Wheel skids shall be kept ready. \n(f) While going in steep down gradient, a loco shall be attached/coupled \nin front/leading direction o f track machine and loco shall control all \nmovements. \n(g) While going in steep up gradient, a loco shall be attached/ coupled in \nrear/trailing direction of track machine direction and loco shall control \nall movements. \n(h) For working purpose, track machine will be uncoupled & loco shall \nmove along 25 meters away from the track machine. After completion \nof work, track machine shall be coupled with banking \nlocomotive/banker. \n(i) SSE/JE/P.Way shall be responsible to arrange a banking \nlocomotive/banker before readiness of track machine. \n(j) Drive only from the cabin corresponding to the direction of travel \n(except during small shunting movements where movement in \nopposite direction could be done with adequate precautions). \n(k) Do not drive the machine at speeds exceeding the p rescribed speed \nfor the section, this speed being further reduced over switches and \nspeed restriction zones. \n(l) Never drive over slopes or descending gradients without putting into \ngear and do not switch off gear box key switch. \n(m) Do not let the RPM of the engine fall below 1000 and do not switch off \nthe engine before the machine stops in gradient sections. \n(n) Shift back to lower gears well in time in case of ascending/descending \n \n \n210", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 232, + "text": "gradients. \n(o) Have a special check for the ZF gear box oil level and its working \ntemperature. \n(p) Ensure proper working of pneumatic circuit and functioning of all \ncomponents in the brake system. \n(q) Ensure availability of spares particularly in respect of items that are \nfailure prone such as transmission gear like cardan sha fts, coupling \nbolts etc. Availability of a skid is a must. \n(r) Also ensure proper working of horns and lights. \n(s) Be on the lookout for trespassers while negotiating sharp curves and \nalso sound horns on such occasions. \n(t) No run through movement shall be done in convoy while moving in \nghat section. Only one machine shall be allowed to move for run \nthrough movement in ghat section at a time. \n(2) Night Working - For machine working in the night suitable lighting \narrangements shall be done by SSE/JE/P.Way. Arrangements to take care of \nmovement of lights with machine with progress of work should also be done. \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n211", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 233, + "text": "Annexure 7.1 \n \n List of standard forms \n \n \n \nS.No Description Form No Font Colour \n \n/Remarks \n \n \n \n \n \n1 Starting permit T 310 Blue/Black \n \n \n \n \n \n2 Advance authority to pass defective signal T/ 369 – (1) Blue \n \n \n \n \n \n3 Authority to pass signals in ‘ON’ or defective position T/369 – (3b) Blue \n \n \n \n \n \n4 \nAuthority to pass shunt signal/gate signal at ‘ON’ and T. 370 Blue/Black \n \nshunting permitted indicator \n \n \n \n \n \n5 Caution order T/409 Green \n \n \n \n \n \n6 ‘Nil’ caution order T/A 409 Green \n \n \n \n \n \n7 Reminder caution order T/B 409 Green \n \n \n \n \n \n8 Authority to receive train on obstructed line T/509 Blue \n \n \n \n \n \n9 Authority to receive train on a non-signaled line T/510 Manuscript \n \n \n \n \n \n10 Authority to start a train from non-signaled line T/511 Blue \n \n \n \n \n \n11 \nAuthority to start a train from a line with common T/512 Blue \n \nstarter signal \n \n \n \n \n \n \n \n12 \nAuthority to proceed for relief engine/train to occupied T/A602 Red \n \nBlock section \n \n \n \n13 \nAuthority for opening communication during total T/B 602 Red \n \ninterruption of communication on single line section \n \n \n \n \n \n \n \n14 \nAuthority for working of trains during total interruption T/C 602 Red \n \nof communication on double line section \n \n \n \n \n \n15 \nAuthority for temporary single line working on double T/D 602 Red \n \nline section \n \n \n \n \n \n16 Conditional line clear ticket up T/G 602 Red \n \n \n \n \n \n 212", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 234, + "text": "17 Conditional line clear ticket down T/H 602 Red \n \n \n \n \n \n18 Shunting order T/806 Blue \n \n \n \n \n \n19 \nAuthority to pass automatic/semi automatic/manually T/A 912 Blue \n \noperated/gate signals \n \n \n \n \n \n20 \nAuthority to proceed without line clear on automatic T/B 912 Red \n \nblock signaling territory \n \n \n \n \n \n \n \n21 \nAuthority to proceed relief engine/train into automatic \nT/C 912 Red \n \noccupied block section \n \n \n \n \n \n \n \n22 \nAuthority to pass automatic block system during T/D 912 Blue \n \nprolonged failure of signals \n \n \n \n \n \n23 Authority to proceed without Line clear (UP) T.1408/UP Blue/Black \n \n \n \n \n \n24 Authority to proceed without Line clear Down T.1408/DN Blue/Black \n \n \n \n \n \n25 Paper Line clear ticket UP T/C 1425 Blue \n \n \n \n \n \n26 Paper line clear ticket DN T/D 1425 Blue \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n213", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 235, + "text": "Annexure 7.2 \n \nPersonal Diary \n \n \n \n \n \n \n \n \n \n \n \n \n \n \nName_____________ Designation \n_________________ \n \n \nThis book will be in possession of SSE/JE/TM \nwhose photograph is affixed above. He shall \nproduce the same on demand by any \ninspecting official. \n \n \n \nXEN/AXEN/TMC/…… \n \n \n \nINDEX(1 page desirable) \n \nS.No. Description(PLEASE CORRECT Page No. \n \nINDEX) \n \n \n \n \n \n \nI. Self Particulars 01 \n \nII. Particulars of \n \n Transfers/Promotions \n \nIII. Particulars of experience on \n \n different types of machines \n \nIV. Details of Awards/ \n \n Achievement’s during service \n \n period. \n \nV. Particulars of IRTMTC \n \n Training(Initial/Refresher) \n \nVI. Particulars of IRTMTC \n \n Training(Special courses) \n \nVII. Particular of ZTC Training \n \nVIII. Particulars of PME \n \nIX. Particulars of Machine \n \n Competency \n \nX. Particulars of LRD \n \nXI. Observation /Remarks of \n \n Inspecting officials \n \nXII. Observation /Remarks of \n \n Inspecting Supervisor \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n214", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 236, + "text": "I. Self Particulars(1 page desirable) \n \n \nS.No Item Description Details \n \n1 Name \n \n2 Father’s Name \n \n3 Date of Birth \n \n4 Designation and HQ \n station \n \n5 Educational qualification \n \n6 Scale and basic pay \n \n7 Phone and Mobile No. \n \n8 Date of appointment to \n Railway \n \n9 Date of \n appointment/Promotion \n to JE/SSE/TM \n \n10 Date of \n Appointment/Promotion \n to SSE/TM \n \n11 Unique ID/PF Account No. \n \n12 Pan No. \n \n13 Aadhaar Card No. \n \n14 Bill Unit No \n \n15 Address \n \n16 Phone No \n \n17 Academic Qualification \n \n18 Blood Group \n \n19 Date of attaining 45 years \n of age \n \n20 Date of attaining 55 years \n \n \n \nII. Particulars of Transfer/Promotion(1 page desirable) \nSN Name of the Date of Transfer*/ Remarks \n supervisory post Promotion \n \n1 JE/…… \n \n2 SSE/……. \n \n \n \n \n \n*Date of transfer means the date of joining the new \npost \n \n \nIII. Particulars of experience on different types \nof machine (2 pages desirable) \n \n \nYear@ Machine Period Remarks \n Type# worked* \n (months) \n \n2016-17 \n \n \n@ Period taken for filling the details shall be \nfinancial year \n# Machine type is to be written as DOUMATIC, \nBCM, DGS etc. \n*Periods of working on a type of machine of less \nthan 3 months a year are not to be recorded \n \n \nIV. Details of Award / Achievement’s \nduring service life(1 page desirable) \n \n \n Division Level Headquarter Level \n \nSN Cash / Awar Cash / Awar Sign of \n Certifi ded Certifi ded SSE/T \n cate by cate by M/SDI \n \n \n \n215", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 237, + "text": "of age \n \n21 Family Particulars \n \n22 Contact No. In case of \nEmergency \n \n23 Present Address and \nhome contact No. \n \n24 Permanent Address \nand home contact No. \n \n \n \n \n \nV. Details of IRTMTC Training (Initial/Refresher Course) (1 page desirable) \nName of Course \nPeriod Due date for Sign of \n \n \n \nFrom \n \nTo next course SSE/TM/SDI \n \n \n \n \n \n \n \n \n \n \n \n \n \n \nVI. Details of IRTMTC Training (Special Course) (1 page desirable) \nName of Course Period Due date for Sign of \n \nFrom \n \nTo next course SSE/TM/SDI \n \n \n \n \n \n \n \n \n \n \nVII. Details of ZTC Training (G&SR)(Initial/Refresher course)(1 page desirable) \nName of Course Period Due date for Sign of \n \nFrom \n \nTo next course SSE/TM/SDI \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n216", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 238, + "text": "VIII. Particulars of PME (1 page desirable) \nCategory \nDate of Certificate Issued \nNext PME \nSign of \n \nPME No. by SSE/TM/SDI \n \n \nDue Date \n \n \n \n \n \n \n \n \n \n \n \n \n \nUp to age of 45 @ 4 year. \n \nFor age between 45 to 55 @ 2 year \n \nAbove age of 55 @ every year \n \n \n \n \nIX. Particulars of Machine Competency (1 page desirable) \n(Dy.CE /TM Line or an officer authorized by him) \n Validity Period Issuing Due date for Sign of \n \nDate SSE/TM/SDI \n \nFrom To Authority reissue \n \n \n \n \n \n \n \n \n \n \nX. Particulars of LRD(Road/Route Learning and Signal particulars) \n(4 pages desirable) \nSection Line UP/DN Date of Sign of Sign of LI or \n etc. Completion JE/SSE/TM SSE/TM/SDI \n \n \n \n \n \n \n \n \n \n \n217", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 239, + "text": "XI. Observations/Remarks of Inspecting Officials(6 pages desirable) \nDate Designation Date of Remarks Sign of LI or \n Completion SSE/TM/SDI \n Sign of JE/SSE/TM \n \n \n \n \nXII. Observations/Remarks of Inspecting Supervisors (16 pages desirable) \nDate Designation Date of Remarks Sign of LI or \n Completion SSE/TM/SDI \n Sign of JE/SSE/TM \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n218", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 240, + "text": "Annexure 7.3 \n \nCompetency Certificate \n \n \nOffice of Dy.Chief Engineer, \nTrack Machine Line, \n……………………, ……….. \n \n \n \n \n \n \n \n \n \nPhotograph \n \n \n \n \n \n \n \n \n \nThis is to certify that Shri…………………………………..…………………….. \nDesignation………………………………………………… is competent & authorized to \noperate the Track Machines on ………………………. Railway. \n \n \n \nItem Description Last Done/ Next Due \n Attended \nPME \nInitial/Refresher Course, IRTMTC, ALD \nInitial/Refresher Course, G & SR, ZRTI, …. \n \nThis certificate is valid upto …………………………………. \nNo……………………………… \nDate…………………………... \n Dy.CE/TM Line/…… \n \n \n \n \n \n219", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 241, + "text": "Annexure 7.4 \n \nProforma of Machine Ready Memo \nFORM NO: TMM-1 \nZonal Railway Serial No. ………. \nStation ………………. \nMachine Type - ………………… \nMachine No. - ………………… \nSSE/JE/TM/I - ………………… \nMachine ready time - ………………… \n \n \n \n \nMachine Type - ………………… \n \nMachine No. - ………………… \n \nSSE/JE/TM/I - ………………… \n \nMachine ready time - ………………… \n \n \n \n \n Date ………….. \n \nMachine Type - ………………… \nMachine No. - ………………… \nSSE/JE/TM/I - ………………… \nMachine ready time - ………………… \n \n \nMachine Type - ………………… \nMachine No. - ………………… \nSSE/JE/TM/I - ………………… \nMachine ready time - ………………… \n \n \nUse one box for each machine. SSE/JE/TM/I of leading machine shall co-ordinate \nfor making this memo. \n \n \nTo – SM/………………….. \n \n \nSSE/JE/P.Way/………………. \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n220", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 242, + "text": "Annexure 7.5 \nProforma of Block Permit \nForm No.TMM-2 \n \n \nZonal Railway……………… Serial No. ………. \n \nTrack Machine block permit \n( SSE/JE/TM,SSE/JE/P.Way/Record) \n \n \nStation ………………….Date …………………Time ……………..Hrs………………. Minutes……………….. \nSSE/JE/TM (Machine Type/No.) …………………………………………………………………………………….. \nNo. of Track Machines to enter into block section for working ………………………………………… \nBLOCK DETAILS \nOn Track “Track Machine(s)” is granted block on ………Road, between …………station \n& …………..station, from ……Hrs……..Mts. to ……Hrs. …..Mts. i.e. for ……. Hrs.& …… Mts. \nEntering from …………….station& clearing into ……………..station. \n \nSpecial instructions if any ………………………………………………………………………… \n \nSIGNAL DETAILS \nYou are hereby authorized to pass Signal No. ……………at “ON” position & proceed \nbeyond/up to ………….. Signal. \nYou are hereby authorized to pass IBS/IBH Signal No. ………at “ON” position. (If \navailable) \nBlock Back/Block Forward No. ………………..in words ………………………. \n \n \nCAUTION ORDER DETAILS \nKm. ………..to Km……… with ………KMPH due to ……………… \nKm. ………..to Km……… with ………KMPH due to ……………… \nKm. ………..to Km……… with ………KMPH due to ……………… \n \n \nPILOT – OUT DETAILS \nYour Track Machine (Type of Machine) …………is being piloted-out \nfrom(Line)…………to ………..(Line). All points enroute are correctly set and \npadlocked. \n \n \nIf not applicable, may be strike out. \n \nSignature of SSE/JE/TM \n \n \nSignature of SSE/JE/P.Way \n \n \nSignature of Station Master \nTime ………….. \n \nTime …………..(Station Master’s stamp) \n \n221", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 243, + "text": "Annexure 7.6 \nInstructions for Machine Working in Automatic Signalling Section \n \n1.0 Double Line – In terms of GR – 9.02 - Duties of SSE/JE/TM when Automatic Stop \nSignal on double line is to be passed at “ON” \n(a) When SSE/JE/TM finds an Automatic Stop Signal with an ‘A’ marker at ‘ON’, \nhe shall bring his track machine to a stop in the rear of the signal. After \nbringing his track machine to a stop in the rear of the signal, the SSE/JE/TM \nshall wait there for one min ute by day and two minutes by night . If after \nwaiting for this period, the signal continues to remain at ‘ON’, proceed \nahead, as far as the line is clear, towards the next stop signal in advance \nexercising the great caution so as to stop short of any obstruction. \n(b) SSE/JE/TM shall show a stop hand signal towards the rear when the track \nmachine has been so stopped at an Automatic Stop signal. \n(c) Where owing to the curvature of the line, fog, rain or dust storm or other \ncause, the line ahead cannot be seen clear ly, SSE/JE/TM shall proceed at a \nvery slow speed, which shall under no circumstances exceed 8 kmph. Under \nthese circumstances SSE/JE/TM may seek the assistance of SSE/JE/P.Way. \n(d) When so, SSE/JE/P.Way shall accompany SSE/JE/TM in the driving cab, \nbefore tra ck machine moves forward, to assist the SSE/JE/TM in keeping a \nsharp lookout. \n(e) When an automatic stop signal has been passed at ‘ON’ the SSE/JE/TM shall \nproceed with great caution until the next stop signal is reached. Even if this \nsignal is ‘OFF’ the SSE/JE/TM shall continue to look out for any possible \nobstruction short of the same. He shall proceed cautiously up to that signal \nand shall act upon its indication only after he has reached it. \n2.0 Single Line –In terms of G R No. 9.07 – Duties of SSE/JE/TM when an Automatic \nStop signal on single line is to be passed at “ON”. \n(a) When SSE/JE/TM finds an automatic stop signal with an ‘A’ marker at ‘ON’ he \nshall bring his train to a stop in rear of that signal and wait there for one \nminute by day and two minutes by night. \n(b) If after waiting for this period the signal continues to remain at ‘ON” and if \ntelephone communication is provided near the signal, SSE/JE/TM shall \ncontact the Station Master of the next block station or the Centralized Traffic \nControl Operator of the section where Centralized Traffic Control is provided, \nand obtain his instructions. The Station Master or the Centralized Traffic \nControl Operator, as the case may be, shall after ascertaining that there is no \ntrain ahead up to the next signal an d that it is otherwise safe for the \nSSE/JE/TM to proceed so far as is known, give permission to the SSE/JE/TM \nto pass the signal in the “ON’ position and proceed up to the next signal, as \nmay be provided under special instructions. \n(c) If no telephone is prov ided near the signal or if the telephone \ncommunication provided near the signal is out of order and cannot be made \nuse of, the SSE/JE/TM shall give the prescribed code of whistle and exchange \n \n \n222", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 244, + "text": "signal with the SSE/JE/TM available on last track machine and then proceed \nto pass the signal as far as line is clear, up to the next stop signal in advance, \nexercising great caution so as to stop short of any obstruction. \n(d) SSE/JE/TM shall show a stop hand signal towards the rear when the train has \nbeen so stopped at an automatic signal. \n(e) Where owing to the curvature of the line, fog, rain or dust storm or other \ncause, the line ahead cannot be seen clearly, SSE/JE/TM shall proceed at a \nvery slow speed, which shall under no circumstances exceed 8 kmph. Under \nthese circumstances SSE/JE/TM may seek the assistance of SSE/JE/P.Way. \n(f) When so, SSE/JE/P.Way shall accompany with SSE/JE/TM in the driving cab, \nbefore track machine moves forward, to assist the SSE/JE/TM in keeping a \nsharp look-out. \n(g) When an automatic stop signal has been passed at ‘ON’ the SSE/JE/TM shall \nproceed with great caution until the next stop signal is reached. Even if this \nsignal is ‘OFF’, the SSE/JE/TM shall continue to look out for any possible \nobstruction short of the same. He sh all proceed cautiously up to that signal \nand shall act upon its indication only after he has reached it. \n3.0 Procedure to Pass Semi-Automatic Stop Signal at ‘ON’ – In terms of G & SR NO. \n9.14 – Procedure when Semi-Automatic Stop signal is ‘ON’. \n(a) When a semi-automatic stop signal is worked as an automatic stop signal, \nrule 9.02 or 9.07 shall apply as the case may be. \n(b) When a semi-automatic stop signal is worked as a manual stop signal and \nbecomes defective, it may only be passed under relevant rules. \n(c) When SSE/JE/TM is authorised to pass a semi -automatic stop signal at ‘ON’ \nby taking ‘OFF’ the calling -on signal fixed below it, he shall follow the \nprecautions stipulated in Rule 9.02 or 9.07 as the case may be. \n4.0 Procedure to Pass Gate Stop Signal at ‘ON’ In Automatic Signalling Territory – In \nterms of G & SR No. 9.15 - If SSE/JE/TM finds a Gate stop signal at ‘ON’ in an \nAutomatic signalling territory – \n(a) SSE/JE/TM shall comply with the provisions of rule 9.02 or 9.07 as the case \nmay be, if the ‘A’ marker is illuminated, or \n(b) If the ‘A’ marker light is extinguished, SSE/JE/TM shall sound the prescribed \ncode of whistle to warn the gateman and bring his track machine to a stop in \nrear of the signal. If after waiting for one minute by day and two minutes by \nnight, the signal is not taken ‘OFF’, SSE/JE/TM shall draw his track machine \nahead cautiously and stop in the rear of the level crossing. After ascertaining \nthat the gates are closed against road traffic and on getting hand signals from \nthe gateman, and in his absence, SSE/JE/TM shall sound the prescribed code \nof whistle and cautiously proceed up to the next stop signal complying with \nthe provisions of rules 9.02 or 9.07 as the case may be. \n5.0 Procedure for Movement of Track Machines against the Direction of Traffic in \nAutomatic Block System – In terms of G & SR No. 9.13, movement of track machines \nagainst the direction of traffic on the automatic block system – in automatic \nsignalling territory, track machine shall run in established direction of traffic only. \n \n223", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 245, + "text": "Movement of track machines against the established direction of traffic is not \npermitted. When in an emergency it becomes unavoidably necessary to move track \nmachine against the established direction of traffic, this shall be d one only under \nspecial instructions, which shall ensure that the line behind the said track machine \nup to the station in rear is clear and free from obstruction. \n6.0 Protection of a Track Machine stopped in an Automatic Block Signalling Section – In \nterms of G & SR NO. 9.10 - Protection of a track machine stopped in an Automatic \nBlock Signalling Section \n(a) When a track machine is stopped in an automatic block signalling section, \nSSE/JE/TM shall immediately exhibit a stop hand signal towards the rear and \ncheck up that the tailboard or taillight is correctly exhibited. \n(b) If the stoppage is on account of accident, failure, or obstruction and the \nmachine cannot proceed, SSE/JE/TM shall sound the prescribed code of \nwhistle and track machine shall be protected immediately as per Rule 6.03 \nexcept that for the protection of the occupied line one detonator shall be \nplaced at 90 m from the track machine on the way out and similarly two \ndetonators, 10 m part, not less than 180 m from the track machine or at such \ndistance as has been fixed by special instructions. \n7.0 Procedure of Block Working of Track Machine in An Automatic Block Signalling \nSection \n(a) In terms of G & SR 4.65-5 (iii, a) – Track machine(s) shall work under the line \nblock only. \n(b) Automatic block signalling section shall be treated as absolute block section. \n8.0 Intermediate Block Hut/Section \n(a) When track machine is going on line clear \n(i) While going on line clear from one station to another, if IBS/IBH is found \nsignal at \"ON\" position then track machine shall be stopped. After 05 \nminutes SSE/JE/TM shall contact the SM in rear station through the \nphone provided under the IBH/IBS. If SM allows the machine to go ahead \nat on position then SM shall give his private No. Thereafter track \nmachine shall proceed to the station in advance. \n(ii) While going on line clear from one station to another, if IBS/IBH is found \nsignal at \"ON\" position then track machine shall be stopped. After 05 \nminutes SSE/JE/TM shall contact the SM in rear station through the \nphone provided und er the IBH/IBS and if phone provided under the \nIBS/IBH is found defective and if visibility is clear then track machine shall \nproceed to the station in advance with 15 kmph, if visibility is not clear \nthen track machine shall proceed to the station in adva nce with 08 \nkmph. \n(iii) After reaching to the station in advance, SSE/JE/TM shall report as above \nin writing to SM on duty of station in advance. \n(b) When track machine is going for block working IBH/IBS shall be treated \nas cancelled and track machine may pass IBS /IBH signal at ON position. \nThis fact shall be mentioned in the memo given by station master. \n \n224", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 246, + "text": "Annexure 7.7 \nInfringement to Indian Railways Schedule of Dimension by Various Track Machines \n(A) Infringement to Schedule of Dimensions – 1939 \nSN Name of the Make Transport- Infringement Description Actual Dimension Speed in kmph \n \n Machine ation Code Dimension of as per SOD \n \n \nSelf pro- In train \n \n \nMachine (mm) (mm) \n \n \npelled formation \n \n \n \n \n \n1. Continuous Tamping M/s Plasser i) Min. dia of new wheel tread measured at 63.5 mm from 730 914 60 40 \n \n Machine (09 - 32 wheel gauge face. \n \n \nCSM) \n \n \n ii) Min. rigid wheel base. 1800 1830 \n \n \n \n2. Points & Crossing M/s Plasser i) Min. dia of new wheel tread measured at 63.5 mm from 730 914 60 40 \n \n Tamping Machine wheel gauge face. \n \n (UNIMAT 08- ii) Min. rigid wheel base. 1800 1830 \n \n 275-3S) iii) Max. distance between any two adjacent axles. 12200 11890 \n \n3. Dynamic Track M/s Plasser i) Min. dia of new wheel tread measured at 63.5 mm from 730 914 60 50 \n \n Stabilizer (DGS-62N) wheel gauge face \n \n ii) Min. rigid wheel base for bogie. 1500 1830 \n \n \n \n4. Ballast Cleaning M/s Plasser i) Min. dia of new wheel tread measured at 63.5 mm from 900 914 40 30 \n \n Machine (RM-80) wheel gauge face. \n \n ii) Max. distance apart of bogie centres. 22200 14785 \n \n iii) Max. length of bogie or roof. 29360 21340 \n \n iv) Max. length of under frames over headstocks. 29360 21030 \n \n v) Max. length over side buffers. 30600 22300 \n \n vi) Max. distance apart between adjacent axles. 20370 11890 \n \n5. Ballast Regulator M/s – i) Min. dia of new wheel tread measured at 63.5 mm from 838.2 914 50 40 \n \n (66-4) Kershaw wheel gauge face. \n \n USA 4-wheeler vehicles. \n \n ii) Max. length of body or roof for 4-wheeler vehicles. 9120 8540 \n \n iii) Max. length over side buffers 10389 9810 \n \n \n \n \n \n \n \n \n225", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 247, + "text": "SN Name of the Make Transp- Infringement Description Actual Dimension Speed in kmph \n Machine ortation Dimension of as per SOD Self pro- In train \n Code Machine (mm) (mm) pelled. formation \n6. Track Relaying MIs Tamper i) Min. dia of new wheel tread measured at 63.5 mm from 838.2 914 5 50 \n Train Corpora-tion, wheel gauge face. \n (P-811-S) USA ii) Min. rigid wheel base for bogie truck. 1727.2 1830 \n iii) Max. distance apart between any two adjacent axles 12072.94 11890 \n7. Points & Crossing M/s Plasser i) Min. dia. of new wheel tread measured at 63.5 mm from 900 914 40 30 \n Cleaning Machine wheel gauge face. \n (RM-76 UHR) ii) Max. distance apart of bogie centre. 19500 14785 \n iii) Max. length of body or roof for bogie vehicles. 23490 21340 \n iv) Max. length of under frames over headstocks. 23490 21030 \n v) Max. length over side buffers 24730 22300 \n vi) Max. distance apart between two adjacent axles 17670 11890 \n8. Points & Crossing M/s –Ameca i) Wheel Gauge: 10 - \n Changing Machine Italy Maximum 1604 1602 \n (AMECA-T-28) Minimum 1598 1599 \n ii) Min. dia of new wheel tread measured at 63.5 mm from 400 914 \n wheel gauge face \n \n9. Ballast Cleaning M/s Plasser i) Min. dia on wheel tread. 900 914 50 40 \n Machine ii) Max. distance apart of bogie centre 22200 14785 \n (RM80- iii) Max. length of body 28300 21340 \n 92-I) iv) Max. length over head stock 28300 21030 \n v) Max. length over side buffers. 29540 22300 \n vi) Max distance apart between any two adjacent axles. 20370 11890 \n10. Shoulder Ballast M/s Plasser i) Min. dia on wheel tread. 900 914 40 30 \n Cleaning Machine ii) Max. distance apart of bogie centres 16000 14785 \n (FRM-80) iii) Max. length of body 38200 21340 \n iv) Max. length over head stocks 38200 21030 \n v) Max. length over side buffers. 39470 22300 \n vi) Max distance apart between any two adjacent axles. 14170 11890 \n11. UTV 502 L M/s –Tamper i) Min. dia on new wheel tread. 838.2 914 60 40 \n Carpora-tion ii) Max. rigid wheel base. 8000 6100 \n USA iiii) Max. length of body for 4-wheel vehicle 3200 mm wide. 11303 8540 \n iv) Max. length over head stocks. 11303 8540 \n v)Max. length over side buffers. 12522 9810 \n \n \n \n \n226", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 248, + "text": "SN Name of the Make Transp- Infringement Description Actual Dimension Speed in kmph \n Machine ortation Dimension of as per SOD Self pro- In train \n Code Machine (mm) (mm) pelled. formation \n12. P&C Tamping M/s Plasser i) Min. dia on wheel tread. 730 914 60 40 \n Machine 08-275 ii) Min. distance apart of bogie centres. 11500 11933 \n (UNIMAT). iii)Min. bogie wheel base. 1500 1830 \n13. Ballast Regulator M/s –Kershaw i) Min. dia on wheel tread. 832 914 60 40 \n 56-3 USA ii) Max. length of body. 11074 8540 \n iii) Max. length over headstocks. 11074 8540 \n iv) Max. length over side buffers. 12344 9810 \n14. Multipurpose M/s Plasser i). Min. dia on wheel tread measured at 63.5mm from gauge 730 914 60 40 \n Tamping Machine. face. \n ii) Min. rigid wheel base for bogie truck of any vehicle. 1800 1830 \n \n15. High Output M/s Plasser CHTM0 i). Min. dia on the tread of new carriage wheel, measured at 730 914 60 60 \n Tamping Machine 9-3XP1 63.5mm from the wheel gauge face. \n (09-3X) 20.0t axle ii) Max. distance apart of bogie centres for bogie vehicles 15700 14785 \n load. 3250 mm wide. \n iii) Min. rigid wheel base for bogie truck of any vehicle. 1500-Satellite \n bogie. \n 1800-Front and \n Rear bogies \n iv) Max. Length of underframes over headstocks for bogie 21700 21030 \n vehicles 3250mm wide. \n \n v) Max. Length over side buffers for bogie vehicles 3250mm 22940 22300 \n wide. \n \n16. Utility Track M/s-BHEL i)Distance apart for centres of buffers . 1956 1955 50 50 \n Vehicle ii) Max Length of body or roof for 4 wheeler vehicle 3200 10516 8540 \n mm wide. \n17. Shoulder Ballast M/s Plasser CSBC85 i) Min. Dia on the tread of new carriage or wagon wheel, 900 914 40 30 \n Cleaning Machine FP measured at 63.5 mm from wheel gauge face. \n (FRM-85F). ii) Max. distance apart of bogie centres . 16000 14785 \n iii) Max. Length of body or roof. 38200 21340 \n iv) Max. Length of under frames over head stocks. 38200 21030 \n v) Max. Length over side buffers. 39440 22300 \n vi) Max. distance apart between any two adjacent axles. 14170 11890 \n \n \n227", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 249, + "text": "SN Name of the Make Transp- Infringement Description Actual Dimension Speed in kmph \n Machine ortation Dimension of as per SOD \n Code Machine (mm) (mm) Self pro- In train \n pelled. formation \n18. Worksite Tamper M/s -Metex i). Min. dia of wheel tread measured at 63.5mm from gauge 710.325 914 40 40 \n Model-VPR-02M face. \n ii) Minimum projection for flange of new tyre, measured 27.675 28.50 \n from tread at 63.5mm from wheel gauge face. \n iii) Max. thickness of flange of tyre ,measured from wheel 32.31 28.5 \n gauge face at 13 mm from outer edge of flange. \n iv) Max. Length over side buffers for bogie vehicle 3250mm 23550 22300 \n wide. \n19. Utility Track Vehicle. M/s- OEPL i) Max. thickness of flange of tyre ,measured from wheel 29.4 28.5 60 50 \n gauge face at 13 mm from outer edge of flange. \n ii) Max. rigid wheel base. 6500 6100 \n iii) Max Length of body or roof for 4 wheeled vehicle 3200 9000 8540 \n mm wide. \n iv) Max. Length of under frames over head stocks. 9000 8540 \n v) Max. Length over side buffers. 10270 9810 \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n228", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 250, + "text": "(B) Infringement to Schedule of Dimensions – 2004 \n \nSN Name of the Make Transp- Infringement Description Actual Dimension Dimensi Speed in kmph \n \n Machine ortation of Machine (mm) on as \n \n \nCode \n \nper SOD \n \n Self pro- In train \n \n (mm) pelled. formation \n \n \n \n1 High Output Tamping M/s Plasser i). Min. dia on the tread of new carriage or wagon wheel, 730-for Satellite 914 50 65 \n \n Machine (09-3X) measured at 63.5mm from the wheel gauge face. bogie. \n \n 18.5t axle load. 850- for Front and \n \n Rear bogies. \n \n ii) Max. thickness of flange of tyre ,measured from wheel 28.68 28.50 \n \n gauge face at 13 mm from outer edge of flange. \n \n iii)Maximum height above rail level for floor of any 1370 1345 \n \n unloaded vehicle. \n \n iv) Max. distance apart of bogie centres for bogie vehicles . 15700 15241 \n \n v) Min. rigid wheel base for bogie truck of any vehicle 1500-for Satellite 1830 \n \n bogie. \n \n 1800-for Front \n \n and Rear bogies. \n \n vi) Max. Length of body or roof for bogie vehicles. 21700 21340 \n \n vii) Max. Length over side buffers for bogie vehicles. 22940 22300 \n \n2. High Output Tamping M/s Plasser CHTM09- i). Min. dia on the tread of new carriage or wagon wheel, 730-for Satellite 914 50 65 \n \n Machine (09-3X) 3XP measured at 63.5mm from the wheel gauge face. \n \n 21.0t axle load. ii) Max. thickness of flange of tyre ,measured from wheel 29.46 29.4 \n \n gauge face at 13 mm from outer edge of flange. \n \n iii) Max. height above rail level for floor of any unloaded 1370 1345 \n \n vehicle. \n \n iv) Distance apart for centres of buffers 1955 1956 \n \n v.) Max. distance apart of bogie centres for bogie vehicles 15700 14900 \n \n vi) Min. rigid wheel base for bogie truck of any vehicle. 1500-for Satellite 1830 \n \n bogie. \n \n 1800-for Front \n \n and Rear bogies. \n \n vii) Max. Length of body or roof for bogie vehicles. 21700 21340 \n \n viii) Max. Length over side buffers for bogie vehicles. 22940 22300 \n \n \n \n229", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 251, + "text": "SN Name of the Make Transp- Infringement Description Actual Dimension Dimensi Speed in kmph \n \n Machine ortation of Machine (mm) on as \n \n \nCode \n \nper SOD \n \n Self pro- In train \n \n (mm) pelled. formation \n \n \n \n3. Utility Track Vehicle M/s i) Max. thickness of flange of tyre ,measured from wheel 29.4 28.5 50 60 \n \n with Mobile Crane. Phooltas gauge face at 13 mm from outer edge of flange. \n \n ii) Distance apart for centres of buffers. 1956 1955 \n \n \n iii) Max. rigid wheel base 8000 6100 \n \n \n iv) Max. Length of body or roof for 4 wheeled vehicle. 11900 8540 \n \n v) Max. Length over side buffers for 4 wheeled vehicle 13170 9810 \n \n4. Utility Track Vehicle. M/s BEML CUTVB i) Max. thickness of flange of tyre ,measured from wheel 29.4 28.5 50 50 \n \n gauge face at 13 mm from outer edge of flange. \n \n ii) Distance apart for centres of buffers. 1956 1955 \n \n \n iii) Max. rigid wheel base for four wheeled vehicles. 7000 6100 \n \n iv) Max Length of body or roof for 4 wheeled vehicle. 10850 8540 \n \n v) Max. Length over side buffers for 4 wheeled vehicle. 12120 9810 \n \n5. Dynamic track M/s BHEL CTSBH i) Maximum height above rail level for floor of any unloaded 1450 1345 50 50 \n \n Stabilizer vehicle. \n \n6. Ballast Regulating M/s Plasser BRM/USP- i) Min. Dia on the tread of new carriage or wagon wheel, 850 914 50 60 \n \n Machine Model-USP 2000SWS measured at 63.5 mm from wheel gauge face. \n \n 2000 SWS ii) Max. thickness of flange of tyre ,measured from wheel 28.64 28.5 \n \n gauge face at 13 mm from outer edge of flange. \n \n iii) Maximum height above rail level for floor of any 2100 1345 \n \n unloaded vehicle. \n \n iv) Distance apart for centres of buffers 1955 1956 \n \n \n7. Point & Crossing M/s Plasser PCTM/08- i) Max. thickness of flange of tyre ,measured from wheel 29.46 28.50 50 65 \n \n Tamping Machine 475-4S gauge face at 13 mm from outer edge of flange. \n \n (UNIMAT 08-475-4S) ii) Maximum height above rail level for floor of any 1370 1345 \n \n unloaded vehicle. \n \n \n iii) Distance apart for centres of buffers. 1955 1956 \n \n \n iv) Min. rigid wheel base for bogie truck of any vehicle. 1800 1830 \n \n v) Max. Length over side buffers for bogie vehicle. 28370 22300 \n \n \n \n \n \n \n \n230", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 252, + "text": "SN Name of the Make Transp- Infringement Description Actual Dimens- Speed in kmph \n \n Machine ortation Dimension of ion as per \n \n Code Machine (mm) SOD (mm) Self pro- In train \n \n pelled. formation \n \n \n \n8. Lifting, Lining M/s Plasser i) Min. Dia on the tread of new carriage or wagon wheel, 850 914 50 50 \n \n ,Levelling and measured at 63.5 mm from wheel gauge face. \n \n Tamping Machine ii) Max. thickness of flange of tyre ,measured from wheel 28.64 28.50 \n \n Model-08-32C gauge face at 13 mm from outer edge of flange. \n \n DUOMATIC iii) Distance apart for centres of buffers. 1955 1956 \n \n \n \n iv) Min. rigid wheel base for bogie truck of any vehicle. 1800 1830 \n \n9. Dynamic Track M/s Metex DTSC8TMX i) Min. Dia on the tread of new carriage or wagon wheel, 860 914 50 50 \n \n Stabilizer (Model measured at 63.5 mm from wheel gauge face. \n \n DSP-C8T) ii) Maximum height above rail level for floor of any 1635 1345 \n \n unloaded vehicle. \n \n \n \n10. Ballast Regulating M/s Plasser CBRM400R i) Min. Dia on the tread of new carriage or wagon wheel, 730 914 50 50 \n \n Machine Model-PBR P measured at 63.5 mm from wheel gauge face. \n \n 400R ii) Max. thickness of flange of tyre ,measured from wheel 28.64 28.50 \n \n gauge face at 13 mm from outer edge of flange. \n \n iii) Distance apart for centres of buffers. 1955 1956 \n \n iv) Max Length of body or roof for 4 wheeled vehicle. 9750 8540 \n \n v) Max. Length over side buffers for 4 wheeled vehicle. 11020 9810 \n \n11. Rail Grinding M/s Loram CRG 72L i) Maximum height above rail level for floor of any unloaded 1683 1345 50 65 \n \n Machine(RGI-72) vehicle. \n \n \n \n12. Ballast Regulating M/s Metex CBRM/RPB i) Maximum height above rail level for floor of any unloaded 1700 1345 50 50 \n \n MachineModel-RPB- -01MX vehicle. \n \n \n01 \n \n \n ii) Distance apart for centres of buffers. 1955 1956 \n \n13. Ballast Cleaning M/s BHEL i) Maximum height above rail level for floor of any unloaded 1600 1345 50 50 \n \n Machine vehicle. \n \n ii) Max. distance apart of bogie centres for bogie vehicles. 18000 15241 \n \n iii) Max. Length of body or roof for bogie vehicles 23840 21340 \n \n iv) Max. Length over side buffers for bogie vehicles. 25110 22300 \n \n v) Max. distance apart between any two adjacent axles 15900 12345 \n \n14. Worksite Tamper M/s Metex TTM/VPR- i) Min. Dia on the tread of new carriage or wagon wheel, 732 914 50 50 \n \n without flat car 02M measured at 63.5 mm from wheel gauge face. \n \n Model-VPR-02M \n \n \n \n231", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 253, + "text": "SN Name of the Make Transp- Infringement Description Actual Dimens- Speed in kmph \n \n Machine ortation Dimension of ion as per \n \n \nCode \n \nMachine (mm) SOD (mm) \n \n Self pro- In train \n \n pelled. formation \n \n \n \n15. Ballast Regulating M/s Gemac CBRMG i) Max. rigid wheel base for four wheeled vehicles. 7500 6100 50 60 \n \n Machine Model SPZ China ii) Max. length of body or roof for 4 wheeled vehicle. 13590 8540 \n \n 210k iii) Max. Length over side buffers for 4 wheeled vehicle. 14780 9810 \n \n16. Multipurpose M/s Plasser CMTUSHP i)Min. Dia on the tread of new carriage or wagon wheel, 730 914 45 45 \n \n Tamping Machine measured at 63.5 mm from wheel gauge face. \n \n Model-Unimat Split ii)Distance apart from centres of buffers. 1955 1956 \n \n \nHead MFI \n \n iii) Max. Length over side buffers for bogie vehicles. 28570 22300 \n \n17. Rail Borne M/s RBMVP i)Min. Dia on the tread of new carriage or wagon wheel, 952 914 65 65 \n \n Maintenance Vehicle Phooltas measured at 63.5 mm from wheel gauge face \n \n \n(RBMV) Model- \n \n ii) Distance apart from centres of buffers . 1956 1956 \n \n \nRBMV.01 \n \n iii)Max. Length over side buffers for bogie vehicles 21337 21340 \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n232", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 254, + "text": "233 \n \nCHAPTER 8 \nPERIODICAL MAINTENANCE AND ASSOCIATED \nINFRASTRUCTURAL FACILITY \n801 General - Periodical maintenance including overhauling and timely repairs are \nessentially required for ensuring reliable and efficient working of track machines. \nThere should be a proper schedule of maintenance and necessary infrastructure \nshould be created for carrying out the maintenance of track machines. \n802 Maintenance Schedule for Track Machines - Periodical maintenance and \nrepairs of machines shall be carried as per Schedules I to VII. Schedule VI and VII \npertains to Intermediate Overhauling (IOH) and Periodic O verhauling (POH) \nrespectively, which are to be carried out at ZMD/CPOH workshops as specified \nand as per prescribed frequency. \n(1) Maintenance Schedule for Various Track Machine - Periodicity and \nduration of various maintenance schedules for all th e machines are \ntabulated in Annexure-8.1 \n(a) Guidelines for Maintenance Schedules – for Track Machines other \nthan RGM \n(i) Adherence to the schedules should be ensured duly informing \nthe division in advance. Similar practice should be followed for \nthe schedules to be carried out at satellite depots so that the \nworks of the division are not left midway at critical junctures. \n(ii) IOH and POH should be incorporated and exhibited in the \ndeployment planning so that divisions are aware in advance \nand can plan the works accordingly. \n(iii) RDSO shall issue instructions on maintenance to be done in \ndifferent schedules including POH of different machines. Items \nto be checked and attended under various schedules shall \ngenerally be as per RDSO’s instructions. In case of any doubt, it \nis to be referred to RDSO for clarification & till then the \nmaintenance can be done as per manufacturer’s i nstructions \nprovided in their manuals . Reference to the manufacturer may \nalso be made keeping RDSO informed. Minor changes in \ninstructions may be done with approval of CE/TM of the \nconcerned Zonal Railway. \n(iv) Before undertaking POH & IOH, major components, su b-\nassemblies and spares required should be procured and kept in \nreadiness. \n(v) 3rd POH should be carried out if the machine is expected to \nwork for residual life of around 3000 to 4000 ERH after the 3rd", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 255, + "text": "234 \n \nPOH. Railways should prepare a 2 -years plan for POH & IOH of \ntrack machines (firm for one year and tentative for next year), \nso that procurement of spares, a long lead item, can be done in \ntime. \n(b) Guidelines for Maintenance Schedules for RGM \n(i) Maintenance of RGM shall be done by a separate maintenance \nteam attached with each RGM. This team will be in addition to \nthe operating team. \n(ii) Day to day maintenance ( schedule-I) of RGM should be done \nby separate maintenance group before and after traffic block, \nas it involves considerable work load & time. Operating staff of \nthe machine shall do daily pre-block check and duration of such \ncheck should not be more than one hour. \n(iii) Schedule II to IV should be carried out by maintenance staff \nalong with regular operating staff. \n(iv) During IOH/POH of RGM (schedule VI & VII), the operating staff \nas well as maintenance staff should be actively involved and \ncarry out jobs along with IOH/POH staff. \n(v) Items to be checked and attended under various schedules \nshall normally be as per RDSO’s instructions. In case of any \ndoubt, it is to be ref erred to RDSO for clarification & till then \nthe maintenance can be done as per manufacturer’s \ninstructions on the subject or as considered suitable with \napproval of CE/TM of the holding Railway. \n(2) Inspection of Wheel and Axle of On- Track Machine - Track Machine \nWheels are solid wheels and follow the wheel profile as per RDSO drawing \nno. SKETCH -91146. Visual inspection, Physical inspection and Ultrasonic \ninspection of the wheels and axles of on- track machines are required to be \ndone during initial procurement. The ultrasonic testing of new wheels shall \nbe done according to the RDSO report no. IRS R-34-2003. Wheels and axles \nshall also be subjected to visual and physical examination. Ultrasonic \ntesting for axles only, should be done during service at prescri bed \nfrequency laid down by RDSO.\n \n(a) Visual and Physical Examination - Visual and physical inspection of \nwheels of on -track machines shall be done during service as per \n“Procedure for visual & physical inspection of wheels and axles of on-\ntrack machines” issue d by Track Machine and Monitoring \nDirectorate, RDSO ( REPORT NO. TM -170, July-2012). Inspection shall \nbe done on inspection pit line at a frequency of once in a year or \nonce after every 1000 engine running hours whichever is earlier. \nHowever periodic visual inspection for any apparent wheel defect", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 256, + "text": "235 \n \nshall be carried out with 50 hours schedule, which is done at track \nmachine siding/stabling line. \n(b) Ultrasonic Testing of Wheel and Axle of On-Track Machines \n(i) Ultrasonic flaw detection (USFD) testing of Axles and Wheels of \nOn-Track Machines shall be done as per “Code of procedures \nfor Ultrasonic testing of a xles and w heels of l arge track \nmachines” issued for different on- track machines by Research \nDesigns and Standards Organization (RDSO). \n(ii) The wheels shall be tested ultrasonically at the time of initial \nprocurement only. \n(iii) The frequency of ultrasonic examination of axles of o n-track \nmachines shall be b etween 40,000 to 45,000 kms of running or \nthree years, whichever is earlier. \n(iv) Testing shall be done by supervisors possessing \nregular/refresher course certificate from RDSO. \n(v) Criteria for the supervisors to be selected and trained for USFD \ntesting of axles shall be one of the following: \n• Graduate in Science with Physics from a University or Institution \nrecognized by Central/State Govt./UGC/or Int ernational \nInstitute/University. \n• 3 years regular Diploma in Mechanical/Civil/Electronics/ \nElectrical/Metallurgical/Chemical Engineering from a University \nor Institution recognized by Central/State Govt./Technical \neducation board or International Institute/University. \n• M.Sc in Chemistry provided that Physics was one of the subjects \nat ISC/Intermediate/10+2 levels. \n• B.E./B.Tech. in Mechanical/Civil/Electronics/Electrical/Chemical/ \nMetallurgical/I.T/Computer Science from a University or \nInstitution recognized by Central/State Govt./Technical \neducation board or International Institute/University. \n(vi) The validity of initial course certificate shall be 3 years and \nrefresher course certificate shall be 5 years. \n(vii) Research Designs and Standards Organization regularly conducts \ntraining of supervisors for ultrasonic ex amination of a xles and \nwheels. Railways shall nominate their eligible staff for the \nrequired training. \n803 Types of Workshops - For carrying out the repairs as well as periodical \nmaintenance of track machines, five types of repairs and maintenance facilities/ \nworkshops shall be developed as below: -", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 257, + "text": "236 \n \n(1) Central Periodical Overhauling Workshop (CPOH). \n(2) Intermediate Overhauling Workshop (IOH)/Zonal Machine Depot. \n(3) Satellite depot. \n(4) Mobile Workshop cum Transport Van. \n(5) Camp Coach Workshop. \n804 Central Periodi cal Overhauling Workshop (CPOH) - CPOH workshops \nare developed depending on the holding of machines on Indian Railway and \ngeographical considerations. \n(1) Functions of CPOH – The functions of CPOH workshop are as under: \n(a) POH of machines. \n(b) Overhauling of tamping units, transmission gearboxes, axle assembly \nand lifting, lining assembly for unit exchange either at shop floor or \nfield. \n(c) Post POH s ervice to Zonal Railways and performance monitoring of \noverhauled items. \n(d) Development of expertise, standardization/ documentation/ \ndissemination of knowledge with respect to overhauling of \nassemblies. \n(e) Study and development of inter -changeability of components and \nsub-assemblies. \n(f) Study of failures, finding out remedial measures, troubleshooting, \nmodification & refinement of maintenance practices. \n(g) Procurement of stores and equipment required for POH and gadgets \nrequired for testing of overhauled machines, sub- assemblies and \ncomponents. \n(h) Inspection and testing of machines/assemblies received prior to and \nafter POH. \n(i) Study of new imported machines and preparation of inventory list \nwith complete series of machines (machine -wise) and checking for \nchanges with reference to old series of machines. \n(j) Development of indigenous substitutes and reliabl e competitive \nsources of supply. \n(k) Development of drawings and material specifications for \nmanufacture of spares. \n(l) Providing shop floor training regarding maintenance of machi nes to \nZonal Railways on demand. \n(m) Acting as knowledge centres for track machines.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 258, + "text": "237 \n \n(2) POH Planning for Track Machines to be Attended \n(a) POH Programme from Zonal Railways - Zonal Railways shall send the \nlist of machines due for POH as also requirement of overhauled \ntamping units for a two -year period in the month of December every \nyear to the respective CPOH workshop in the format given in \nAnnexure 8.2. \n(b) Finalization of POH Programme by CPOH Workshop \n(i) CPOH shall prepare POH program for two years (Firm for the \nfirst year and tentative for second year) and forward it to \nRailway Board by 31st January every year for approval. Railway \nBoard shall issue the approved POH programme of track \nmachines and distribution of tamping units for 2 years period. \n(ii) CPOH shall start indenting process to procure spares \nconsidering the requirements of two years based on \nprogramme submitted to Railway Board. \n(iii) The Zonal Railway should send detailed report to Dy.CE/TM \n(CPOH) at least two months in advance of arrival of the \nmachine for CPOH workshop to take preparatory action and \narrangement of additional spares, if any. \n(iv) Annual targets for track machines and machine deployment \nprogramme shall be fixed considering the POH, IOH and transit \nduration. \n(3) POH Execution \n(a) Staff of machine shall accompan y the machine during POH and \nactively associate themselves in overhauling of the machine. \n(b) On arrival of the machine SSE/TM (CPOH) and SSE/TM (in -charge) \nshould conduct a joint survey of m achine for assessment of repairs \nand reconditioning works required. \n(c) Zonal railways shall accept Provisional Debits (Adjustment Memo) \ntowards the expenditure on POH raised by Dy. CE/TM (CPOH) , on \narrival of machine. Final debit shall be raised after actual completion \nof work duly verified by SSE/TM (in-charge) of the machine. \n(d) Model activity flow chart for POH of track machine is depicted in \nAnnexure 8.3. CPOH shall decide the items to be replaced, repaired, \nand reused during POH work and will consult the railway, if required. \n(e) Unit Exchange for POH: To minimize POH duration, activities of POH \nshould be planned on the basis of unit exchange for various sub-\nassemblies like tamping units, engines and other important \nassemblies/sub-assemblies.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 259, + "text": "238 \n \n(f) Process control: POH process should be controlled by preparing \nmachine register, checklists, method sheets and statement, working \ninstructions, specifications and activity chart. \n(g) Typical list of infrastructural facilities like shed & structure, plant & \nmachinery, measuring/working tools including other miscellaneous \nequipment required for CPOH workshop shall be as per Para 809. \n(h) CPOH workshops shall adhere to the prescribed time schedules for \ncompleting the POH. Delay, if any, beyond stipulated period must be \npromptly advised to concerned owning railway well in advance giving \ndetailed reasons. \n(4) Dispatch of Machine after POH \n(a) After out turn of machine from shed, all functional parameters shall \nbe calibrated as per rated tolerances specified for the machine in \ndrawing and catalogues. Null setting of all sensing units, transducers, \npendulums and PCBs shall be carried out on zero defect track. All \ndisplay units/input values shall b e validated with calibrated masters \nas listed in Annexure 8.5. Format for master calibration is given in \nAnnexure 8.6. \n(b) It is desirable that an officer of the owning railway may be present \nduring the testing and trials. SSE(TM)/in -charge shall take over the \noverhauled machine, only after all the tests and trials have been \ncarried out and test run certificate is signed. A test run certificate \nshall be jointly signed by officials of Zonal R ailways and CPOH along \nwith a summary repair sheet with details of POH execution as per \nAnnexure 8.7 before dispatch of machine. \n(c) It is desirable to have third party audit/inspection organized by CPOH \nworkshop involving OEM and necessary rectification measures taken \nbefore dispatch of machine. \n(d) CPOH should furnish the list of spares replaced during POH and \nreleased components shall be handed over to machine staff, unless \nagreed otherwise, with the approval of Dy.CE/TM/Line of the Zonal \nRailway. \n(e) The CPOH works hop shall stand warranty for satisfactory working of \nthe machine and tamping units and other assemblies/sub-assemblies \nfor a period of six months after commissioning of the machine. Zonal \nRailway shall report such issues, which are beyond the technical \nexpertise of Zonal Railways, for attention and assistance from CPOH. \n(f) Feedback of machine and tamping unit performance after POH \nshould be sent to CPOH after three months and as and when \nrequired in the format given in Annexure 8.8.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 260, + "text": "239 \n \n(g) CPOH workshop shall separately advise the machine holding railway \nabout the components under trial and modification carried out \nduring POH, if any. Zonal R ailways shall keep special watch on these \nitems and submit feedback to CPOH workshop about their \nperformance.\n \n805 Intermediate Overhauling Workshop (IOH)/Zonal Maintenance \nDepot (ZMD) - There shall be at least one Zonal Machine Depot with each \nZonal Railway. The IOH of all the machines shall be carried out as per the \nschedule VI mentioned in para 802 unless otherwise stipulated by OEM. In \naddition, POH of machines, which are specified in para 802, shall also be \nundertaken in ZMD. \n(1) Functions of ZMD – The functions of ZMD workshop are as under: \n(a) IOH of all machines. \n(b) POH of machines specified to be done in ZMD. \n(c) Need based overhauling/unit replacement of engines, tamping units, \ngear assembly, axle assembly and lifting, lining assembly etc. either \nat shop floor or field. \n(d) Field attention in case of break down by creating service groups of \ndifferent functions like hydraulics, pneumatic, electronic, electrical \netc. either at the Zonal depot level or satellite \ndepot level. \n(e) Assistance to machine & satellite depot staff or execution of heavy \nrepair and schedule maintenance. \n(f) Study of failures, finding out remedial measures, troubleshooting and \ndevelopment of maintenance practices. \n(g) Procurement of stores and equipment required for operati on and \nmaintenance of all machines including IOH/POH. \n(h) Annual calibration of machines gauges. \n(i) Preparation of inventory list for new series /model of machine with \ncomplete series of machines (machine -wise) and checking for \nchanges with reference to old series of machines. \n(j) Development of indigenous substitutes and reliable competitive \nsources of supply. \n(2) Facilities at ZMD - Facilities at ZMD shall include stores for spares and \nconsumable with facilities for housing the track machines and carrying out \nthe repairs, assembly and replacement of unit components along with the \noffices for SSE and track machine officers. Typical list of infrastructural \nfacilities like shed & structure, plant & machinery, measuring/working \ntools including other miscellaneous equipment required for ZMD shall be \nas per Para 809.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 261, + "text": "240 \n \n(3) Programme of IOH & POH - Programme for IOH of machines and POH of \nselect machines should be prepared by Zonal Railways on the lines similar \nto POH i.e. firm for first year and tentative for second year by end of \nJanuary and sent to Railway Board for information and taking it into \naccount while finalising the targets for the Railw ays. Procurement action \nfor the requirement of 2 years shall be taken. \n(4) Planning of IOH – Proper advance preparation shall be done after survey \nof the machines to be overhauled. Items like engine top overhaul, renewal \nof pumps and motors and valves, changin g of tamping unit, tyre turning, \nattention to measuring system, attention to tamping units and brake etc. \nshould be planned during IOH. In addition, attention shall also be given to \nother items on condition basis as per repeated failures reflected in the \nlogbook. Normally, two IOH shall be done between two POHs. If IOH/POH \nat lesser interval is considered necessary, approval of the CE/TM should be \nobtained. Normally such instances will arise only if there are major \nstructural damages or cracks or major over haul of power packs or major \nmodifications are necessary. Heavy repairs of machines &overhauling of \nassemblies can be clubbed with POH/IOH. \n806 Satellite Depot - In addition to IOH workshop, Zonal R ailways will set up at \nleast one Satellite Depot in each division to meet the repairs and maintenance \nneeds of a fleet of machines. \n(1) Functions of Satellite Depot – The track machines shall be brought to \nthe satellite depots for repairs , which cannot be performed in the field \nas also for maintenance schedule of machines as specified in para 802. In \naddition, it shall also be used for need- based attention to tamping units, \ngear assembly, axle assembly and lifting, lining assembly and for unit \nexchange of assemblies and sub-assemblies not feasible in the field. \n(2) Facilities at Satellite Depot – Facilities at s atellite depot shall include \nstores for spares and consumable with facilities for housing the track \nmachines and carrying out the repairs, assembly and replacement of unit \ncomponents along with the offices for SSE and track machine officers. \nTypical list of infrastructural facilities like shed & structure, plant & \nmachinery, measuring/working tools including other miscellaneous \nequipment required for satellite depot shall be as per Para 809\n. \n807 Mobile Workshop- Cum-Transport Van - Each railway shall have m obile \nworkshops (road vehicles with necessary workshop facilities) in each zonal depot \nas well as in each satellite depot of adequate capacity to repair track machines, \nwhich are deployed all over the zone. \n(1) Functions of Mobile Workshop – The mobile workshop shall attend each \ntrack machine periodically, as required to cover s chedules II to V and \nbreakdown repairs. It will carry spares and consumables to be replenished.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 262, + "text": "241 \n \n(2) Facilities in Mobile Workshop – For this, sufficient inventory of spares and \ntools will be maintained in the van. The mobile workshop shall be provided \nwith well -trained staff who can handle repair of various systems. Mobile \nworkshop should be self -propelled covered van or on trailer unit mounted \non trolley, which can be pull ed by t ruck or any other road vehicle. Zonal \nRailways shall either procure the trucks and get these units fabricated or \nhire such units by inviting tenders. Typical facilities to be provide in a \nmobile workshop are given in Annexure 8.9. \n808 Camping Coach Workshop - One camping coach shall be provided with each \nmachine for accommodating machine staff. It shall be a coach modified and \nprovided with facilities for boarding and lodging of machine staff. It shall have \nnecessary cocking facility, toilets and bathrooms. \n(1) Functions of Camping Coach Workshop – The coach shall contain \nprovisions of small workshop for emergency repairs/store for material at \nsite also. These shall be manufactured or re -furnished as per the drawing \nissued by RDSO. It will cater for Schedules I, II, occasionally schedule III and \nemergency breakdowns. \n(2) Facilities in Camping Coach Workshop –The spares and equipment for \nminor repairs and daily usage shall be kept in camping coach. Typical list of \nequipment to be kept in camping coach workshop are given in Annexure \n8.10. \n809 Infrastructure Facility for Operation and Maintenance of Track \nMachines - Following facilities are necessary for day -to-day working and \nmaintenance of machines: \n(1) Infrastructural Facilities for CPOH, ZMD and Satellite Depot – Various \ninfrastructure facilities like shed & structure, tracks including pit lines, \nPlant & machinery (Test benches/work benches/Inspection & measuring \ntools/ working tools) and other miscellaneous equipment required for \nCPOH, ZMD and satellite depot are given in Annexure 8.4. \n(2) Storage and Carriage Facilities for Fuel and Oil – Special road mobile \nunit(s) to carry and distribute fuel, lubricants and hydraulic oils with \npumping arrangements shall be provided. The mobile van carrying fuel will \nhave to fulfil statutory safety standards in this regard. More than one unit \nmay be necessary for each satellite depot depending upon the number of \nmachine units to be catered for. Storage facilities may also be provided at \nselected locations for storing HSD oil required for day -to-day operations. \nOption of involving oil companies on the lines of RCDs can also b e \nconsidered. \n(3) Transportation of Spare Parts & Assemblies – Spare parts and assemblies \nare required to be transported by road. One or more road vehicles with \ncrane facility for loading/unloading shall be arranged at the z onal", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 263, + "text": "242 \n \nmaintenance depot and satellite depot, depending on requirement. Hiring \nwill be done if departmental vehicles are not available. \n(4) Communication Facilities – All JEs/SSEs shall be provided with voice and \ndata connectivity through CUG mobile SIMs. A walkie -talkie/VHF \ncommunication system should be available between the site of the work \nand the adjoining stations. Machine in- charge shall have two walkie -talkie \nsets to the frequency used by operating staff i.e. loco pilot, guard and \nstation master. Wh ere communication from mid -section to Engineering \nControl is available, such facility can also be used. Necessary Head \nmounted communication system (covering one ear only) shall also be \nmade available for communication during the actual work in machine lik e \nBCM, SBCM , T -28, TRT and TLE etc. The officers of Track Machines \nOrganization shall be provided with adequate communication facilities \nincluding STD and FAX at ZMD & SD. Each m achine shall be equipped with \na mini laptop & Data card facility for uploading the details in TMS. \n(5) Repairs and Stabling Facilities for Machines - In addition to sidings at SSE \n(P.Way)’s headquarters, siding of adequate lengths for stabling of t rack \nmachines & camping coaches shall be made available at stations about 10 -\n30 kms apart suitably distributed on UP and DN line side, depending upon \nthe number of lines, and availability of paths and the traffic. These sidings \nshall be provided with facilities of electricity (for lighting, welding & \ncharging etc. ), water supply, and space for storage of critical spares and \nconsumable to enable minor repairs to be carried out in the workshop of \nthe camping coach. Bio latrine or portable latrine should also be prov ided \nat resting sites. A typical sketch of stabling siding with facilities is shown in \nAnnexure 8.11. \n(6) Resting &Cooking Facilities for Staff - Rest house facilities shall be \nprovided, attached to each SSE/Sectional Engineer (P. way)'s office for \ntrack machine staff. One camp coach i.e. Workshop -cum-Rest Van shall be \nprovided with each track machine. As far as possible, TM sidings & rest \nrooms shall be at the same location. Camping coach shall be capable of \nbeing attached to the machine and also in train formation. List of \nequipment and facilities in this coach shall be in accordance with the \nstandard plans (Annexure 8.13, 8.14 & 8.15) issued by RDSO. \nArrangements for housekeeping & cooking in camping coaches & r est \nrooms shall be made either departmentally or by outsourcing. Typical \nlayout of track machine rest house is at Annexure 8.12. \n810 Camp Coach Facilities - The camping coach shall be provided with air \nbrake system. The coupling to be provided shall be normal I RS standard \nscrew coupling. The modification work for camping coaches shall be \nperformed in coach as per drawings enclosed as Annexure 8.13, 8.14 & 8.15 \nand the amenities shall be provided as per Annexure 8.16. Railways may", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 264, + "text": "243 \n \ndecide to have different drawing & amenities as per their local requirements \nwith the approval of PCE. Railway may convert selective cabin/cabins into \nAir-Conditioned cabin/cabins as per requirement. In this respect, electrical \ncircuit may be modified acco rdingly. Painting scheme for camp coach is given \nin \nAnnexure 8.17. \n(1) Living Area - The living area in the proposed layouts is marked as \n'X' \n(a) Additional roof ceiling ( false ceiling) shall be provided following \npreferably the same curvature of existing roof ceiling with \nminimum height of 2400 mm at centre, from floor level. This will \nreduce the heat in the coach.\n \n(b) Beds shall b e preferably provided at the level of lower berths as \nin 1st AC coaches. \n(c) The size of beds shall be 1850X850 mm and should be box type \nwith cushion as in 1stAC coaches. \n(d) The beds shall be boxed type and can be open in upward \ndirection to accommodate linen items etc .\n \n(e) Upper existing berths shall be removed . \n(f) In place of upper existing berths, wooden cabinets shall be \nprovided of size 1850x300x300 mm (approx.) above all the beds \njust below the false ceiling. Alternatively bunk beds may be \nprovided. \n(g) Flooring in this area shall be of same standa rd as in the 1stAC class. \n(h) Sofa, tables and chairs shall be provided as shown in the drawing. \n(2) Kitchen \n(a) Granite/marble top shall be provided on cooking platform (550 \nmm wide). \n(b) One of the existing water tanks of the coach shall be used for water \narrangement.\n \n(c) One exhaust fan shall be provided at suitable location. Chimney may \nalso be provided in the kitchen. \n(3) Bathing Area & Toilet \n(a) One of the existing water tanks of the coach shall be used for \nbathroom water arrangement. Complete bath fittings as available in \nAC 1\nst Class coach, shall be provided in bathing area. \n(b) The toilet shall be of 'bio -toilet' type being used in Indian Railways. \nIn this regard schedule of Tech. requirement no. C-9908 Rev.1 issued \nby RDSO may be followed as guidelines .", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 265, + "text": "244 \n \n(c) One exhaust fan each should be provided in the toilet, bathroom and \nkitchen area. \n(4) Electrification Plan \n(a) The electric supply arrangement shall be as in Annexure-8.18. \n(b) Battery blocks provided wi th the coach shall be utilized as it is, \nexcept the self -generating equipment and alternator. In place of \nthese, 230 V AC/110 V DC battery chargers will be provided for the \npurpose of charging of coach batteries. The coach electrification shall \nbe from following sources of supply. \n(i) Electricity may be obtained from outside supply available at \nRailway stations/sidings. \n(ii) A 3-phase 10 KVA silent DG set will be housed i n camp coach \nfor fulfilling requirement of electricity. \n(iii) In case of failure of batteries, there shall be the provision of 9 \nroof sunken CFL to be illuminated by AC supply. \n(iv) Solar panels on the roof with inverter may be provided to \npromote the use of renewable energy. \n(c) The electrical appliances/fittings to be provided in camp coach are \nbeing listed below: \n(i) Fluorescent lights roof sunken – 21 Nos. \n(ii) Brackets fans 225 mm – 17 Nos. \n(iii) Roof sunken lights (CFL-15W) – 09 Nos. \n(iv) Exhaust fan – 03 Nos. \n(v) Power point 15A – 02 Nos. \n(vi) Plug point – 02 Nos. \n(vii) Emergency lights – 04 Nos. \n(5) Store Management \n(a) Storeroom shall be provided, for keeping the small spares of the \nmachine, as shown in the camp coach layout. \n(b) This store shall be provided with cabinets/rakes at suitable height \nwith locking arrangement. \n(c) In addition to store given in coach l ayout additional under slung boxes \nshall be created for heavy spares of the machines. These boxes shall \nbe used for keeping empty drums, hydraulic hoses and heavy spares \nof the machine. The design of the boxes shall be accordi ng to the \nrequirement for particular machine. The safety factor for welding \nwork of the boxes shall be sufficiently high so that there shall be no \nfailure on account of welding work.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 266, + "text": "245 \n \nAnnexure 8.1 \nMaintenance Schedule of Track Machines \n(A) Schedule I to V \nGroup of \nMachines \nType of \nSchedule \nSchedule -I Schedule –II Schedule -III Schedule IV Schedule -V \nAll machines \nexcept RGM \nPeriodicity Daily 50 Hrs. 100 Hrs. 200 Hrs 1000 Hrs \nLocation TM Siding TM Siding TM Siding TM Siding SD/ZMD \nDuration One Hour Two hours 01 day 02 Days 07 days \nRGM Periodicity Daily 50 Hrs. 250 Hrs. 1000 Hrs 3000 Hrs \nLocation TM Siding TM Siding TM Siding TM Siding CPOH \nDuration 08 Hour 10 hours 12 hrs. 03 Days 10 days \n(B) Schedule VI (IOH) and VIII (POH) \nMACHINE OTHER THAN RGM FOR RGM \nSchedule \nType \nPeriodicit\ny (Engine \nhours) \nMachine Group – I (TLE, \nBRM, RBMV & UTV) \n(PCCM, DTS & TRT) \nMachine Group – II \n(WST-08-32, UNIMAT-\n2S &3S& HOT-CSM) \nMachine Group – III (HOT-\n3X & UNIMAT-4S) (BCM, \nSBCM) \nSchedu\nle Type \nPeriodicity \n(Engine \nhours EH) \nMachine Group IV \n(RGM) \nDuration Location Duration Location Duration Location Duration Location \nSchedule \n– VI \n(IOH) \n2000 (IOH) PCCM, DTS: \n21 Days, TRT: \n45 days and \nother 15 days. \nZMD 30 days ZMD For BCM/SBCM \n45 days. For \nothers 30 days \nZMD Schedul\ne – VI \n(IOH) \n6000 20 days CPOH \nSchedule \n– VII \n(POH) \n1st – 8000, \n2nd – \n14000 and \nthen at \n4000 \nFor TRT \n1st – 70 days, \n2nd – 90 days. \nFor Other \n1st – 45 days, \n2nd – 60 days \nZMD/ \nCPOH \n1st – 60 \ndays, 2nd \n– 75 days \nCPOH For BCM/SBCM \n1st – 90 days, \n2nd – 105 days. \nFor Other \n1st – 75 days, \n2nd – 90 days \nCPOH \nSchedul\ne – VII \n(POH) \n15000 or \n60 months \nwhich \never is \nearlier \n1st POH-\n45 \nDays 2nd \nPOH-60 \nDays \nCPOH", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 267, + "text": "246 \n \nAnnexure8.2 \n Formats for POH Planning \nRailway___________________ \ni) Details of M/c Proposed for POH during Current Year \nSN M/c No \nPropose\nd for \nPOH \nDate of \nLast POH \nEngine \nHrs Since \nLast POH \nCumulative \nprogress of \nM/c after \nlast POH \nGoverning \nreason for \nproposed POH \nEngine Details Probable date \nof sparing of \nM/c \nMake & Model No Engine Hrs since last \noverhauling \n \n \nii) Tentative List of Machines to be proposed for POH next Year \nS No M/c No Type of M/c Date of Last POH \n \niii) Demand for Tamping Units \nType of \nTamping Unit \nM/c No for which \nrequired \nMonth of \nRequirement \nCSM/WST \nUNI-3S \n09-3X \nUNI-4S \nVPR \nMPT", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 268, + "text": "247 \n \n Annexure 8.3 \nPOH Flow Chart \n \nArrival of machine \n Joint Survey \n Checking of ZF \n Placing in shed \nDismantling. Of all Sub- \nAssemblies \nCleaning & checking of \ndismantled components \nRepair of all Sub-\nAssemblies in their \nrespective sections \n \nFixing of Sub-\nAssemblies on M/c \nDeparture Tamping trial Testing & Calibration in Zero \nparameter track Shed \nReplacement of \nHoses \nRepair to sensing \nunits \nReplacement of \nPump, valves & \nmotor components \nReplacement of \nelect. components \nMACHINE", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 269, + "text": "248 \n \nAnnexure8.4 \nREQUIREMENT OF FACILITIES IN VARIOUS DEPOTS \nSN Description of items For POH capacity \nof 50TMUs per \nannum \nFor POH capacity \nof 24TMUs per \nannum \nIOH shed/ZMD Satellite Depot \n1. Cleaning Shed: This shed should be separate and outside the main POH shed \nto avoid pollution of dust, oil, grease etc. \nFor painting no separate area is needed as painting of the machine is carried \nout concurrently with the progress of rebuilding in the repair shed itself. \nGalvanised Aluminium /Aluminium sheet with thermal insulation layer and \nnatural drift exhaust system which will have 10- 15% translucent sheets in the \nroof shall be provided. \nPneumatic circuits with tapping arrangements at required locations shall be \nprovided. \nConcrete aprons of approx. 20 m length on either side of shed with hydrant \nand jet cleaning arrangement having proper drainage system including \nindustrial waste treatment plant/system is to be provided. \n50 m X 15 m \n(To have only one \nline with light shed) \n50 m X 15 m \n(To have only one \nline with light shed) \n50 m X 15 m \n(To have only one \nline with light shed) \n \n- \n2. POH & Repair shed: Each shed to have two EOT cranes of 10 Ton capacity \neach with EPU (epoxy polyurethane) flooring, inspection pits and grilled base. \nGalvanised Aluminium /Aluminium sheet with thermal insulation layer and \nnatural drift exhaust system which will have 10- 15% translucent sheets in the \nroof shall be provided. \nPneumatic circuits with tapping arrangements at required locations shall be \nprovided. \n3 Sheds of \n 100 m X 20 m with \n2 lines in each shed. \n2 Sheds of \n100 m X 20 m with \n2 lines in each \nshed. \n1 Sheds of \n100 m X 20 m with \n2 lines \n1 shed of \n50 m length x 20 m \nwidth with 2 lines", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 270, + "text": "249 \n \nSN Description of items For POH capacity \nof 50TMUs per \nannum \nFor POH capacity \nof 24TMUs per \nannum \nIOH shed/ZMD Satellite Depot \n3. Shed for sub -assemblies: For Gearbox, axle, Engine, hydraulic, \npneumatic, electrical, electronic and Lifting units sections with \nsuitable partition with air conditioning & test bench \nEach shed to have one EOT crane of 5 t capacity with EPU (epoxy \npolyurethane) flooring. \nGalvanised Aluminium /Aluminium sheet with thermal insulation \nlayer and natural drift exhaust system which will have 10 -15% \ntranslucent sheets in the roof shall be provided. \nPneumatic circuits with tapping arrangements at required locations \nshall be provided. \nOne shed of \n100 m X 20 m \nOne shed of \n 50 m X 20 m \nOne shed of \n 30 m X 20 m \n \n4. Shed for overhauling of 200 tamping unit: Each shed to have one EOT \ncrane of 5 t capacity with EPU (epoxy polyurethane) flooring. \nGalvanised Aluminium /Aluminium sheet with thermal insulation layer \nand natural drift exhaust system which will have 10 -15% translucent \nsheets in the roof shall be provided. \nPneumatic circuits with tapping arrangements at required locations \nshall be provided. \nConcrete aprons of approx. 20 m length with hydrant and jet cleaning \narrangement having proper drainage system shall be provided. \nOne shed of \n100 m X 20 m \nOne shed of \n100 m X 20 m \n-- -- \n5. Inspection Pit: Each depot will be provided with an inspection pit of \nlength given with proper drainage arrangement for examination of \nunder gears of machines \n \n60 m 60 m 60 m 20 m \n6. Rooms for inspection, JFT (Jig Fixture and Templates) & Rejected \nitems with proper storage/racks arrangements. \n4 rooms each of \nsize 8 m X 5 m \n4 rooms each of \nsize 8 m X 5 m \n2 rooms each of \nsize 8 m X 5 m \n- \n7. Store ward with proper storage/racks arrangements. 12 rooms each of \nsize 8 m X 10 m \n8 rooms each of \nsize 8 m X 10 m \n8 rooms each of \nsize 8 m X 10 m \nTwo room of size \n5 m x 7 m", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 271, + "text": "250 \n \nSN Description of items For POH capacity \nof 50 TMUs per \nannum \nFor POH capacity \nof 24 TMUs per \nannum \nIOH shed/ZMD Satellite Depot \n8. Open fenced space for stacking of release spares etc. 30 m X 30 m 20 m X 20 m 20 m X 20 m - \n9. Open fenced space for keeping of scrap 30 m X 30 m 20 m X 20 m 20 m X 20 m - \n10. Administrative block (FF): For officers’ chambers, office, visitor’s \nroom, model room, conference hall with all requisite facilities. \n100 m X 8 m 50 m X 8 m 50 m X 8 m - \n11. Administrative block (GF): Hall for SSEs, drawing cell, staff lunch room, \nchange room etc. (separate earmarked facility for lady staff) \n100 m X 8 m 50 m X 8 m 50 m X 8 m 5 m x 7 m \n12. Rest house - Adequate facilities for kitchen, dining and recreation \nshould be provided. \n2 suits for Officers, \n8 rooms for \nSupervisors & 32 \nbedded dormitory \nfor staff. \n2 suits for \nOfficers, 6 rooms \nfor Supervisors & \n20 bedded \ndormitory for \nstaff. \n6 rooms for \nSupervisors & 20 \nbedded \ndormitory for \nstaff. \n2 rooms o f size 4.5m \nx4.5 m for supervisor \nand staff \n13. Overhead water tank including bore well with standby bore well and \npumping arrangements. \n50000 Gallons \ncapacity \n50000 Gallons \ncapacity \n25000 Gallons \ncapacity \n10,000 gallon capacity \n14. Rooms for electrical installation/substation etc. 4 rooms each of \nsize 5 m X 5 m \n4 rooms each of \nsize 5 m X 5 m \n2 rooms each of \nsize 5 m X 5 m \n- \n15. Centralised compressor room One room of size \n5 m X 5 m \nOne room of size \n5 m X 5 m \nOne room of size \n5 m X 5 m \n- \n16. Boundary wall with barbed wire fencing enclosing the workshop \nhaving provision of CCTV cameras with watch towers, h igh mast \nlighting towers to cover entire workshop area. \nYes Yes Yes Yes \n17. Time office with electronic devices to control the entry/exit system, \nsecurity Check Post and provision of CCTV cameras for the purpose \nOne room of size \n3 m x 5 m \nOne room of size \n3 m x 5 m \nOne room of size \n3 m x 5 m \nOne room of size \n3 m x 5 m \n18. Test track having one line with suitable curvature 2 X 500 m with one \nPSC turnout \n2 X 500 m with \none PSC turnout. \n1 X 500 m with \none PSC turnout. \n1 x 150 m with 1 PSC \nturnout \n19. Calibration track with washable apron and light shed. Two tracks of 50 m \neach \nOne track of 50 \nm \nOne track of 50 \nm \nOne track of 50 m", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 272, + "text": "251 \n \nS. \nNo \nDescription of items For POH capacity \nof 50 TMUs per \nannum \nFor POH capacity \nof 24 TMUs per \nannum \nIOH shed/ZMD Satellite Depot \n20. Garage for housing road vehicles For 5 vehicles For 3 vehicles For 2 vehicles For 2 vehicles \n21. Cycle and Scooter shed Two nos. One no. One no. One no. \n22. Canteen Yes Yes Yes - \n23. Garbage disposal Pits Yes Yes Yes - \n24. Line for camping coach 250 m 250 m 100 m 50 m \nB. Plant & machinery - \nI. Test Benches \n1. Test bench for tamping unit with computer interface and data \nacquisition system. (Motor driven with optional system for engine) \n2 Set 2 Set 1 set - \n2. Hydraulic test bench (engine driven) with load testing facility with \ncomputer interface and data acquisition system \n1 Set 1 Set 1 Set - \n3. ZF test bench with computer interface and data acquisition system \n(engine driven) \n1 Set 1 Set - - \n4. Test bench for PCBs 1 No. 1 No. 1 No. - \n5. Test bench for pendulum and transducer 2 Nos 2 Nos. 1 No. - \n6. Test bench for sensors 2 Nos 1 No. 1 No. - \n7. Test bench for alternator and self starter 2 Nos 2 Nos. 1 No. - \n8. I.C. Tester 2 Nos 1 No. 1 No. - \n9. Pneumatic test bench 1 No. 1 No. 1 No. - \n10. Axle testing bench 1 No. 1 No. 1 No. - \n11. Oil seal tester for tamping unit section 4 Sets. 2 Sets. 1 Set. - \n12. Pinion shaft test bench 1 No. 1 No. 1 No. - \n13. Engine load testing machine 1 No. 1 No. - - \nII. Work Benches \n1. Work bench for gearbox assembly. 4 Nos. 2 Nos. 1 No. -", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 273, + "text": "252 \n \nSN Description of items For POH capacity \nof 50 TMUs per \nannum \nFor POH capacity \nof 24 TMUs per \nannum \nIOH shed/ZMD Satellite Depot \n2. Work bench for tamping unit assembly (CSM/UNI) 16 Nos 12 Nos. 2 Nos. - \n3. Work bench for tamping unit assembly (09-3X) 4 Nos. 2Nos. -. - \n4. Work bench for tamping unit assembly (UNI 4S) 4 Nos. 2 Nos. - - \n5. Work bench for ZF assembly 2 Nos. 2 Nos. - - \nIII. Inspection and measuring equipments \n1. USFD testing machine suitable for axle testing 1 Set 1 Set 1 Set - \n2. Pneumatic bore gauges for measurement up to 1 micron 2 Sets 1 Set - - \n3. Three dimensional (Coordinate) measuring machine 1 No. 1 No. 1 No. - \n4. Portable hardness tester 1 No. 1 No. 1 No. 1 No. \n5. Ring Gauge off size 2 Sets 1 Set 1 Set - \n6. Non contact thermometer 4 Nos 2 Nos 1 No 1 No. \n7. Z. F. mobile test kit 2Nos. 2 Nos. 1 No - \n8. Wheel diameter (700-1200 mm) measuring gauge (digital) 2Nos. 2 Nos. 1 No 1 No. \n9. Wheel profile gauge 2 Nos. 1 No. 1 No. 1 No. \n10. Surface roughness tester 1 No. 1 No. 1 No. - \n11. Rubber hardness tester 1 No. 1 No. 1 No. - \n12. Surface plate with V block 1 No. 1 No. 1 No. 1 No. \n13. Combination gauge 1 No. 1 No. 1 No. - \n14. Combination dial gauge 2 Nos 2 Nos - - \n15. Height gauge (0-500mm) 1 No. 1 No. 1 No. 1No. \n16. Thread gauge off size 4 Sets 2 Sets 1 set 1 set \n17. Feeler gauge off size 1 Set 1 Set 1 Set 1 Set \n18. Radius gauge off size 1 Set 1 Set 1 Set 1 Set \n19. Portable chrome coating thickness gauge 1 Set 1 Set 1 Set 1 Set \n20. Hydrometer 1 No. 1 No. 1 No. 1 No. \n21. Temperature gauge contact type 2 Nos. 2 Nos. 1 No 1 No", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 274, + "text": "253 \n \nS. \nNo \nDescription of items For POH capacity \nof 50TMUs per \nannum \nFor POH capacity \nof 24TMUs per \nannum \nIOH shed/ZMD Satellite Depot \n22. Noise level (dB) meter 2 Nos. 2 Nos. 1 No 1 No \n23. Vibration meter 1 No. 1 No. - - \n24. Tachometer (0-9999 rpm) contact type 1 No. 1 No. 1 No. 1 No. \n25. Tachometer (0-9999 rpm) contact less type 2 No. 2 No. 2 No. 1 No. \n26. LASER particle counter 1 No. 1 No. 1 No. - \n27. Injector Tester 1 No. 1 No. 1 No. - \n28. Precision inspection instruments i.e vernier calipers, micrometers, dial \ngauges, bore gauges & manual torque wrench, spanner sets \n4 Sets 2 Sets 2 Sets 1 set \n29. Nominated inspection gadgets as prescribed by OEMs i.e. CUMMINS, \nMWM, DEUTZ , PARKER, SKF etc. \n1 Set 1 Set 1 Set - \n30. Digital Multimeter 6 Nos. 4 Nos. 2 Nos. 1 No. \nIV. Working Tools \n1. Set of synchronized jacks upto 50 t capacity for machine lifting \n(Mechanical screw ) \n 3 Sets 2 Sets 1 set 1 Set \n2. Nominated assembly tools as prescribed for ZF 1 Set 1 Set - - \n3. Mechanized (Hydraulic) arrangement for lifting and removing heavy \nassemblies (Fork lifter) 2-5 t capacity. \n 4 Sets 2 Sets 2 Sets 1 Set \n4. Hydraulic power pack for testing (Operation of hydraulic tool) 2 Sets 1 Set 1 Set 1 set \n5. 10 t EOT cranes in POH shed 2 Nos. each shed= \n6 in total \n2 Nos. each \nshed= 4 in total \n2 Nos \n \n- \n6. 5 t EOT cranes in sub assembly shed 1 No. 1No. = 1 No. \n7. 5 t EOT cranes in tamping unit shed 1 No. 1 No. - - \n8. Mechanical tools, spanners 8 Sets 4 Sets 2 Sets 1set \n9. Pneumatic tools for assembly/ disassembly work 8 Sets 4 Sets 2Sets 1 set \n10. Hose crimping machine set for crimping of pressure, super hi-pressure \nand return hose assemblies of different size \n1No. 1No. 1No. -", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 275, + "text": "254 \n \nSN Description of items For POH capacity \nof 50 TMUs per \nannum \nFor POH capacity \nof 24 TMUs per \nannum \nIOH shed/ZMD Satellite Depot \n11. Power hacksaw machine 2 Nos. 2 Nos. 1No. - \n12. Circular saw for metal cutting 3 Nos. 2 Nos 1No. - \n13. Gas cutting equipment 5 Nos. 3 Nos. 2 Nos. 1 No. \n14. MIG (metal inert gas) welding Plant 2 Nos 1 Nos. 1 Nos. - \n15. Arc welding plant (DC) 8 Nos. 4 Nos. 2 Nos. 2 nos. \n16. Spray painting set with compressor 3 Sets 2 Sets 1 Sets 1 set \n17. High pressure Jet cleaning Machine 2 Sets 2 Sets 1 Sets 1 set \n18. D.G set for standby power supply 500 KVA 1 Set 1 Set 1 Set 250 KVA 1 set of 100KVA \n19. Freezing unit (Double compressor) up to (–) 50 degree 2 Sets 1 Set 1 Set 1 set \n20. Heating tank (Oil bath) 2 Sets 1 Set 1 Set 1 set \n21. Heating tank with auto temp cut-off (oil bath) 1 Set 1 Set 1 Set - \n22. Hydraulic press 50 t capacity 1 Set 1 Set 1 Set - \n23. Heavy duty mechanical jacks, pullers, pushers up to 50 t capacity 1 Set 1 Set 1 Set 1 set \n24. Milling machine (0-300 mm) 1 No. 1 No. - - \n25. Radial drilling machine (1.5 m height and 32 mm drill size) 1 No. 1 No. 1 No. - \n26. Radial drilling machine (1.5 m height and up to 20 mm drill size) 1 No. 1 No. 1 No. 1No. \n27. Lathe (3 ft.) 1 No. 1 No. 1 No. - \n28. Lathe (6 ft.) 1 No. 1 No. - - \n29. Lathe (12 ft.) 1 No. 1 No. 1 No. - \n30. Shaper Machine (0-300 mm stroke) 1 No. 1 No. - - \n31. Tool grinder (Rotary type 500 mm disc) 2 Nos. 2 Nos. - - \n32. Horizontal boring machine (2000 X 500 mm table) 1 No. 1 No. - - \n33. Centralized compressor (250 CFM) 1 No 1 No 1 No (100 CFM) 1 No (50 CFM) \n34. Portable filter 4 Nos. 2 Nos. 2 Nos. 1 No. \n35. Vertical boring machine 1 No 1 No. - - \n36. Wheel de-pressing and pressing machine 1 No. 1 No. - -", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 276, + "text": "255 \n \nSN Description of items For POH capacity \nof 50 TMUs per \nannum \nFor POH capacity \nof 24 TMUs per \nannum \nIOH shed/ZMD Satellite Depot \n37. Induction heater 2 Nos 2 Nos = - \n38. Induction type bearing removal unit (0-200 mm dia) 1 Set 1 Set 1 Set - \n39. Electrical crimping machine 2 Sets 2 Sets - - \n40. Hand riveting machine 2 Nos. 2 Nos. 2 Nos. 1 No. \n41. Pneumatic riveting machine 1 No. 1 No. 1 No. 1 No. \n42. Hot air blower 1No. 1 No. 1 No. - \n43. High Pressure cleaning chamber for tamping unit with water jet \nsystem \n1 Set 1 Set 1 Set - \n44. Accumulator nitrogen gas filling equipment 2 sets 2 sets 1 set 1 No. \n45. Hand drill 24V operated 1 No. 1 No. 1 No. 1 No. \n46. Hand drill 230V operated 1 No. 1 No. 1 No. 1 No. \n47. Pencil grinder 1 No. 1 No. 1 No. 1 No. \n48. Drill, reamers & tap set 4,6,8,10,12,14,16, 20 & 24 mm 1 Set. 1 Set. 1 Set. 1 No. \n49. Hose cutting machine 1 No. 1 No. 1 No. 1 No. \n50. Battery charger (12/24V) 2 Nos. 2 Nos. 2 Nos. 1 No. \n51. Desalination plant 1 No. 1 No. 1 No. - \n52. Soldering de-soldering unit 2 Nos. 2 Nos. 2 Nos. 1 No. \n53. Hot cleaning tank 1 No. 1 No. 1 No. - \n54. Wire thimble punching machine 1 No. 1 No. 1 No. 1 No. \n55. Torque wrenches (Elect or Pneumatic Control) 16 Nos. 8Nos. 8Nos. 1 No. \nIII. Miscellaneous \n1. Battery operated truck (2 t capacity) 1 No. 1 No. 1 No. 1 No. \n2. Material carrying van (1 t capacity) 1 No. 1 No. 1 No. - \n3. CC TV with camera web based covering complete shed & store 1 Set 1 Set 1 Set - \n4. P.A. System 1 Set 1 Set 1 Set - \n5. Intercom system (50 lines) 1 Set 1 Set 1 Set -", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 277, + "text": "256 \n \n \n \nSN Description of items For POH capacity \nof 50 TMUs per \nannum \nFor POH capacity \nof 24 TMUs per \nannum \nIOH shed/ZMD Satellite Depot \n6. Effluent treatment Plant 1 Set 1 Set 1 Set - \n7. Mechanized floor cleaning machine (Scrubber) 2 Nos. 2 Nos. 1No. - \n8. Release material handling hand trolley 4 Nos. 2 Nos. 1 No. 1 No. \n9. Light weight collapsible ladder with working platform \n(up to 10 m max height) \n1 Set 1 Set 1 Set - \n10. Industrial RO with water cooler of suitable capacity 2 Sets 1 Set 1 Set 1 No. \n11. Industrial Hooter 1 Set 1 Set 1 Set 1 No. \n12. Multi utility Vehicle (6 seater) 1 No. 1 No. 1 No. 1 No. \n13. Truck (10 t) 1 No. 1 No. 1 No. 1 No. \n14. Fire fighting system 1 Set 1 Set 1 Set - \n15. Turfer ( 5 ton capacity) 1 No. 1 No. 1 No. - \n16. Apron, Helmet, goggles, mask & safety shoes etc. 300 Sets 150 Sets 50 Sets 20 Sets \n17. Heavy duty industrial vacuum cleaner 2 Nos. 2 Nos. 1No. 1No.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 278, + "text": "257 \n \nAnnexure 8.5 \nMachine wise list of 'Masters' required for calibration of parameters \nSN Parameter to be calibrated Master \nRef \nRange of \nMaster CSM 09-3X WST UNI-2S UNI-3S DGS BCM FRM \n(A) Hydraulic System \n1 Squeezing Pressure PG-3 0-250 bar 100-120 bar 100-120 bar 100-120 bar 100-130 bar 100-130 bar N/A N/A N/A \n2 System Pressure PG-3 0-250 bar 140 bar 140 bar 140 bar 140 bar 140 bar 100 bar N/A 175 bar \n3 Vibration Pressure left PG-3 0-250 bar 150 bar 210 bar 180 bar 150 bar 150 bar N/A N/A N/A \n4 Vibration Pressure Right PG-3 0-250 bar 150 bar 210 bar 180 bar 150 bar 150 bar N/A N/A N/A \n5 Counter Pressure of Small \nSqueezing \nPG-3 0-250 bar 35-40 bar 55bar 35-40 bar N/A N/A N/A N/A N/A \n6 Counter Pressure of Big \nSqueezing \nPG-2 0-160 bar 140 bar 130 bar 140 bar N/A N/A N/A N/A N/A \n7 Accumulator Pressure 32L-1 PG-6 0-280 bar 85 bar 85 bar 85 bar 85 bar 85 bar N/A N/A N/A \n8 Accumulator Pressure 32L-2 PG-6 0-280 bar N/A 85 bar N/A N/A N/A N/A N/A N/A \n9 Accumulator Pressure 32L-3 PG-6 0-280 bar N/A 85 bar N/A N/A N/A N/A N/A N/A \n10 Accumulator Pressure 20L PG-6 0-280 bar 100 bar N/A 100 bar N/A N/A N/A N/A N/A \n11 Accumulator Pressure 10L PG-6 0-280 bar N/A N/A N/A 100 bar 100 bar 60 bar N/A N/A \n12 Accumulator Pressure 2.5 L-1 PG-6 0-280 bar 20 bar 20 bar 20 bar N/A N/A N/A N/A N/A \n13 Accumulator Pressure 2.5 L-2 PG-6 0-280 bar 20 bar 20 bar 20 bar N/A N/A N/A N/A N/A \n14 Accumulator Pressure 2.5 L-3 PG-6 0-280 bar N/A 20 bar N/A N/A N/A N/A N/A N/A \n15 Accumulator Pressure 2.5 L-4 PG-6 0-280 bar N/A 20 bar N/A N/A N/A N/A N/A N/A \n16 Accumulator Pressure 2.5 L-5 PG-6 0-280 bar N/A 20 bar N/A N/A N/A N/A N/A N/A \n17 Accumulator Pressure 2.5 L-6 PG-6 0-280 bar N/A 20 bar N/A N/A N/A N/A N/A N/A \n18 Accumulator Pressure 2.5 L-7 PG-6 0-280 bar N/A 140 bar N/A N/A N/A N/A N/A N/A \n19 Accumulator Pressure 2.5 L-8 PG-6 0-280 bar N/A 140 bar N/A N/A N/A N/A N/A N/A \n20 Pressure setting of Safety \nvalve for system Pressure \nPG-3 0-250 bar 175 bar 175 bar 175 bar 175 bar 175 bar 175 bar 210 bar 210 bar", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 279, + "text": "258 \n \nSN Parameter to be calibrated Master \nRef \nRange of \nMaster CSM 09-3X WST UNI-2S UNI-3S DGS BCM FRM \n21 Pressure setting of oil cooler \nmotor \nPG-3 0-250 bar 100 bar 210 bar 150 bar 150 bar 150 bar 150 bar 120 bar 200 bar \n22 High pressure setting PG-3 0-250 bar 150 bar 150 bar 180 bar 180 bar 180 bar N/A N/A N/A \n23 ZF oil pressure PG-5 0-30 bar 12-15 bar 12-15 bar 12-15 bar 12-15 bar 12-15 bar 12-15 bar N/A N/A \n24 Charging pressure of variable \npumps \nPG-5 0-30 bar 30 bar 30 bar N/A N/A N/A 30 Bar 30 bar 30 bar \n25 Work drive pressure PG-4 0-600 bar 0-210 bar 0-240 bar 160 bar N/A N/A 210 bar N/A N/A \n26 Satellite bypass pressure PG-3 0-250 bar 160 bar 160 bar N/A N/A N/A N/A N/A N/A \n27 Control pressure PG-2 0-600 bar N/A N/A N/A N/A N/A N/A 60 bar N/A \n28 Travel drive pressure PG-4 0-600 bar N/A N/A N/A N/A N/A N/A 0-380 \nbar \n0-380 \nbar \n29 Main conveyor pressure PG-4 0-600 bar N/A N/A N/A N/A N/A N/A 315 bar 315 bar \n30 Waste conveyor drive \npressure \nPG-4 0-600 bar N/A N/A N/A N/A N/A N/A 230 bar 315 bar \n31 Waste conveyor U/P pressure PG-3 0-250 bar N/A N/A N/A N/A N/A N/A 150 bar N/A \n32 Distributor drive pressure PG-4 0-600 bar N/A N/A N/A N/A N/A N/A 230 bar 315 bar \n33 Cutting chain drive pressure PG-4 0-600 bar N/A N/A N/A N/A N/A N/A 350 bar 350 bar \n34 Clutch pressure front PG-5 0-30 bar N/A N/A N/A N/A N/A N/A 15 bar 15 bar \n35 Clutch pressure rear PG-5 0-30 bar N/A N/A N/A N/A N/A N/A 15 bar 15 bar \n36 Chain guide left PG-4 0-600 bar N/A N/A N/A N/A N/A N/A 140 bar N/A \n37 Chain guide left PG-4 0-600 bar N/A N/A N/A N/A N/A N/A 140 bar N/A \n38 Rail clamp pressure PG-3 0-250 bar N/A N/A N/A N/A N/A N/A 160 bar N/A \n39 Chain tension pressure PG-3 0-250 bar N/A N/A N/A N/A N/A N/A 150 bar N/A \n40 Cutter bar lifting PG-3 0-250 bar N/A N/A N/A N/A N/A N/A 160 bar N/A \n41 Cutter bar locking PG-3 0-250 bar N/A N/A N/A N/A N/A N/A 160 bar N/A \n42 L/U up down PG-3 0-250 bar N/A N/A N/A N/A N/A N/A 160 bar N/A \n43 Ac drive PG-3 0-250 bar N/A N/A N/A N/A N/A N/A 120 bar N/A \n44 Screen unit vibration pressure PG-4 0-600 bar N/A N/A N/A N/A N/A N/A 390 bar 350 bar \n45 Screen tilting Pressure PG-3 0-250 bar N/A N/A N/A N/A N/A N/A 140 bar 175 bar", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 280, + "text": "259 \n \nSN Parameter to be calibrated Master \nRef \nRange of \nMaster CSM 09-3X WST UNI-2S UNI-3S DGS BCM FRM \n46 Distributor conveyor in/out PG-2 0-160 bar N/A N/A N/A N/A N/A N/A 50 bar 175 bar \n47 Excavating conveyor pressure PG-4 0-600 bar N/A N/A N/A N/A N/A N/A N/A 315 bar \n48 Hydraulic vertical load \npressure \nPG-2 0-160 bar N/A N/A N/A N/A N/A 20-10 bar N/A N/A \n49 Vibration pressure of \nvibration unit \nPG-4 0-600 bar N/A N/A N/A N/A N/A 350 bar N/A N/A \n50 Pre load pressure PG-2 0-160 bar N/A N/A N/A N/A N/A 60 bar N/A N/A \n51 Broom drive pressure PG-3 0-250 bar N/A N/A N/A N/A N/A N/A N/A 175 bar \n(B) Pneumatic System \n52 Pneumatic system pressure PG-1 0-10 bar 7 bar 7 bar 7 bar 7 bar 7 bar 7 bar 7 bar 7 bar \n53 Pneumatic intermediate \npressure \nPG-1 0-10 bar 4 bar 4 bar 4 bar 4 bar 4 bar 4bar 5 bar 5 bar \n54 Break pressure PG-1 0-10 bar 3.8 bar 3.8 bar 3.8 bar 3.8 bar 3.8 bar 3.8 bar 3.8 bar 3.8 bar \n55 Vertical preload pressure PG-1 0-10 bar 2 bar 2 bar 2 bar 2 bar 2 bar 2 bar N/A N/A \n56 Satellite brake pressure PG-1 0-10 bar 2,5 & 5.5 bar N/A N/A N/A N/A N/A N/A N/A \nElectronic System \n57 Cross level by front pendulum MM-1 N/A 25 mv/mm 25 mv/mm 25 mv/mm 25 mv/mm 25 mv/mm 25 mv/mm N/A N/A \n58 Cross level by middle \npendulum \nMM-1 N/A 25 mv/mm 25 mv/mm 25 mv/mm 25 mv/mm 25 mv/mm 25 mv/mm N/A N/A \n59 Cross level by rear pendulum MM-1 N/A 25 mv/mm 25 mv/mm N/A N/A 25 mv/mm 25 mv/mm N/A N/A \n60 Height transducer value MM-1 N/A 90 mv/mm 90 mv/mm 90 mv/mm 90 mv/mm 90 mv/mm 90 mv/mm N/A N/A \n61 Super elevation value MM-1 N/A 50 mv/mm 50 mv/mm 50 mv/mm 50 mv/mm 50 mv/mm 50 mv/mm N/A N/A \n62 General lift value MM-1 N/A 50 mv/mm 50 mv/mm 50 mv/mm 50 mv/mm 50 mv/mm N/A N/A N/A \n63 Versine value by lining \ntransducer \nMM-1 N/A 23.1 mv/mm 23.1 mv/mm 23.1 mv/mm 23.1 mv/mm 23.1 mv/mm N/A N/A N/A \n64 Versine value by measuring \ntransducer \nMM-1 N/A 23.1 mv/mm 23.1 mv/mm 23.1 mv/mm 23.1 mv/mm 23.1 mv/mm N/A N/A N/A \n65 Versine value by versine \npotentiometer \nMM-1 N/A 50 mv/mm 50 mv/mm 50 mv/mm 50 mv/mm 50 mv/mm N/A N/A N/A", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 281, + "text": "260 \n \n \n \n \n \n \nSN Parameter to be calibrated Master \nRef \nRange of \nMaster CSM 09-3X WST UNI-2S UNI-3S DGS BCM FRM \n66 Slew value by slew \npotentiometer \nMM-1 N/A 50 mv/mm 50 mv/mm 50 mv/mm 50 mv/mm 50 mv/mm N/A N/A N/A \n67 Tamping depth value MM-1 N/A 25 mv/mm 25 mv/mm 25 mv/mm 25 mv/mm 25 mv/mm N/A N/A N/A \n68 Engine oil pressure gauge \n(NTA) \nPG-5 0-30 bar N/A 0-10 bar 0-10 bar 0-10 bar N/A N/A 0-5 bar N/A \n69 Engine temp gauge (NTA) T-1 40-120⁰C N/A 40-120 \ndegree C \n40-120 \ndegree C \n40-12 \ndegree C \nN/A N/A 40-120 \ndegree C \nN/A \n70 Engine oil pressure gauge \n(KTA) \nPG-5 0-30 bar 0-10 bar 0-10 bar N/A N/A 0-10 bar 0-10 bar 0-5 bar 0-10 bar \n71 Engine temp gauge (KTA) T-1 40-120⁰C 40-120 \ndegree C \n40-120 \ndegree C \nN/A N/A 40-120 \ndegree C \n40-120 \ndegree C \n40-120 \ndegree C \n40-120 \ndegree C \n72 Vibration frequency Tachome\nte1 \n0-9999 \nr.p.m. \n2100 2100 2100 2100 2100 35 Hz N/A N/A \n73 Engine RPM-1 Tachome\nte1 \n0-9999 \nr.p.m. \n2100 2100 2100 2100 2100 2100 2200 2100 \n74 Engine RPM-2 Tachome\nte1 \n0-9999 \nr.p.m. \nN/A 1800 N/A N/A N/A N/A 2200 N/A \n Total no. of parameters \n \n37 46 33 28 29 23 32 22 \n Total no.of master required 9 9 9 6 6 9 8 8", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 282, + "text": "261 \n \nAnnexure 8.6 \nFormat for Master Calibration \nCode \nNo. \nLocation Custodian Name Of \nEquipment \n/ Device \nMake / \nModel \nRange Least \nCount \nFrequency \nOf \nCalibration \nCalibration \nAgency Inside \n/Outside \nDate Of \nCalibration \nNext Due", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 283, + "text": "262 \n \nAnnexure 8.7 \nFormat for Repair Summary sheet for POH \nMachine no…………. of………….. Railway, which arrived on ------------ at CPOH \nworkshop…………, was taken in hand for overhauling since -------------. The overhauling \nwork has been completed on --------------, and test runs and tamping were carried out \nfor ----- days/yet to be conducted. A ll performance indicators/gauges have been \ncalibrated/yet to be calibrated from masters as per Annexure 8.5. The performance of \nthe machine with regard to fitment of overhauled/new spares and all performance \nparameters have been found to be satisfactory. T he performance of this machine has \nbeen checked by Shri --------------------------------------------------------------------------------------\n----------, in-charge. In case of any major failure within 6 months. Sri -------------------------\n--------------------- SSE/CPOH machine in -charge for overhauling at CPOH shall visit this \nmachine. It will be the onus of officer in- charge of that machine, to timely intimate \nDY.CE/TMC/CPOH [+] for any such help. Performance pro -forma may please be sent \nback (duly filled up) after three months working. All testing of machine has been \ncarried out as per entire satisfaction of Shri ---------------------------------------------------------\n------------------------------------------------------- in his presence. Minor errors in the field of \nelectrical/electronic/mechanical during stabilization period is expected. Adjustment/ \nre-calibration/replacement of small components to be carried out at field. CPOH/ALD \nwill render all possible help wherever so required for any major failure. \n1. Details of POH: Details of New / Repaired /Reused spares are as per checklis t \njointly signed by undersigned. \n2. Release materials : Accountal of release material is as per checklist signed \njointly. \n3. Performance of following assemblies/spares are fixed on trial and its \nperformance is required to be recorded and feedback must be s ent to CPOH \nafter three months. \n4. List of missing spares of machine at the time of receipt of machine should be \njointly signed. \n5. Modification /Alteration /Deviation with original, carried out during POH should \nbe jointly signed. \n6. Special /Major repairs carried out during POH. \n \n \nSSE/ In-charge of Machine SSE/TMC/CPOH", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 284, + "text": "263 \n \n Annexure8.8 \nFormat for 90 Days Feedback of POH \n \nMACHINE TYPE AND NUMBER – ______________ \nRAILWAYS - ______________________________ \nDATE OF REPORT- _________________________ \n1-STATION:_______________________________________________________________ \n2-DATE SENT FOR POH:_____________________________________________________ \n3-DATE HANDED OVER TO ZONAL RAILWAY AFTER POH:___________________________ \n2-DATE OF START OF UTILISATION AFTER POH: __________________________________ \n3-TOTAL PROGRESS TILL DATE AFTER POH:____________KMS._______________POINTS. \n4- TOTAL DAYS MACHINE WORKED:___________________________________________ \n5- TOTAL DAYS BLOCK TAKEN:________________________________________________ \n6- TOTAL DAYS LOST DUE TO BREAKDOWN OF MACHINE:__________________________ \n7- Status of Section Wise Performance During POH: \n \nS .No. \nSection \n \nActivity \n \nTamping unit \nSection \nLifting unit \nSection \nElectronic \nGear Box \nWheel & Axle \nHydraulic \n \n \n \nPneumatic \nEngine \nGeneral \n1 Total days lost due to breakdown \nassembly wise \n2 Total no of failures in block \nsection \n3 Total time lost in block section \n(block time) \n4 No. of repeated failures \n5 \nPerformance of assembly \nafter 90 days working \n(fill 1,2,3,4 & 5 level of satisfaction) \n \nFor Sl. No. 5 \nOnly \n \n5 4 3 2 1 \n 100% 80% 60% 40% Less than 20%", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 285, + "text": "264 \n \n8- Feed Back of Trial Items: \n9. Details of major maintenance input given in last 90 days \n \n \n \n \n10. Suggestions if any \n \n \n \nCPOH Incharge SSE/Machine Incharge \n \n \n \n \n \n \n \n \n \n \n \n \n \nS. \nNo \nDESCRIPTION PERFORMANCE \n \nDATE OF FAILURE BRIEF DETAILS ABOUT \n THE FAILURE \nSatisfactory satisfactory \n1 \n2 \n3 \n4 \n5", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 286, + "text": "265 \n \nAnnexure 8.9 \nTypical Facilities to be provide in a Mobile Workshop \nSN Items Quantity \n1 Portable tent 1 \n2 Portable electric drill machine 1 \n3 Flexible shaft grinder 1 \n4 Bench grinder 1 \n5 DG set 10 KVA with welding plant 1 \n6 Gas cutting equipment 1 \n7 Work table -with bench vice 1 \n8 Tool kit 1 \n9 Lighting arrangement 1 \n10 First aid box 1 \n11 Heavy duty jacks, pullers, pushes up to 50 t capacity 1 set \n12 Multimeter 1 set \n13 Tachometer (contactless) 1 \n14 Small pay bars 2 sets \n15 Temperature meter digital (non contact type) 1 \n16 Reamers 8 \n17 Seals installation kits 1 set \n18 Bearing puller/pushers, presses 1 set \n19 Accumulator pressure checking and filling device PC-250 \ncomplete \n1 set \n20 Wheel defect gauge 1 \n21 Torque wrenches 1 set \n22 Magnetic base dial gauge 1 \n23 IC tester, relay tester, diode tester 1 \n24 O-ring cone 1 \n25 Gauge cum level 1 \n26 Pendulum calibration pads 1 set \n27 Versine measuring chord 1 \n28 Go-NO-Go gauge for tamping tynes 1 set \n29 Hydrometer 1 \n30 Set of masters required for machine calibration 01 set \n31 Off line filtration unit with contamination sensor 01 set \n32 Z.F. hydraulic test kit 01 set \n33 Temperature gauge (Non contact type) 01 set \n34 D spanner and ring spanner set 01 set \n35 Vernier calipers, micrometers and bore gauge 01 set \n36 Hot air blower 01 Nos \n37 Chain pulley 2 t block 01 Nos \n38 8mm wire rope sling 01 No \n39 Wooden block 10 Nos.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 287, + "text": "266 \n \nAnnexure 8.10 \nList of Equipment to be kept in Camp Coach Workshop \nSN Items Quantity \n1 Welding plant 1 \n2 Bench grinder 1 \n3 Bench vice and a work table 1 \n4 Portable drill machine 1 \n5 Tool kit 1 \n6 Portable filter 1 \n7 Portable crimping machine 1 \n8 Heavy duty jacks, pullers, pushers up to 50 t capacity 1 Set \n9 Hot air blowers 1 \n10 Multimeter 1 \n11 Accumulator pressure checking and filling device PC-250 \ncomplete 1 set \n12 Torque wrench 1 Set \n13 Versine measuring chord 1 \n14 Go-NO-Go gauge for tamping tynes 1 \n15 Steel scale 1\" to 6\" 1 Set \n16 Taper gauge up to 1\" 1 \n17 Feeler gauge 1 \n18 Thread gauge 1 \n19 Cell tester (battery voltage) 1 \n20 Battery charger 1 \n21 Inverter 1000 VA/roof mounted with solar inverter 1 \n22 Vernier caliper and normal calipers 1 set", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 288, + "text": "267 \n \nAnnexure 8.11 \n Typical Layout of Track Machine Siding \n 9. Roofing over 25m length to be provided full width of pathway", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 289, + "text": "268 \n \n Annexure 8.12", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 290, + "text": "269 \n \nAnnexure 8.13 \nLayout of Camping Coach(Based on RDSO Drawing no.CSC-1592", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 291, + "text": "270 \n \nAnnexure 8.14 \nLayout of Camping Coach(Based on RDSO Drawing no.CSC-1640)", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 292, + "text": "271 \n \nAnnexure 8.15 \nLayout of Camping Coach(Based on RDSO Drawing no.CSC-1686)", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 293, + "text": "272 \n \nAnnexure 8.16 \nAmenities to be provided in Camping Coaches \n \n \n \n \n \n \n \nS.No\n \nName of Item Qty. \nA. \n \nKitchen Area \n \n1 Fire extinguisher 02 nos. \n2 Commercial gas connection with double cylinder 01 set \n3 Four burner LPG gas stove 01no. \n4 RO+UV water purifier 01 no. \n5 Refrigerator-210 l capacity 01 no. \n6 Dinner set 01 no. \n7 Thermos 02 l capacity 02 nos. \n8 Gas lighter 02 nos. \n9 Presser cooker 5 l capacity 01 no. \n10 Presser cooker 3 l capacity 01 no. \n11 Casserole 10\" dia. 04 nos. \n12 Bhagona copper base as per required sizes 04 nos. \n13 Plate steel 12\" dia. 10 nos. \n14 Kadahee 02 nos. \n15 Spatula (karchhul) of various sizes 03 nos. \n16 Service spoon big 03 nos. \n17 Service spoon small 03 nos. \n18 Service bowl big 03 nos. \n19 Gripper 02 nos. \n20 Tea mug 12nos. \n21 Stainless steel spice box 01 no. \n22 Stainless steel container 2 l 06 nos. \n23 Stainless steel container for floor 15 l 01 no. \n24 Stainless steel container for rice 15 l 01 no. \n25 Stainless steel container for water 20 l 01 no. \n26 Stainless steel bucket 15 l 01 no. \n27 Hot chapatti case 02 nos. \n28 Sink 01 no. \n29 Stool for work 02 nos. \n30 Tea set 01 no. \n31 Tea strainer (stainless steel)-4\" 01 no. \n32 Teaspoon \n \n12 nos. \n33 Stainless steel utensil stand (wall hanging) 01 no. \n34 Stainless steel sauce-pan (copper base) 1 l 01 no. \n35 Hot plate iron (tawa) -12\"with handle 01 no. \n36 Pastry board (chakla) 10\" 01 no. \n37 Pastry roller (belna) 01 no. \n38 Fridge water bottle·1 l 6 no. \n39 Dustbin 01 no.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 294, + "text": "273 \n \n \n \nSL.NO. DESCRIPTION QUANTITY \n B. LIVING AREA \n1. LCD/LED television 28\". 01 no. \n2. Satellite antenna for TV (DTH) 01 no. \n3. 230VAC desert cooler or 4 nos. 1 ton AC unit 3 nos. \n4. Laptop 01 no. \n5. Foldable tubular chairs 06 nos. \n6. Folding tables 1000x500 mm. 03 nos \n7. Wooden centre Table 1000X500 mm. 01 no. \n8. Radio/audio player 01 no. \n9. Pillow Durafoam/Sleepwell 10 nos. \n10. Pillow cover 20 nos \n11. Curtain One each window \n12. Bed sheets (single bed} 20 nos. \n13. Mosquito net 10 nos. \n14. Woolen blanket (Raymond) 10 nos. \n15. Sofa One 3 seater as per the \nspace available \n16. Insulated water jug 10 l capacity 02 nos. \n \n \n \n \n \n \nC. BATH AREA \n1. Geyser 20 l capacity 01 no. \n2. Bucket 20 l capacity 06 nos. \n3. Mug 02 nos. \n4. Aluminium/stainless steel stool 02 nos. \nD. STORE \n1. Welding set 5 kva 01 no. \n2. Water lifting pump 02 nos.· \n3. Portable drilling machine 01 no. \n4. Portable grinding machine 01 no.· \n5. Diesel filling pump ' 01 no. \n6. Silent DG set 10 kva 01 no. \n7. Folding cot (single bed) 06 no", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 295, + "text": "274 \n \nANNEXURE 8.17 \nPaint Scheme for Camping Coach \n \n \n \n \n \n \n(Paint scheme for Camp Coach) \n1 Grid blasting One time \n2 Isophthalic putty One Coat \n3 Primer red oxide zinc chromate to IS 2074 One Coat \n4 Filler gray to IS 110 One Coat \n5 Knifing stopper (putty) to IS 5083 One time \n6 Wet rubbing One Coat \n7 Knifing stopper (putty) to IS 5083 One job \n8 Wet rubbing One job \n9 Necessary putty One job \n10 Wet rubbing One job \n11 Filler gray IS 110 One Coat \n12 Dry rubbing One job \n13 Under coat synthetic enamel IS 8662 One Coat \n14 Dry rubbing One job \n15 Finish coat, synthetic enamel to IS 8662 One Coat \n16 Glaze coat (1:1 mixture of synthetic enamel to IS 8662& \nsynthetic clear varnish to IS :524 \nOne Coat \n17 Lettering One job", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 296, + "text": "275 \n \n Annexure 8.18 \nElectric Circuit Diagram of Camping Coach", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 297, + "text": "276 \n \nCHAPTER 9 \nMANPOWER \n901 General - Manpower is the most precious and important resource for operation \nand maintenance of track machines. Skilled and trained m anpower is required to \nman sophisticated track machines for their optimal utilization. \n902 Requirement of Manpower \n(1) The scale of man power requirement for machine working is fixed for \nfollowing activities : \n(a) Field operation & maintenance. \n(b) Field supervision, technical and general services including repairs and \nmaintenance – at satellite depot and/or for fleet of machines. \n(c) Repair and maintenance – at zonal depot. \n(d) Repair & maintenance for POH – CPOH workshop. \n(2) The scale of manpower for activities (a), (b) & (c) above is given in Annexure \n9.1. Scale of manpower for CPOH workshop is given in Annexure 9.2. \n(3) While scale of manpower for activity (a) above has been laid down for each \ntype of machine separately, scales for other activities i.e. (b), (c) and (d) have \nbeen laid down based on track machine holding in terms of machine units. \nTrack machine holding is computed by multiplying number of machines by \nweightage factors for each type of machines, as given in Annexure 9.1. \n(4) As specified in Chapter 8, the POH of the machines may be carried out either \nat nominated CPOH w orkshops, or by entering into a contract with the \nmanufacturer or authorized service agents or the combination of the two . \n(5) It should be the endeavour of r ailways to ensure manning as per prescribed \nscale to ensure optimal utilization of machines . \n(6) Creation of additional manpower, based on scale, commensurate with \nprojected machine holding should be an annual exercise to ensure \ncommissioning and deployment of new machine immediately upon receipt \non Zonal Railways. \n903 Training - Training of officers, supervisors and skilled as well as unskilled staff is \nessential and important for proper operation and maintenance of modern and \nsophisticated track machines. \n(1) Officers- They shall undergo training course at IRICEN/Pune & IRTMTC as a \npart of the initial training. In addition, officers working in track machine \norganization shall undergo special courses on track machines conducted from \ntime to time by IRICEN, IRTMTC and OEMs. They shall also be exposed to \nfacilities available with OEMs in India as well as abroad. All officers shall be", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 298, + "text": "277 \n \nimparted hands -on training to learn basic operations of track machine at \nIRTMTC and Zonal Railways. \n(2) SSE/JE /TM(s) -They shall undergo initial course at the time of joining or after \nempanelment for the post of JE/TM from MCM/TMM as the case may be. \nThereafter, they shall undergo refresher course once in 3 years at IRTMTC. For \nknowledge relating to the operation and safety of working in the field, they \nshall take G&SR courses at zonal training centres initially and refresher courses \nonce in 3 years. Training facilities with OEMs and manuf acturers in India as \nwell abroad shall also be organized. They shall also be imparted training by \norganising special courses including that of establishment from time to time. \nNew appointees should be exposed to all types of machines available on the \nzonal railway as a part of their field attachment. \n(3) Technical Staff - All MCMs & TMMs working in the track machines \norganization shall undergo regular courses designed for different categories at \nIRTMTC/Allahabad and field training as specified. They shall undergo refresher \ncourses at IRTMTC every 5 years. \n(4) Machine Assistant- Those joining railway services directly (entry through \nRRCs) shall be given 2 weeks training on the lines similar to that of trackman. \nSuitable course plan shall be devised with liberal use of videos showing \nworking of track machines and safety aspects. \n904 Roster - Dynamic working roster has to be followed for working of track machines in \nthe field, based on availability of traffic blocks and requirements of the work site. The \nguiding principle shall be optimal utilization of machines and fixing the working hours \nof machine staff accordingly with the aim to keep the overall working time within \nprescribed duty hours as far as possible. Weekly or 3 weeks roster may be followed as \nper the requirement of the railway. \n(1) Weekly Roster- Roster of the staff working in track machine organization falls \nunder continuous classification as per HOER. The staff is rostered to work for a \nperiod of 6 days at a stretch followed by one day of rest. In respect to over time, \nthe staff will be governed by extant instructions under HOER in regard to the \nprinciple of averaging. \n(2) Three Weeks Roster- Staff working on track machines may be rostered to work \nfor a period of 3 weeks at a stretch followed by continuous rest for a period of \none week at headquarters. The three weeks continuous roster will include the \nactual period of journey under taken from head quarters to the place of work and \nback. The individuals shall not be employed for more than 12 hours on any day. \nIn respect to over time, the staff will be governed by extant instructions under \nHOER in regard to the principle of averaging as applicable to 3 weeks roster. The \nimplementation of three weeks roster shall be governed by exemption \ncommunicated by Railway Board from provisions of Railway Act 1989 from time \nto time. \n(3) Duty Hours for Field -The actual roster duty hours (timings) for staff working on", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 299, + "text": "278 \n \nvarious track machines in the field shall be decided by the Senior Divisional \nEngineer/Divisional Engineer; considering availability of traffic blocks/corridor \nblocks over the sections where the machines are deployed. The record of duty \nhours shall be maintained by engineering control and shall be conveyed to \nmachine staff. \n(4) Duty Hours for CPOH Depot, Zonal Depot & Satellite Depot - SSE/JE/TMs and \nother staff working in CPOH Depot, Zonal Depot & Satellite depot, shall have \nweekly roster only. \n(5) Duty Hours for HQ Office & Control –SSE/JE/TMs and other staff working in HQ \noffice, in HQ control, zonal depot control and satellite depot control shall follow \nthe working system of the respective offices/depot.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 300, + "text": "279 \n \nAnne xure 9.1 \nWeightage Factors for Track Machines and Yardsticks for Staff \n(1) Weightage Factors (Units) for Track Machines \nS.No.\n \nType of Machine Weightage \nFactor \n1 Tampers, Dynamic Track Stabilizer, Points & Crossing Laying \n \n1.0 \n2 Mobile Flash Butt Welding Plant 1.0 \n3 Tamping Express Dynamic 1.5 \n4 Ballast Regulator/ Utility Vehicle (Self Prope lled), RBMV \n \n0.8 \n5 Ballast Cleaning Machine and Shoulder Ballast Cleaning \n \n1.5 \n6 HOBCM (RM900) and HOSBCM 1.75 \n7 Track Relaying Train 3.0 \n8 Portal Crane, Muck Disposal Unit/ Tie Crane/ Rail threader \n \n0.5 \n9 Rail Inspection Vehicle 0.8 \n10 Rail Grinding Machine (16 stones/08 stones) and Switch Rail \n \n1.0 \n11 Rail Grinding Machine (72 stones) 4.5 \n12 Rail Grinding Machine (96 stones) 4.75 \n(2) Scale of Manpower for Field Operation & Maintenance: \nScale of field operation staff for each type of machine per shift is given in the \nfollowing table: \nS.No Name of Machine SSE(TM)/\nJE(TM) \nTrack \nMachine \nMaintain\ners \n(TMM) \nMachine \nAssistant \n(MA) \nCook Total \n(Exclu\nding \nCook) \n1 Plain Track Tamper \n(DUO/Worksite & CSM) \n2 3 3 1 8 \n2 Mobile Flash Butt Welding \nPlant \n2 3 3 Nil 8 \n3 Tamping Express \n(09-3X-CSM) \n2 4 4 1 10 \n4 Tamping Express Dynamic \n \n2 5 6 1 13 \n5 P&C Tamper \n(UNIMAT)/ Multipurpose \nTamper \n3 3 3 1 9 \n6 Dynamic Track \nStabilizer \n2 2 2 Nil 6 \n7 Ballast Cleaning \n Machines \n3 3 4 1 10 \n8 HOBCM (RM900) 3 4 6 1 13", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 301, + "text": "280 \n \n9 Shoulder Ballast Cleaning \nMachine \n3 3 4 1 10 \n10 HOSBCM 3 4 6 1 13 \n11 Ballast Regulating Machine 2 2 3 1 7 \n12 Track Relaying Train 6 8 14 2 28 \n13 Portal Crane (one No.)/ \nSpoil Disposal \nUnit/ Tie Crane/ Tie \nExchanger / Rail Lifting \nUnits/Rail Cum Road \nVehicles \n1 1 1 1 Per set \nof \nPortals \n(2 or 3 \nNos.) for \nTLE and \n \n \n \n3 \n14 P&C laying Machine (Two \nT- 28 Cranes + one Jib \nCrane) \n3 3 3 1 per \nSet of 2 \nT-28 & 1 \njib crane \n \n9 \n15 Utility Vehicle (Self \nPropelled), Rail Borne \nMaintenance Vehicle. \n2 2 3 1 7 \n16 Rail Inspection Vehicle 2 1 2 Nil 5 \n17 Rail Grinding Machine (16 \nstones/08 stones) \n3 4 3 1 10 \n18 Switch Rail Grinding \nMachine (20 stones) \n3 4 5 1 12 \n19 Rail Grinding Machine (72 \nstones) \n10 12 12 2 34 \n20 Rail Grinding Machine (96 \nstones) \n10 14 14 2 38 \n(3) Scale of Staff for Field Supervision, Technical & General Services \nfor Satellite Depot \n(a) Gazetted Posts \n(i) Junior scale/ senior scale posts for field supervision: \n• One post of junior/senior scale for each division for holding up \nto 12 machine units, \n• Two officers posts i.e. one senior scale and one junior scale are \nto be provided for divisions with more than 12 (twelve) units of \ntrack machines. \n(b) Non-Gazetted Posts - Staff requirement for field supervision, technical \nand general services including repair and maintenance shall be worked \nout on the following scale for a set of six track machine units or part \nthereof in each division/ satellite depot. Additional posts required in", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 302, + "text": "281 \n \nsatellite depot are mentioned in the note below the table. \nS.No Category Nos. \n1 SSE/JE/TM(s) \n2 \n2 MCMs &TMMs \n3 \n3 Track Machine Assistants 3 \n4 Store Clerk/ Material cha ser 1 \n \n \n \nTotal* (for a set of 6 Track Machine Units) \n \n9 \n* In addition one SSE/JE/TM shall be provided in to assist Engineering \ncontrol for monitoring and feeding of track machines progress in each \nsatellite depot. \n**In addition, minimum one Post of Sr. Loco Inspector/Loco Inspector \nshall be provided in each division for monitoring the staff working on \ntrack machines. Additional post of LI can be considered for a division \nhaving strength of SSE/JE/TMs of more than 40. \n(4) Scale of Staff for Repairs and Maintenance for Zonal Depot \nThe scale of staff for repairs and maintenance in zonal depots excluding POH is \nas under \n(a) Gazetted Posts- Yardstick for j unior scale, senior scale and j unior \nadministrative grade posts is as below. \n \n \n \n \n \n(b) Non–Gazetted Posts – Additional posts required in zonal depot and HQ \nare mentioned in the note below the table. \nS.No Category Machine \nunits > 75 \n50 to 75 \nmachine \nunits \n24 to 50 \nmachine \nunits \nUp to 24 \nmachine \nunits \n1 Track Machine supervisors \nSSE (/JE/TM(s) \n18 15 11 6 \n2 MCMs & Track machine \nmaintainers (TMMs) \n42 38 26 15 \n3 Track Machine Assistants 40 33 23 13 \nSN Category Junior Scale Senior Scale Junior \nAdministrative \nGrade \n1 Up to 24 Units of TMs 0 1 1 \n2 24 to 50 Units of TMs 0 1 1 \n3 50 to 75 Units of TMs 1 1 1 \n4 75 Units of TMs and above 1 2 1", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 303, + "text": "282 \n \n4 OS 1 1 1 1 \n5 Draftsman 1 1 1 1 \n6 Steno 2 1 1 \n7 DSK 1 1 1 1 \n8 Material Chaser 4 3 2 2 \n9 Watchmen 2 2 2 2 \n10 Store Clerk 1 1 1 1 \n11 Personnel clerk 1 1 1 1 \n Total* 111 98 70 44 \n* In addition 3 SSE/JE(TM) shall be provided for round the clock functioning \nof control office in each zonal depot as well as HQ office of the railway – \ntotal 6 SSE/JE/TM per Zone \nNotes for Para (2), (3) & (4): \n(i) Weightage factors as per para (1) shall be applied and units of track \nmachines calculated by multiplying number of each type of track \nmachine with the weightage factor. \n(ii) Posts of SSE/TM, JE/TM, MCM, TMM and MA shall be operated as \ncadre posts and the post of cook shall be operated as ex-cadre. \n(iii) The requirement of a cook for DTS shall be met with out of the \nprovision made for the machine to which these machines are \nattached. \n(iv) For all the above categories, additional requirements of l eave \nreserve (LR) @ 12.5%, rest giver (RG) @ 47% (for 3 weeks roster) \nand @ 16.5% (for weekly roster) & trainee reserve @ 4% shall be \nconsidered to work out total requirement. Satellite and zonal depot \nshall have 7 days working and RG shall be considered for these also. \n(v) Distribution and designation of individual posts in various categories \nshall be based on restructuring formulae and percentage \ndistribution of various types of grades applicable from time to time. \n(vi) The nomenclature of track machine maintainer covers all types of \nartisan staff required for operation and maintenance of machine.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 304, + "text": "283 \n \nAnnexure 9.2 \n Scale of Staff for Rep airs and Maintenance for POH - CPOH Workshop \nThe scale of staff for repairs and maintenance for POH in CPOH work shop is as under \n(1) Gazetted Posts \nAsst. Scale, Senior Scale and JA Grade posts for CPOH work shop: Yards tick for \nthis category of posts is as below: \n \nCategory JA Grade Sr.Scale Jr. Scale \n24 TMU per year 1 1 2 \n50 TMU per year 1 2 3 \n(2) Non- Gazetted Posts \nDetails of Non Gazetted staff for CPOH required in 24 TMU and 200 tamping \nunit and 50 TMU and 200 tamping unit are given in Annexure 9.3 and 9.4", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 305, + "text": "284 \n \n \nAnnexure 9.3 \nMan Power for POH of 24 Track Machine Units and 200 Tamping Banks \nSN Section SSE JE Technician Helper OS/Clerk Total \n1 Electronics section including \nrepair of panels, pendulum, \ntransducers and PCBs etc. \n1 - 4 3 - 8 \n2 Electrical section for \nrepairing of lights, self \nstarters, alternators, battery \nsection and testing etc. \n1 - 4 3 - 8 \n3 Hyd. pump, motors & valves 1 - 2 5 - 8 \n4 Hydraulic hoses - 1 2 5 - 8 \n5 Z.F. and other gear box \nsection - 1 2 5 - 8 \n6 Lifting unit 1 1 2 4 - 8 \n7 Pneumatic valves - - 2 3 - 5 \n8 Maintenance of plant \nmachinery - - 2 4 - 6 \n9 Quality control cell 1 - 1 3 - 5 \n10 Tamping bank overhauling \nsection 1 - 2 2 - 5 \n11 Machine shop - - 2 3 - 5 \n12 Drawing & design 1 - 1 - 2 \n13 Testing & calibration 1 1 4 6 - 12 \n14 Material management \nincluding store handling 1 1 - 4 - 6 \n15 Office - - - 2 6 8 \n16 Post POH site attention \n group - 1 4 4 - 9 \n Total 9 6 33 57 6 111", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 306, + "text": "285 \n \nAnnexure 9.4 \nMan Power for POH of 50 Track Machine Units and 200 Tamping Banks \nS.No Section SSE JE Technician Helper OS/ \nClerk \nTotal \n1 Electronics section \nincluding repair of \npanels, pendulum, \ntransducers and PCBs \netc. \n1 1 6 6 - 14 \n2 Electrical section for \nrepairing of lights, \nself starters, \nalternators, \nbattery section and \ntesting etc. \n1 - 6 6 - 13 \n3 Hyd. pump, motors \n& valves 1 - 4 7 - 12 \n4 Hydraulic hoses - 1 4 8 - 13 \n5 Z.F. and other gear \nbox section 2 1 3 5 - 11 \n6 Lifting unit - - 4 6 - 10 \n7 Pneumatic valves - - 4 6 - 10 \n8 Maintenance of \nplant & machinery 1 - 4 5 - 10 \n9 Quality control cell 1 - 2 3 - 6 \n10 Tamping bank \noverhauling section 1 - 2 2 - 5 \n11 Machine shop - - 4 4 - 8 \n12 Drawing & design 1 1 - 1 - 3 \n13 Testing & calibration 2 1 6 8 - 17 \n14 Material \nmanagement \nincluding store \nhandling \n2 1 - 7 - 10 \n15 Office - - - 4 6 10 \n16 Post POH site \nattention group 1 1 6 6 - 14 \n Total 14 7 55 84 6 166", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 307, + "text": "286 \n \nCHAPTER 10 \nSTORES AND CONTRACTS \n1001 Store Depot - Track machines of different types and models equipped with complex \nmechanical, hydraulic, pneumatic electrical and electronic systems have very large \nnumber of spares parts. An attached well -organized store depot is necessary for smooth \nfunctioning of the Zonal Machine Depot (ZMD) as well Satellite Depot (SD). It is desirable \nto have web based store management system. \n(1) Zonal store depot shall be under the charge of SSE/TM/ZDI assisted by DSK and a \nstore clerk. Zonal depot shall be the main depot for stocking of consumables, spares \nand unit assemblies. Diesel is generally arranged and managed by the division. \n(2) Stores depot attached with Satellite Depot shall be under the charge of SSE/TM/SDI \nassisted by s tores clerk and shall be for stocking of essential spares and \nconsumables. Adequate inventory of items should be available at satellite depot for \nabout one month consumption for carrying out various maintenance schedules of \nmachines working under the jurisdiction of s atellite depot. Apart from the above, \ncritical emergency spares of engines, tamping units, and heavy mechanical items of \nvarious machines are also important for expeditious attention to machines. The \nscale of spares at SD shall be fixed by Zonal Railway taking into consideration the \ngeographical locations and convenience of transport from ZMD. \n(3) Camping coach of each machine should have stock of consumables required for day \nto day maintenance of the machine. \n1002 Inventory Control \n(1) Pricing of Items and Consumption \nSSE/ZDI shall maintain record of spares and consumables procured for different \nmachines and their normal annual consumption. SSE/ZDI should maintain close \nliaison with the SSE/ZD and/or DSK to ensure that pricing of the materials is done \ncorrectly and that the prices are revised to keep them current from time to time. \nThis will ensure “cost consciousness” on the part of the supervisors. Upon \noperationalization of all modules of TMS, the rates shall be updated automatically \nfrom procurement module. \n(2) Estimated Annual Requir ements - The stock position, consumption trends and the \nestimated annual requirements should be reviewed periodically by AEN/XEN/ZD \nand estimated Annual Requirement shall be reviewed regularly. \n(3) Fast Moving Items - Fast moving items are those spares or consumables, which are \nrequired to be issued frequently. Any item requiring issue more than once in a week \nin ZMD regularly in last 6 months period can be termed as fast moving. A list of fast \nmoving spares should be prepared by the officer in- charge of the Zonal Depot as per \nfollowing proforma-", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 308, + "text": "287 \n \nS.No Date Items Required Stock Position in \nStores \nRemarks \n \nA monthly review of the consumption of fast moving items should be done at the \nzonal depot level. SSE/TM/ZD should maintain a record in which he should enter the \nstock position of materials affecting day -to-day working. This record will help the \nofficer in-charge to pinpoint the items to be dealt on priority. \n(4) Inactive Items \n(a) Dead storage items should be segregated i.e. items, which are not at all \nrequired in the foreseeable future due to obsolescence, change in design \netc. Such items may be circulated t o other zonal railways twice or kept on \nweb based software in surplus list for a period of one year. In case there are \nno takers, these items should be put up before the survey committee and \nsuitably disposed off following the provisions of stores code. Items, which \nare damaged due to storage, handling etc. should also be surveyed and \nsuitably disposed off according to the recommendations of the s urvey \ncommittee as per the provision of store code. \n(b) Items, which are not likely to be required in the near f uture on the railway, \nshould be offered to other railways and CPOH workshops. \n(c) Every endeavour should be made by the AEN/XEN/ZMD to utilize the \nexisting stock by making suitable modifications to the extent possible. \n(5) Control over consumption - The officer in- charge of the zonal d epot should identify \nand list out specific items other than those required in periodical maintenance \nschedules, for replacement of which the machine in- charge (SSE/JE/TM) will seek \napproval from the SSE/TM/ZMDI or SSE/TM /SDI; depending on under whose control \nthe machine is repaired. He will personally check the item before authorizing such \nreplacement. \n(6) Recoupment of Stock - The action for recoupment of an item should be initiated \nkeeping in view the lead period so as to h ave one year’s requirement in stock. \nWhenever procurement action is initiated, the following shall be ensured: \n(a) That the estimated annual requirement is worked out based on past three \nyears’ consumption. For the items for which last three years consumption is \nnot available, manufacturer’s recommendation or data from other railways \ncan be considered to arrive at the figure of average annual consumption. \n(b) That subsequent to a design change or modification done since the time of \nlast review, no obsolescence of the product has resulted. \n(c) Selective procurement possible in times of financial stringency, based on \nrealistic technical appreciation of the requirements. \n(d) For proprietary items, necessary proprietary article certificate duly signed by \nthe competent authority shall accompany the indents.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 309, + "text": "288 \n \n(e) Wherever required, indents shall be accompanied by detailed specifications; \ndrawings and list of firms duly approved by the competent authority. \n1003 Procurement of Consumables, Components and Spares \n(1) Purchase Powers - The officers of Engineering Department, dealing with track \nmachines at HQ as well as in Zonal and Satellite Depot, shall have the powers to \nprocure spares, consumables and small tools to meet the requirements of track \nmachines, as available to the officers of Stores Department in corresponding posts \n(PCE equivalent to COS, CE/TM equivalent to CMM, Dy. CE equivalent to Dy. COS \nand XEN/TM equivalent to SSO). \n(2) Purchase Rules - All rules and procedures as laid down for procurement by the \nStores Department, shall be followed by Engineering Department while exercising \npowers as per sub-para (a) above. \n(3) Tender Committee - The Tender Committee, wherever necessary, may be \nconstituted with the Engineering Officers of appropriate level as a convener and \nthe other members from Finance and Stores as per the schedule of powers \ndelegated on the Zonal Railways. \n(4) Imprest - Imprest ava ilable with t rack machine officials may also be utilized for \nprocurement of spares, consumables and small tools to meet specific \nrequirements of track machines. \n1004 Sourcing of Components & Spares and Procurement Procedure - Zonal \nRailway shall decide the source of procurement from among the following: \n(1) OEM or their Authorized Representative - Proprietary article certificate (PAC) \nduly signed by the competent authority shall accompany the indents. A rate \ncontract may be entered when number of items from a single source is \nsufficiently large to simplify and expedite the procurement process. This rate \ncontract may be entered on pattern of DGS & D rate contract with list of items \nalong their unit rate. No quantity, however, is required to be indicated against \neach item. The procurement against rate contract may be done for a period of 2 -\n3 years specifying annual financial ceiling. \n(2) Original Item/Component Manufacturers of High Repute in the Industry - These \nitem/unit component manufacturers are the ones having established reputation \nin the industries. These also include those from whom the OEM also sources the \nsupply for their machines. Spares like bearings and unit components like pumps \nare examples of such items/unit components. Procurement from them may be \ndone either through limited tenders if there are more than one sources or PAC if \nthere is only one source. Due care in establishing compatibility of \nitem/component should be expressed. \n(3) DGS & D Rate Contract – Officers of Track Machines Organisation in Sr. Scale and \nabove shall be designated as Direct Demanding Officers, and they can directly \nplace orders for items available in DGS & D rate contract. \n(4) Indigenous Sources - Following procedure shall be adopted", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 310, + "text": "289 \n \n(a) Zonal Railways shall classify the spares requ ired in various groups based \non the commonality of the manufacturing process or the source of \nsupply. \n(b) The groups can be formed broadly as given below: \n(i) Mild steel components. \n(ii) Alloy steel, heat treated and ground components. \n(iii) Grey iron castings alloy steel castings. \n(iv) Engine filters and other components. \n(v) Hydraulic filters. \n(vi) Hydraulic hoses. \n(vii) Pneumatic hoses. \n(viii) Seals and ‘O’ rings. \n(ix) Conveyor belts and conveyor chains. \n(x) Hydraulic cylinders. \n(xi) Hydraulic Pumps, motors, valves and other hydraulic \ncomponents. \n(xii) Printed circuit boards (PCBs). \n(xiii) Bearings. \n(xiv) Tamping tools. \n(xv) Tamping unit components. \n(xvi) Excavating chains. \n(xvii) Oils and lubricants. \n(xviii) Nuts/bolts and fasteners. \n(xix) Other consumables. \n(c) Items to be indigenized and whose local sources are available should be \nidentified and specifications and drawings should be got issued by RDSO. \n(d) The Railways shall maintain the list of approved suppliers of various \ngroups and important indigenous spares shall normally be procured from \nthe list of approved suppliers. The list should be uploaded on the website \nfor information of the other Railways. \n(e) The Railways shall periodically carry out the performance review of the \nlist of approved suppliers for various groups and take action to update the \nsame. Such performance reports shall also be made available on the \nwebsite along with other details like purchase orders etc. \n(f) During the stages of development or trial of new indigenous items or in \ncase there are issues with the quality of supply; procurement will be", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 311, + "text": "290 \n \nreverted from the proven sources or from OEMs. The idea is to avoid \nidling of costly machines. \n1005 Inspection and Acceptance of Materials - Inspection and acceptance of materials \nshall be done by the nominated official of Track Machine Organisation or as specified in \nthe contract. \n1006 Modes of Procurement, Repairs and Maintenance \n(1) Cash Imprest \n(a) Cash imprest of Rs. 5,00,000/ - or more shall be provided with the officer in -\ncharge of the Zonal Depot for emergency repairs and purchase of essential \nstores, including consumables, tools plants, and machinery, for day to day \noperation of machine. The objective is to ensure that costly machine (s) \nshould not idle for small amounts. \n(b) Cash imprest of Rs. 2,00,000/ - or more shall be provided with the officer in -\ncharge of satellite depot and in -charge of fleet of machines for emergency \nrepairs and purchase of essential stores, i ncluding consumables, tools plants, \nand machinery, for day to day operation of machine. The objective is to \nensure that costly machine should not be idle for small amounts. \n(c) A cash imprest of Rs. 5,00,000/- shall be provided with the officer in- charge \nof Ra il Grinding Machine for emergency purchase of essential stores, \nconsumables and for day to day repairs of tools, plants, and machinery, \n(d) The cash imprest available shall be reviewed on the Zonal Railways every \nthree years. \n(2) Emergency Repairs/Purchase - In addition to cash imprest, officers dealing with \ntrack machines shall be delegated financial powers for emergency repairs and \npurchase of spares, tools, plants and consumables to meet the emergent \nrequirements. GMs are fully authorized to delegate these powers to \nDy.CE/XEN/AXEN/TM(s) and Sr.DENs of the division and such powers are to be \nincorporated in SOP of Zonal Railways. \n(3) Annual Maintenance Contract (AMCs) - For proper upkeep and maintenance of \ntrack machines as also for trouble shooting and attending break -downs, it is \ndesirable to enter into AMC with OEM or their authorized agent(s) on single \ntender basis. AMC can be for the complete machine and/or the impor tant unit \ncomponents like engines. AMCs may also be invited from open market, \ndepending on the availabilities of agencies available with necessary expertise. \nWherever OEM or his authorized agent is not willing to come forward or his \nperformance is not satisfactory, open tenders may be called for AMC from open \nmarket or approved firms. Financial powers from AMCs are defined in the SOP of \nthe Zonal Railways. For machines taking up AMC for which no firms come \nforward, contracts for special repairs may be entered into. \n(4) Contracts other than AMCs - Planned repairs like overhauling of engines, \noverhauling of tamping banks, reconditioning of tamping tools, reconditioning", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 312, + "text": "291 \n \ntool arms, painting of machines, repairs to flooring /cabin etc., wiring, \nmodification of camping coaches, modification of BRNs, and such other works as \nnot covered under annual maintenance contracts are to be carried out on the \nlines of works contract under revenue or other heads as applicable. \n1007 \nCondemnation of Track Machine - Track Machines shall be condemned after \ncompletion of codal/useful life. Following procedure shall be adopted: \n(1) Executive in -charge of the track machine (Deputy Chief Engineer/Executive \nEngineer) will prepare a detailed report on the condition of the track machine and \nsend it to Zonal Railway headquarter. The rep ort must contain the following \ninformation: \n(a) Introduction. \n(b) Brief history. \n(c) Major defects recorded. \n(d) Probable cost of rehabilitation. \n(e) Present output per unit effective hour of work and quality of work. \n(f) Items proposed to be taken out for use as spares. \n(g) Financial justification for replacement, reconditioning or abandonment in \nterms of Annexure G (Para 240) of Finance Code Vol. I in case the machine \nhas not completed its codal life. \n(h) Recommendations. \n(2) A Committee of three SAG officers of the Zonal Railway s, one each from \nEngineering, Finance and Electrical Engineering will examine the report, and finalize \ntheir recommendations. They may choose to inspect the machine, if necessary. The \nnomination of the officers for the committee may be done in the form of a Standing \nCommittee on the Zonal Railways. \n(3) The recommendations of the SAG Officers Committee will be forwarded to Railway \nBoard, duly accepted by PCE/CE (Coordination). \n(4) After approval of Railway Board, the railways will be advised for condemning the \nmachine and write back the capital cost of the machine. \n1008 Codal life of machines and POH/IOH Frequencies - Codal life of different type \nof machines and frequencies of POH/IOH shall be as below: \nMachines Codal Life POH Schedule \nRail Grinding machines \n(RGM) \n15 years Every 15000 ERH or 60 months \nwhichever is earlier \nAll tamping machines i.e. \nDuomatic, CSM, Tamping \nExpress, MPT, UNIMAT etc. \n20 years 1st POH: 8000 ERH \n2nd POH: 14000 ERH \nAnd subsequent at every 4000 ERH or on \ncondition basis.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 313, + "text": "292 \n \n1009 Calculation of Unit Cost of Working of Different Track Machines - The \nfollowing procedure shall be adopted for working out unit cost of the machines: \n(1) Capital Recovery Factor – The unit cost of working shall be calculated taking \nCapital Recovery Factor (CRF) with interest rate of 12% from the tables in \nAnnexure-C of Indian Railways Finance Code (1982 Edition). CRF shall depend on \ncodal life of machine. CRF Values for 15 years, 2 0 years and 25 years codal life is \n0.14682, 0.13388 and 0.12750 respectively considering interest rate of 12%. \n(2) Codal Life of Machines –Codal life of the machine in terms of number of years of \neffective working and POH frequency is as stipulated in para 1008 above. \n(3) Proportional POH and IOH Cost – The IOH frequency of machine is @ 2000 ERH \nwhich allows IOH to be planned in between POH. For calculating unit cost of \nworking for CSM as shown in example below, 2 POHs have been considered at \n8000 ERH and 1400 0 ERH and 7 IOHs have been considered at 2000, 4000, 6000, \n10000, 12000, 16000 and 18000 ERH. The per annum proportional POH/IOH cost \nhas been worked out by equal distribution of total cost over the lif e of machine \ntaken as 20 years. \n(4) Fixed and Variable Cost – Unit cost of machine shall comprise of two components \nnamely fixed cost (FC) and variable cost (VC). Fixed c ost comprises of capital \nrecovery factor (CRF) and staff cost. The v ariable cost will comprise of \nproportionately distributed POH/IOH expenditure and actual expenditure on \nspares and consumables. Expenditure on POH and IOH shall be considered based \non average of past figures for similar vintage machines. While fixed cost shall be \ncalculated on duration basis (per day or part thereof), variable cost shall be \nworked out on basis on actual work done in respective units like kms or number of \nturnouts. \n(5) Working and Approval of Unit Cost – Unit cost of working for different types of \nmachines shall be worked out at the end of every financial year. Unit cost \nMachines Codal Life POH Schedule \nBallast screening machines \nBCM, SBCM, Ballast \nRegulating machines etc \n20 years 1st POH: 8000 ERH \n2nd POH: 14000 ERH \nAnd subsequent at every 4000 ERH or on \ncondition basis. \nTrack renewal machines \nlike TLE, TRT, Points and \nCrossing changing \nmachines, Dynamic Track \nstabilizer. \n20 years 1st POH: 8000 ERH \n2nd POH: 14000 ERH \nAnd subsequent at every 4000 ERH or on \ncondition basis. \nMaterial handling machines \nUTV, RBMV \n25 years 1st POH: 8000 ERH \n2nd POH: 14000 ERH \nAnd subsequent at every 4000 ERH or on \ncondition basis.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 314, + "text": "293 \n \nstatement shall be approved by CE/TM. This tentative unit cost rate for purpose of \nestimation for a year will be calculated by assuming 7% escalation over calculated \nunit cost of previous year. \n Example 10.1 Unit Cost of Tamping Done by CSM – \n(a) Data : \ni) Initial cost of the machine : Rs. 13.50 Crore \nii) Rate of interest : 12% \niii) Life of machine : 20 years \niv) Expenditure on IOH ( each) : Rs. 30 lacs \nv) Expenditure on POH (each) : Rs. 125 lacs \nvi) Annual expenditure on machine (VC) \nSpare (actuals) : Rs. 16 lacs \nConsumables (actuals) : Rs. 24 lacs \nvii) Annual Staff expenditure (FC) : Rs. 35 lacs \nviii) Staff Overheads (Proportionate) (FC) : Rs. 8.75 \nix) Average yearly engine hours : 1000 ERH \n(b) Annual Cost of Working: \n- Actual tamping done in the year : 500 km \n- Life of machine : 20 years \n- CRF (Capital Recovery Factor) : 0.13388 \ni) Capital recovery (FC) : Rs.1,80,73,800 \nii) Proportional exp. on POH/IOH(VC) : Rs.23,00,000 \n IOH / POH (7 x 30 + 2 x 125) Lakhs \n 20 \n(c) Annual Fixed Cost \ni) Capital Recovery Factor : Rs.1,80,73,800 \nii) Staff expenditure : Rs 43,75,000 \n TOTAL FIXED COST Rs.2,24,48,800 \n FIXED COST PER DAY Rs. 61504 (F) \n(d) Annual Variable Cost \ni) Cost of spares : Rs. 16,00,000 \nii) Consumables : Rs. 24,00,000 \niii) POH/IOH : Rs. 23,00,000 \nTOTAL VARIABLE COST Rs. 63,00,000", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 315, + "text": "294 \n \nVARIABLE COST PER KM Rs. 12,600 (V) \n Unit Cost - Explained: \nUnit Cost shall be worked out in terms of Fixed cost per day (or part thereof) (F) and \nVariable cost per Km (V) \nSuppose a CSM works 2 km on a day, the total cost of Tamping will be \nFixed cost for one day = Rs. 61,504 \nVariable cost for 2 Kms = 2 x 12,600 = Rs. 25,200 \n Total Cost of work for a day = Rs. 86,704 \n Cost per km of tamping on that day = Rs. 43,352 \n Unit cost for the work shall be computed on basis of progress of work in kms and \nnumber of days machine made available for work. Days taken in shifting shall be \ncharged based on the act ual. Thus , the jurisdiction which moves the machine \nexpeditiously would save expenditure. When machine is moved for other non-\ndivisional units like construction and other agencies work, the days in transit for the \nnon-divisional units shall be charged to that unit.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 316, + "text": "295 \n \nCHAPTER 11 \nMONITORING \n1101 GENERAL - Track machines, being capital- intensive assets need track possession \nfor working and shall be monitored on day -to-day basis at the level of d ivision and \nheadquarters. Both aspects of monitoring i.e. d ata collection & entry and \ngeneration of alerts/reports have to be meticulously done to reduce the response \ntime and ensure optimum utilization of track machines. In addition, a system of \nperiodical meetings at different levels is required for bringing to fore the issues \naffecting the smooth functioning of track machines and its organization and to \ngenerate solutions to the issues. These interactions will also serve to have finger on \nthe pulse of the organization. \nIt is desirable to design TMS module keeping in mind above aspects so that relevant \nreports reach the concerning officials in the hierarchy at pre -decided times \nperiodically. \n(1) Data Collection & Entry - This shall consist of creation of data for the \nfollowing \n(a) Machine details. \n(b) Section wise availability of corridor blocks for each day of the week. \n(c) Manpower, their deployment and various competency certificates. \n(d) Target and deployment programme. \n(e) Daily machine utilization – duty hours, movement, block working and \nprogress and important machine parameters. \n(f) Maintenance schedules including IOH and POH details, failures and \nrepairs etc. \n(g) AMCs and other contracts, visits of service engineer. \n(h) Procurement of spares and consumables. \n(i) Issue and utilization of spares and consumables. \n(j) Details of unit assemblies and costly components like engines, tamping \nbanks etc. \n(k) Inspections at various levels. \n(l) Frequency of maintenance operations like tamping, deep screening etc. \n(m) Costing of procurement of spares, consumables, maintenance, repair and \noperations. \nData collection, entry an d validation of different sets of data shall have \nauthorization at various levels i.e. machine in -charge, engineering control in \nthe division, satellite depot, zonal machine depot& its control, zonal \nheadquarter & its track machine control and railway board. Scrutiny of data", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 317, + "text": "296 \n \nentered, validation and authority for corrections at different levels has also to \nbe designed so as to be an integral part of the data entry. \n(2) Generation of Reports and Alerts – The working of track machines shall be \nmonitored by generation of various reports including exception reports and \npredefined alerts through software. This would consist of generation of - \n(a) Periodical Reports – Daily, weekly, monthly, yearly reports with an option \nof user specified period for a specific machine or machines types, for the \njurisdiction of a SSE/AEN/DEN/division etc. including comparative \npositions for corresponding periods of previous spells/yea rs. It should be \npossible to select the machines. \n(i) Stipulated and actual progress in tabular and graphical form. \n(ii) Blocks stipulated, demanded, granted and availed. \n(iii) Blocks granted within the specified corridor and outside the \ncorridor. \n(iv) Position of AMCs and other contracts. \n(v) Maintenance and other schedules including IOH & POH and down \ntime analysis. \n(vi) Utilization of consumables i.e. diesel, lub e oil, hydraulic oil, grease \netc. \n(vii) Utilization of spares and that of fast moving spares. \n(viii) Unit assembly and costly components. \n(ix) Expenditure on items like consumables, spares, unit assemblies, \nstaff for operations, for spares and for depot working, IOH, POH \netc. \n(x) Inspections in tabular and graphical form. \n(xi) Training details. \n(xii) Manpower detailed reports including medical and other \ncompetencies. \n(xiii) Costing per unit of work (fixed cost and variable costs). \n(xiv) Movement of machines – Intra and inter -divisional movement of \nmachines as also inter railway movement. \n(xv) Health related data, service engineer visit details etc. \n(xvi) Deep screening chart and overdue deep screening chart. \n(xvii) Tamping chart and overdue tamping chart. \nThe module shall be so designed to get these reports, machine wise, \nmachine type wise, unit wise, division wise, and railway wise.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 318, + "text": "297 \n \n(b) Exception Reports for Management and Control at Various Levels \n(i) Data not entered (of different types like progress, mainten ance \netc.). \n(ii) Machines not available for work (for different reasons like \nschedule maintenance like IOH, POH, unit replacement, repair, \nmovement etc.). \n(iii) Machines available but not worked (for different reasons like block \nnot given, site not ready, track material not available, labour/staff \nnot available, holiday, rest etc.). \n(iv) Overdue of maintenance operations like tamping, deep screening \netc. \n(v) Overdue maintenance schedules of machines. \n(vi) Manpower issues such as overdue PME, refre sher, competency, \nroad learning. \n(vii) Repeat tamping or deep screening within user specified period. \n(c) Alerts on the Home page of TMS and/or Mobile based on Pre- decided \nTrigger Conditions \n(3) Periodical Meetings – Periodical review of t he different aspects of machine \nworking at appropriate levels is essential for keeping tab on the field situation \nand in turn for the proper functioning of system and to keep the staff \ninformed and motivated. \n(a) Regular Meetings - shall be held at Zonal Depot/HQ level to monitor \nday-to-day progress, impediments etc. Daily meeting shall also be held \nat field level between machine staff and P. Way staff to avoid any \ncommunication gap and ensure quality work by the machines. It will also \nbe useful to conduct pre -work inspection of work site by SSE/JE/TM, \nSSE/P.Way, SSE/TRD and SSE/S&T, as per need of the work. \n(b) Review Meetings \n(i) Fortnightly meetings of SSE/TM/I and machine staff with SSE/TM/SDI \nor SD (who is in -charge of fleet of machines) with his concerned staff, \nif any for the purpose of discussing about the health of the machine, \nfailures of machines, safety issues etc. SSE/TM /SDI or SD will mostly \nhold these in the field generally during the field inspection. \n(ii) Monthly review meeting of SSE/SDIs with ZMD officials and \nrespective AEN/TM/Lines with Dy.CE/TM/Line. Various issues of \nhealth of machine, progress, quality of work, failures , spares, \nconsumables, staff, safety etc. will be discussed in this meeting, \n(iii) Quarterly meeting of Dy.CE/TM/Line and AEN/TM/Lines with CE/TM. \nVarious issues of health of machine, progress , quality of work, \nfailures, spares, consumables, staff, safety e tc. will be discussed in", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 319, + "text": "298 \n \nthis meeting. The planning for AMC’s, procurement of spares, other \nproposals, infrastructural facilities, camping coaches etc. shall also be \ndiscussed. \n(iv) Periodic meetings should also be held by CE/TM and Dy .CE/TM with \nDRM and divisi onal officers of different departments as per the need \nand also at Zonal HQ with traffic officers to get co -operation for \nensuring blocks, joint working, quality and progress of work. \n1102 Organization for Monitoring - The offices of satellite depot , z onal \nmaintenance depot and HQ will have a system of control set ups for data entry and \ncommunication of information for monitoring the working of the track machines. All \nthese controls will function 24x7 as machines work in the field 24x7. \n(1) Track Machine Control at Headquarters – The track machine control office in \nthe headquarter of railway shall function under the administrative control of \nJA Grade/Sr.Scale officer of the Track machine o rganization to have command \nand control over the units in the divisions and Zonal depot. This control office \nshall be manned round the clock on all 7 days of the week by staff not lower \nthan Junior Engineer with suitable roster. EI roster shall be followed for the \ncontrol staff. The control office shall be provided with railway telephone with \nSTD facilities, DOT landline telephone with STD facilities, a fax machine, CUG \nmobile connection with smartphone instrument for effective communication \nwith connected offices. A PC with printer and Internet connection (with wi -fi) \nfor feeding of various details and monitoring, printing reports through TMS, as \nwell as other than TMS, shall also be made available. \n(2) Track Machine Control at Zonal maintenance Depot (ZMD) Level – The track \nmachine control office in the zonal maint enance depot shall function under \nthe administrative control of JA Grade/Sr. Scale officer in-charge of the d epot \nto co-ordinate with headquarter and other divisions, as also with the satellite \ndepots and track machines in- charges. This control office shall be manned \nround the clock on all 7 days of the week by staff not lower than Junior \nEngineer with suitable roster. EI roster shall be followed for the control staff. \nDivisional control office shall be provided with Railway telephone with STD \nfacilities, D OT landline telephone with STD facilities, a fax machine, CUG \nmobile connection with smartphone instrument for effective communication \nwith connected offices. A PC with printer and Internet connection (with wi -fi) \nfor feeding of various details and monitoring, printing reports through TMS, as \nwell as other than TMS, shall also be made available. \n(3) Divisional Control – The day to day planning for deployment of machines, \narranging blocks for the machines, monitoring progress of the machines and \nco-ordination with other departments for effective utilization of machines will \nbe done by e ngineering control of the division. The present set- up of \ndivisional control will serve this function, augmented by staff from track \nmachine organization as required.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 320, + "text": "299 \n \n(4) Satellite Depot ( SD) – An effective mechanism for SD to closely liaison with \ntrack machine in -charges and ZMD shall be put in place. Since the ZMD/SD \nhave to respond on real time basis for any failure, breakdown etc., the \nofficials shall have direct and real- time interaction with machine -in-charges \nand with ZMD and also with SD of other divisions of the zone. SD shall be \nprovided with r ailway telephone with STD facilities, DOT landline telephone \nwith STD facilities, a fax machine, CUG mobile connection with smart phone \ninstrument for effective communication with connected offices. A PC with \nprinter and internet connection (with wi -fi) for feeding/validating details and \nmonitoring, printing reports through TMS, as well as other than TMS, shall \nalso be made available. SD shall h ave a nominated official in the morning shift \nfor liaison with zonal depot and machine in-charges. \n1103 Functions of Divisional Control in respect of Track Machines \n(1) Advance planning of the daily machine works to be done. \n(2) Monitoring of grant of blocks for the machines. \n(3) To co-ordinate between the different departments in the control, machine in -\ncharges, SD, ZMD as required; for effective utilization of machine. \n(4) Regular communication with engineering officers of the division. \n(5) Monitoring the work during the block fo r any unusual incidents and real -time \nreporting to the officials concerned. \n(6) Collecting the daily progress details (block hours, time of important events \nfrom machine being given ready to machine stabled in siding, location of \nwork, break-up of time consumed in different operations in the block, output \netc.) duly reconciled with SSE/P.Way and SSE/JE/TM along with reasons for \nless progress, if any. \n(7) Entering and validating t rack machine progress into TMS by SSE/J E/Control in \nthe division through specific login id in addition to other entries. \n(8) Detention to traffic if any, and other factors, affecting train movement on \naccount of working of machines. \n(9) Monitoring movement of track machines within the division including \nmachines of other Zonal Railways. \n(10) Recording details of failures of machine, if any and getting failure reports. \n1104 Functions of Track Machine Control at ZMD Level - The main functions of \ntrack machine control at ZMD level shall be: \n(1) Communication link between the machine in- charges, divisional control, \nsatellite depots and headquarter. \n(2) Co-ordination for issues related to deployment of manpower etc. on \ndifferent track machines. \n(3) Co-ordination for deployment of machines as per the programme issued.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 321, + "text": "300 \n \n(4) Co-ordination for movement of machine for deployment, major schedules \nlike POH, IOH, replacement of major components and assemblies and \nrepairs to be done in sheds. \n(5) Co-ordinate to ensure expeditious movement of spares for repairs. \n(6) Coordination for deputation of service engineer of OEM etc. \n(7) Obtaining and recording the details of unusual incidents and reason s \naffecting machine utilization. \n(8) Getting failure reports from the machine in-charges. \n(9) Regular interaction with HQ control in respect of above. \n(10) Providing feedback to HQ control regarding unusual , breakdown of \nmachines etc. in real time. \nThe information collected by the t rack machine control and instructions given \nshould be recorded comprehensively in a logbook, which shall be scrutinized by the \nofficials to ensure effective functioning. \nThe functions of ZMD control have to be dovetailed in the TMS module for track \nmachines. \nThe systems evolved in different railway for distribution of roles and responsibilities \nbetween the HQ, ZMD, SD and divisional control may differ and will not be \ndisturbed or modified if functioning satisfactorily. \n1105 Functions of Track Machine Control at Headquarter Level - The main \nfunctions of track machine control at headquarter level shall be: \n(1) Ensuring feeding of track machine details including daily progress into TMS by \nrespective officials at different levels and divisional controls. \n(2) Contacting the Divisional Controls for obtaining and recording the details of \nunusual incidents and other reasons affecting machine utilization. \n(3) Authorizing shifting of machines from one division to other. \n(4) Monitoring of unusual, failures and block bursting and recording assistance \nrequired. \n(5) Coordinate with Railway Board TMS cell for commissioning of new \nmachines/shifting of machines to other Railways. \n(6) Monitoring deployment of the machines in the field as per the approved \nprogramme and bringing the deviations to the knowledge of HQ officials. \n(7) Communicating essential instructions from HQ to divisions/field units. \n(8) Generation of various reports at HQ for Railway Board, PCE, CTE, CE/TM etc. \nThe information collected by the track machine control and instructions given \nshould be recorded comprehensively in a logbook, which shall be scrutinized by the \nofficials to ensure effective functioning.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 322, + "text": "301 \n \n1106 Monitoring Modules of Track Machines - The deployment and performance \nof Track machines is to be monitored very meticulously and desired reports \nextracted for an informed analysis of usage of track machines. The parameters shall \nbe monitored broadly for two areas: \n- Working of machines affecting productivity and utilization, \n- Maintenance of machines affecting health. \n(1) Parameters for monitoring Productivity and Utilization of Machines \n(a) Productivity vis-à-vis Target - In the beginning of the year, r ailway wise \ntargets for various types of machines are issued by Railway Board. These \nyearly/monthly targets should be broken into weekly targets and \nproductivity monitored vis -a-vis assigned targets. The shortfal l in \nproductivity of machines should be made good by addressing issues such \nas health of machine, adequate traffic blocks etc. Efforts shall be made to \nachieve these targets and to ensure optimum productivity of track \nmachines. \n(b) Adherence to Deployment Prog ramme - The deployment programme \nissued for each machine in the beginning of the year shall be followed. It \nshould be the endeavor of all concerned that no deviation in the issued \nprogramme is allowed. The performance shall be periodically reviewed \nto achieve the pre -decided deployment of machines in various sub -\nsections of division so as to complete the targeted work without any \nshortfall. \nIt shall be the responsibility of track machine organization to make \nmachine available to work in good fettle as per the requirement and \ndeployment planning. Loss of time on account of schedule of the \nmachine, major repairs, shifting etc. shall be minimized. The schedules of \nthe machine i.e. 50 hrs, 100 hrs, 200 hrs, 500 hrs, 1000 hrs and also IOH, \nPOH shall be meticulously planned and advance notice given to division \nfor optimization of resources. \nThe availability of each machine shall be worked o ut in terms of number \nof days machine is made available for work against total number of \ndeployed days in each division. \n(c) Utilization of Machine – SBH, DBH and ABH - Railway Board has \nstipulated minimum block hours for each type of machine. All out efforts \nshall be made to operate traffic blocks equivalent to stipulated blocks \nhours thus making the Utilization r atio (granted blocks/stipulated blocks) \nas 1.0. Immediate steps for improving the traffic blocks for machines \nhaving utilization ratio less than 0.8 should be taken at appropriate level. \n(d) Performance o f Machine in terms of rated output against achieved \noutput - Rated output of machines per effective hour is stipulated for \neach type of machine. Ratio of actual output to r ated output is a good", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 323, + "text": "302 \n \nindicator of performance of machine. All out efforts shall be made to \nachieve performance ratio (actual output/rated output) as 1.0. Steps shall \nbe taken to analyse and take corrective action for the machines having \nperformance ratio less than 0.8. \n(2) Parameters for Monitoring Health of Machine \n(a) Monitoring of Prescribed Schedules of Machine - Prescribed schedules \nof machines as st ipulated in relevant chapter of this manual, to ensure \nproper health of machines, shall be strictly adhered to and adequate time \ngiven for these maintenance works. Overlapping schedules shall be \nclubbed to reduce the down time of machine without compromisi ng on \nquality of schedules. \n(b) Replacement Planning of Major Components/Assemblies - Major \ncomponents/assemblies of machine shall be replaced in a planned \nmanner and monitored at level of ZMD. These major components shall \ninclude: \n(i) Engine. \n(ii) Tamping unit. \n(iii) ZF and other gear boxes. \n(iv) Axles and wheels. \n(v) Pumps and motors. \n(vi) Other critical components as decided. \nAll these important assemblies shall be serially numbered and \nperformance of these components monitored in a centralized database \nfor meaningful analysis and control. \n(c) Monitoring of consumption of oils and consumables - Consumption of \nconsumables and various type of oils i.e. diesel oil, lub e oil, hydraulic oil \nand gear oil are very essential to be kept under control. The \ndaily/monthly reports shall form the basis and apart from cost aspect \nexcess consumption will constitute a symptom, of ill health of a machine, \nindicating a need for corrective action. \n(d) Monitoring of c onsumption of Spares - While the consumption of \nmandatory spares requiring replacement at specified intervals will have \nto be on a set pattern, any excess drawl shall be critically reviewe d. \nSimilarly, case of spares consumed on repetitive basis, the root cause for \nsuch excess consumption should be analysed and corrective action to \nchange the sub-assembly or going in for better quality of spares will have \nto be decided. The monthly reports will bring out the consumption \nforming the basis for this item. Issue of stores/spares at b ase depot shall \nbe only with SSE/TM/ZD’s approval in the case of Imported spares and \nalso when the stock is at a low level.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 324, + "text": "303 \n \n(e) Failure Analysis - Each failure of the machine or any of its components \neither during block or detected during maintenance shall be recorded \nand documented in the failure register. The failure an alysis should be \ndone machine type wise in following categories \n(i) Mechanical failure. \n(ii) Electrical failure. \n(iii) Hydraulic failure. \n(iv) Pneumatic failure. \n(v) Miscellaneous failure. \nFailure reports in the prescribed proforma shall begiven by SSE/TM/Line \nto SSE/TM/SDI and details along with remedial measures discussed \nduring the monthly meeting held at the level of SSE/TM/SDI and \nDy.CE/TM/Line. Failure reports of major nature and of those causing \nbursting of block shall be sent to HQ office also. Repeated failures and \nfailure suspected on account of design shall be reported to RDSO for \nfurther study and analysis. Similarly, failures related to POH shall be \nreported to respective POH workshops. \n(f) Monitoring of Competencies of Staff and their validity - Track machine \nhave to work in b lock section and accordingly staff have to in possession \nof various certificates such as PME, block competency, route learning, \nmachine competency etc. This is to ensure that staff is fit to work in block \nsection with track machine. A monitoring mechanism shall be put in place \nto ensure that all staff possess necessary fitness and certificates. Staff \ndue for certification/ examination shall be directed timely to the \nconcerned authority for examination/training/certification. \n(g) Recording of machine parameters while working - Record of important \nmachine parameters shall be kept by machine in charge while working. \nThis may includ e various parameters such as squeezing pressure, \nsqueezing time, tamping depth, vibration pressure in tamping machine, \ndepth of cutting and lifting in BCM and SBCM. Monitoring of these \nparameters shall also ensure quality of the work done by the machine \nduring block. Aim should be to develop such recording mechanism that \nrecords these parameters automatically while working. \n1107 Reports and Documentation for Track Machines - The following \nreports/documents shall be used in monitoring of performance and other items in \nrespect to working of machines: \n(1) Daily performance report – A daily performance report compiled by the \ntrack machine control based on the information/fed on -line or collected \nfrom all divisional engineering controllers/field staff. This will be a computer \nprintout containing details of blocks demanded and actually made available, \nproportionate output achievable and actually achieved cumulative figures", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 325, + "text": "304 \n \nfor the month/year. Brief remarks for less output shall also be included for \nthe information of CE/TM, CTE and PCE. A register shall be maintained by \ntrack machine control for serving as a “Master Record” for all relevant data \ntill such time the information is computerised. \n(2) Daily log – A day wise report from the mac hine in charge to XEN/AEN/TM in \ncharge of field incorporating block details, performance, schedules \ndone/overdue, consumables/spares used, oil consumption, spares required \nfor the machine, systems by passed/dummied in the machine, repair and \nfailure shall be made out . A daily logbook shall be maintained by machine \nincharge as per the format given in Annexure 11.1. \n(3) Breakdown report – The machine in charge will submit a report to \nDy.CE/XEN/TM/Line on every breakdown of the machine resulting in failures \nexceeding half an hour. The report will be submitted as per format given in \nAnnexure 11.2. \n(4) Monthly appreciation report –Monthly appreciation reports from the \nmachine in charge on performance furnishing: \n(a) Number of days worked. \n(b) Number of days not worked with reasons. \n(c) Block availed. \n(d) Target. \n(e) Output. \n(f) Reasons for less output. \n(g) Other remarks. \n(h) Consumables/spares used and cost thereof. \n(i) Failures/repairs with spares and cost particulars. \n(j) Details of service Engineer’s visit and copy of the reports. \n(5) Monthly summary – A summarized monthly performance report from \nXEN/AEN/TM/Line showing schedules of inspections done, health of \nmachine, failure analysis, adequacy of allied track works etc. of the machines \nunder their control to Headquarter and Dy.CE/TM/Line. \n(6) Record for 3 years –A summary of availability of each machine for a period \nof 3 years shall be maintained at the satellite depot and zonal depot showing \nat a glance the availability, breakdowns, schedule repairs and POH of \nmachine. \n1108 Track Management System (TMS) – Present Module - Track Management \nsystem ( TMS) is web enabled multi user platform available for monitoring \nmechanized track maintenance inputs and their efficacy. Track machine module of \nTMS is an integral part of overall architecture of track maintenance system, \ngenerating various important reports, including deployment planning of a machine,", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 326, + "text": "305 \n \ntamping chart etc. It should be the endeavor to switch over to TMS completely in a \ntime bound manner so that paperless working can be achieved. Presently, only the \nprogress related module is available in TMS. Statement of different kind of reports \npresently available in TMS is summarized in Annexure 11.3.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 327, + "text": "306 \n \n \n Annexure 11.1 \n \n TRACK MACHINES ORGANISATION Page No. \nWESTERN RAILWAY ENGINE LOG BOOK \nMachine No. Type Engine No. 1 Date ___/___/20__ \n2 \nSSE/TM JE/TM Stabling Station \nMachine Movement \nDetails \nSTN FROM STN TO \nTime From ________ To______________ \nREMARKS \n \nBlock Utilisation details \nBlock \nNo \nPlanned Availed Effective Location Attended \nWork No. of EQ length \nin Km SL/ Turn out From To From To From To STNF STNT LN KMF KMT \n \n \n \nBlock Time Lost Block \nNo. \nTime Reason for loss of time \n \nEngine Meter Reading Start Close BF From prev. \nday Duration on date \nTotal \nEngine No 1 \nEngine No 2 \n \nName & Signature M/C. Incharge JE(P.Way)", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 328, + "text": "307 \n \n \n \nConsumable Used HSD LUB HYD Gear Oil \nCotton \nWaste Grease Others \n \nSpares Utilisation FIT/ \nReleased \nPart Code New/ \nRepaired \nDescription Unit Scheduled/ \nBreak down \nRepair cost Remarks \n \nSchedule details Schedule Type Engine Meter Reading Cost \nRemarks \nBreak down \ndetails \nSTN CODE From To In Block or \nnot \nMajor/Minor Engine Meter Reading \n \nRemarks", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 329, + "text": "308 \n \nSpecial Report Reasons /symptoms of likely Failure / Assistance \nReason for not availing Block, ifany SSE/SE/JE/TM", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 330, + "text": "309 \n \n Annexure 11.2 \nBREAKDOWN REPORT OF TRACK MACHINE \n(a) \n1. \nReport by Machine In charge \nMachine No. ……………………….. Date of breakdown ………………………………..……….. \n \n2. Block permitted from ………………… hrs. to……..………… hrs. \n3. Block section …………………………..…………Division ………………………… \n4. Time of breakdown……………………. hrs. to ………………… hrs. \n5. Time of block cleared ……………..………………… \n6. Detention to train if any …………………………… \n7. Description of failure ………………………………………………………………… \n8. Date of last POH/IOH: a) Machine …………… b) Engine ……………… \n9. Date of last schedule maintenance ………………..………………………… \n And observations made …………………………….……………………………… \n10. Rectification action ………………………………..……………………………… \n11. Date and time M /c made fit ……………………..……………………………… \n12. Report on failed part:- \n No. & description of part …………………………………………………………… \n Make of the part …………………………………………………..…………………… \n Date of fitment ……………………………………………….………………………… \n Part identification code ……………………..……………………………………… \n Spare part brought from …………………………………………………………… \n13. Name of the machine I/c …………………………………………………………… \n14. Officer/Supervisor at site …………………………………………………………… \n15. Assistance required, if any, ……………..………………………………………… \n From XEN/TM/Line office \n16. Action suggested to prevent ……………………………………………………… \n recurrence/reduce breakdown time \n Dated …………………… Signature …………………… \n(b) \n1. \nReport by Line Officer \nDetailed description of failed part …………………………………………………………..……………… \n \n2. Expected life of component …………………………………………………..……………….……………… \n3. Period of service given by …………………………………………………….……………..………………… \n component at time of failure \n4. If premature failure: \n a) Reason of failure …………………………………………………………………………………………………… \n \n \n b) Name of supplier & brand ……………………………………………………………..……………………… \n5. Whether warranty period exists or not ……………………………………………………………………… \n6. If mature failure reason for not changing \n component ……………………………………………………………………………………………………..………… \n7. Whether failure was avoidable or unavoidable …………………………………………….…………… \n8. Staff held responsible and action taken against ………………………………………………………… \n9. Action suggested to prevent recurrence …………………………………………………………………… \n Dated ………………………… \nCopy to –Dy.CE/TM/Line; Dy.CE/TM/HQ", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 331, + "text": "310 \n \n Annexure 11.3 \nTYPES OF REPORTS IN TMS – BLOCKS, AVAILABILITY & PROGRESS OF \nTRACK MACHINES \nSN Report Heading Period Report Content \n \n1. Progress \n(Machine Wise) \nSpecified Day wise block availed, time loss, progress, location, \nreason for tamping, design tamping, BCM site opened \nwith speed for specified duration for single selected \nmachine. \n2. Progress \n(Detailed) \nSingle \nday \nDetailed report for whole railway/division either \nmachine wise or division wise with various times \nconsumed/lost. \n3. Progress \n(Summary 1) \nSingle \nday \nSummary of machine holding, machines worked, \nprogress and break up of reasons for not working, \nwith summary of holding, worked in no. and % for all \nzonal railways. \n4. Progress \n(Summary 2) \nSingle \nday, \nmonth \nand fin. \nyear \nSummary of progress for whole railway /division for \nthe selected day, for the month up to the selected \nday and for the financial year up to the selected day. \n5. Machine Idle Single \nDay \nMachine Idle – under repair/breakdown, under \nshifting, not planned as site not ready, depot work, \nmachine under IOH/POH and stabled for \ncondemnation – for a whole railway/division of any \nzone/division of Indian Railway. \n6. Missing Data \nEntry \nSpecified Missing data entry for each machine worked in each \ndivision giving dates of missing entry as well as total \ndays– \ncan be seen for railway, division for all \nmachines or M/c type wise. \n7. Missing Data \nSummary \nSpecified Missing data entry days division wise total – no break \nup or details. This can be covered in SN- 6 \n8. Progress on Date Single \nday \nDetailed report for a railway/division either machine \nwise or division wise with progress, block and idling \ndays for the month with timing of block in 24 hour \nformat. \n9. Progress in Mega \nBlock \nSpecified Progress and block details, date wise for each \nmachine worked in mega block during the specified \nperiod. \n10. Machine Progress \n& Availability \nSpecified Machine availability for each machine for a \nrailway/division with % ABH/SBH and machine days \nnot worked break-up reason wise. \n11. Machine Type Specified Machine wise cumulative block duration, days and", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 332, + "text": "311 \n \nwise progress for whole railway/division/selected section \nfor selected machine type(s) with sub-total. \n12. Machine \nUtilization \nSpecified % DBH/SBH, % ABH/DBH for whole railway/division – \ngiving figures division wise for each machine type \n13. Night Working Specified Total hours worked, worked in night in hours and % \n(19:00 to 05:00 hours) for whole railway/division, \ndivision wise, machine type wise. \n14. Progress Target \nVs. Actual \nSpecified Annual target, proportionate target, total and % \nprogress for whole railway/division, division wise \nmachine type wise. \n15. Yearly Summary Specified Day wise pictorial representation of specified \nmachine worked and reasons for not worked for a \nspecified period for whole railway/division. \n16. Machine Under \nRepair \nSingle \nday \nMachine under repair/breakdown and IOH/POH \ngiving date since repair and reason for repair division \nwise on a given date. \n17. Tamping Chart As on Track details, tamping details year wise for last 5 \nyears, month wise for current year for a selected \nofficial for a selected line of a selected section (8 kms \nat a time). \n18. Machine \nAvailability \nSummary \nAs on Average machine holding, average machine worked in \nno. of units and % effective for the specified period of \nthis year as well as last year for selected/all Zonal \nRailways.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 333, + "text": "312 \n \nLIST OF ABBREVIATION \nADEN Assistant Divisional Engineer (of open line) \nAEN Assistant Engineer \nAEN/TM/Line Assistant Engineer/Track Machine/Line \nALC Automatic Guiding Computer \nALP Assistant Loco Pilot \nAMC Annual Maintenance Contract \nASM Assistant Station Master \nAT Auxiliary Track \nAT weld Alumino Thermit Weld \nAXEN Assistant Executive Engineer (of other than open line) \nBCM Ballast Cleaning Machine \nBEML Bharat Heavy Earth Movers Limited \nBFR Bogie for Flat Rail carrying \nBRM Ballast Regulation Machine \nBRN Air Braked Wagon \nCB Center Bogie \nCCD Charge Couple Device \nCCTV Closed Circuit Television \nCE/TM Chief Engineer/Track Machine \nCFL Compact Fluorescent Lamp \nCMS Computerized Measuring System \nCPC Contact Point Central \nCPF Contact Point Field \nCPOH Central Periodical Overhauling \nCS Correction Slip \nCSM Continuous Tamping Machine \nCST-9 Central Standard Trial 9 Sleeper \nCT Curve – Transition Junction \nCTR Complete Track Renewal \nCUG Mobile Closed User Group Mobile \nCUM Cubic Meter \nCWR Continuous Welded Rail \nCWS Computerized Working System \nDEN Divisional Engineer (of open line) \nDGR Defect Generation Rate \nDGS&D Directorate of General Store and Depot \nDPR Data Processor Recording \nDPT Dye Penetration Test", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 334, + "text": "313 \n \nDRP Data Recording Processor \nDSL Diesel \nDTS Dynamic Track Stabilizer \nDy.CE (TM) /Line JAG/SG officer in-charge of the track machines working in the divisions \non a Zonal Railway \nDy.CE/TM Deputy Chief Engineer/Track Machine \nEOT Electric Overhead Travelling \nERC Elastic Rail Clip \nERH Engine Running Hour \nF Front Tower \nFB weld Flash Butt Weld \nFCC Front Control Car \nFOB Foot Over Bridge \nFRM Shoulder Ballast Cleaning Machine \nG&SR General and Subsidiary Rules \nGDMS Grind Data Management System \nGMT Gross Million Tonne \nGQI Grind Quality Index \nGRP Grooved Rubber Pad \nGRSP Grooved Rubber Sole Plate \nGVA Geometry Value Assessment \nHAZ Heat Affected Zone \nHMI Human Machine Interface \nHOER Hours of Employment Regulation \nHP Horse Power \nHQ Head Quarters/Head Office \nHRM/HM High Rail Mild \nHRS/HS High Rail Sharp \nHSD High Speed Diesel \nIMR Immediate Removal \nIMRW Integrated Major Reference Works \nIOH Intermediate Overhauling \nIR Indian Railway \nIRPW Indian Railway Permanent Way \nIRPWM Indian Railway Permanent Way Manual \nIRTMTC Indian Railway Track Machine Training Center \nISA Industry Standard Architecture \nIT Information Technology \nJFT Jig Fixture and Template", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 335, + "text": "314 \n \nkmph Kilo Meter per Hour \nKVA Kilo Volt Ampere \nLC/L-Xing- Level Crossing \nLED Light Emitting Diode \nLI Loco Inspector \nLM Locomotive \nLP Loco Pilot \nLS Loco Staff \nLWR Long Welded Rail \nM Middle Feeler Rods \nm Metre \nm/c Machine \nMCI Malleable Cast Iron \nMCM Master Crafts Man \nMDU Muck Disposal Unit \nMF Middle Front \nMIG Metal Inert Gas \nmm Millimeter \nMMU Mobile Maintenance Unit \nMPT Multipurpose Tamper \nNRC National Research Council of Canada \nNT New Track (sleeper) \nOBS Observation \nOBSW Observation for Weld \nODC Over Dimensioned Consignment \nOEM Original Equipment Manufacturer \nOHE Overhead Equipments \nOT Old Track (sleeper) \nP&C Points and Crossing \nP&C,ST Points & Crossing Steel Trough Sleeper \nP&CPSC Points & Crossing Pre stressed Concrete \nP. Way Permanent Way \nPAC Proprietary Article Certificate \nPCB Printed Circuit Board \nPCCM Points and Crossing Changing Machine \nPME Periodical Medical Examination \nPOH Periodical Overhauling \nPQRS Plasser's Quick Relaying System \nPSC Pre Stressed Concrete", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 336, + "text": "315 \n \nPSU Public Sector Undertaking \nP.Way Permanent Way \nR Rear Tower \nRBMV Rail Borne Maintenance Vehicle \nRCC Rear Control Car \nRCD Railway Consumer Depot \nRCF Rolling Contact Fatigue \nRDSO Research, Design & Standards Organization \nRF Rear Front \nRG Rest Giver \nRGM Rail Grinding Machine \nRM Rear Middle \nROB Road Over Bridge \nRPM Revolutions Per Minute \nS&T Signal & Telecommunication \nSAG Senior Administrative Grade \nSBCM Shoulder Ballast Cleaning Machine \nSC Straight to Curve \nSD Satellite Depot or Standard Deviation \nSDI Satellite Depot In charge \nSE Super Elevation \nSEJ Switch Expansion Joint \nSM Station Master \nSOD Schedule Of Dimensions \nSOP Schedule Of Powers \nSr. DEN/DEN Senior Divisional Engineer/ Divisional Engineer \nSr.DEN (Co) Senior Divisional Engineer (Co-ordination) \nSSE Senior Section Engineer \nSSE/DI (TM) Senior Section Engineer/Zonal Depot In-charge (Track Machines) \nSSE/JE Senior Section Engineer/Junior Engineer \nSSE/JE (P.Way) Senior/Junior Section Engineer (Permanent Way) \nSSE/JE (TM) Senior/Junior Section Engineer (Track Machines) – posted on track \nmachine \nSSE/JE/D (TM) Senior/Junior Section Engineer/Zonal Depot (Track Machines) \nSSE/JE/P.Way Senior Section Engineer/Junior Engineer/ Permanent Way \nSSE/JE/SD (TM) Senior/Junior Section Engineer/Satellite Depot (Track Machines) \nSSE/JE/TM (I) Senior Section Engineer/Junior Engineer/Track Machine (in- charge) \nSSE/JE/TM(SDI) Senior Section Engineer/Junior Engineer/Track Machine (satellite depot) \nSSE/SDI (TM) Senior Section Engineer/Satellite Depot In-charge (Track Machines)", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 337, + "text": "316 \n \nSSE/TM (D) Senior Section Engineer/ Track Machine (Depot) \nSSE/TM(SDI) Senior Section Engineer/Track Machine (satellite depot in charge ) \nSSE/TM/DI Senior Section Engineer/ Track Machine /Depot In charge \nST Steel Trough or Straight to Transition Junction \nt Ton/Tonne \nTC Transition to Curve Junction \nTCTT Tungsten Carbide Tamping Tool \nTEX Tamping Express \nTLE Track Laying Equipment \ntm Tonne Metre \nTMM Track Machine Maintainer \nTMO Track Machine Organization \nTMS Track Management System \nTP Telegraph Post \nTRR Through Rail Renewal \nTRT Track Relaying Train \nTS Transition to Straight \nTSR Through Sleeper Renewal \nTT Tamping tool \nTXR Train Examiner \nUGC University Grants Commission \nUNIMAT Points and Crossing Tamping Machine \nUP/DN Denote the nomenclature of Lines on Double/Multiple Line Sections \nUp/Down Track Identification on Double Line section \nUSA United States of America \nUSFD Ultra Sonic Flaw Detection \nUTS Ultimate Tensile Strength \nUTV Utility Track Vehicle \nWST Work Site Tamper \nXEN Executive Engineer \nXEN/AXEN Executive Engineer/Assistant Executive Engineer \nXEN/AXEN/TM(D) Executive Engineer/Assistant Executive Engineer/Track Machine (Depot) \nXL Cross Level \nZF gearbox Gear Box manufactured by German Company ZF \nZMD Zonal Maintenance Depots \nZMDI Zonal Machine Depot Incharge \nZRTI Zonal Railway Training Institute", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 338, + "text": "317 \n \nCorrection Slips Detail \nS.No. C.S. No. Date Para No. Descreption Page No.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Railway Track Machine Manual.pdf", + "document_name": "Railway Track Machine Manual.pdf", + "document_path": "circulars/Railway Track Machine Manual.pdf", + "doc_category": "circular", + "rule_type": "engineering", + "priority": 3, + "authority": "Indian Railways", + "description": "Manual for operation and maintenance of railway track machines", + "is_static": false, + "effective_year": null, + "page_number": 339, + "text": "318 \n \nCorrection Slips Detail \nS.No. C.S. No. Date Para No. Descreption Page No.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Tatkal Scheme (Indian Railways Board PDF).pdf", + "document_name": "Tatkal Scheme (Indian Railways Board PDF).pdf", + "document_path": "circulars/Tatkal Scheme (Indian Railways Board PDF).pdf", + "doc_category": "circular", + "rule_type": "tatkal", + "priority": 2, + "authority": "Railway Board", + "description": "Official Tatkal scheme issued by Railway Board", + "is_static": false, + "effective_year": null, + "page_number": 1, + "text": "TATKAL SCHEME \n \nWith a view to provide reservation to those passengers who have to undertake \njourney at short notice and to save such passengers from the clutches of unscrupulous \nelements/touts, Tatkal Reservation Scheme was initially introduced in December, 1997. \nInitially this scheme was available only in ar ound 110 trains and mainly in Sleeper Class. \nAt that time an extra coach was to be attached for this purpose. This scheme was \nthoroughly revised in August 2004 and thereafter in 2009, 2011, 2012 & 2013. The \nsalient features of this scheme introduced in August 2004, with modifications made from \ntime to time are as under:- \na. Tatkal booking opens at 1000 hours on the previous day of journey excluding date of \njourney from the train originating station. Fo r example, if train is to depart from the \noriginating station on the second of the month, the Tatkal quota for that particular \ntrain shall open at 1000 hours on the first of the month. \nb. The reservation under this scheme is availa ble only upto the time of preparation of \ncharts. At the time of preparation of charts, the vacant Tatkal accommodation is \nreleased to the RAC/waitlisted passengers and no Tatkal charges are realised from \nsuch passengers. \nc. The facility of change of name is not permitted on the bookings made under Tatkal \nscheme. \nd. No duplicate Tatkal tickets are issued. Duplicate Tatkal tickets are issued only in \nexceptional cases on payment of full fare including Tatkal charges. \n \ne. The reservation under this scheme can be sought by full fare paying passengers only \nand no passenger holding concessional ticket is allowed to avail reservation under \nthis scheme. \n \nf. Tatkal tickets are issued only on production of one of the nine prescribed proofs of \nidentity as mentioned below and passenger should carry the same proof of identity(in \noriginal) during the journey failing which all the passengers booked on that ticket are \nconsidered as travelling without ticket and charged accordingly:- \n \ni. Voter Photo Identity Card issued by Election Commission of India. \nii. Passport \niii. PAN Card issued by Income Tax Department \niv. Driving Licence issued by RTO \nv. Photo Identity Card issued by Central /State Government \nvi. Student Identity Card with photograph issued by recognized School/ \nCollege for their Students \nvii. Nationalised Bank Passbook with photograph and \nviii. Credit Cards issued by Banks with laminated photograph. \nix. Unique identification Card “Aadhar “. \nx. Photo identity cards having serial number issued by Public Sector \nUndertakings of State/Central Government, District Administrations, \nMunicipal bodies and Panchayat Administrations. \n \ng. The procedure for booking Tatkal ticket is as under:- \n \n(i) For booking Tatkal ticket, a self attested photo copy of any one of the proofs \nof identity mentioned above, of any one passenger, is to be attached to the \nrequisition slip. \n \n(ii) The details of the identity proof is captured by the system and indicated on the \nreserved tickets as well on the reservation chart. \n \n(iii) It is not mandatory for the passenger(s) to go to the counter to book the Tatkal \nticket, however, the proof is to be sent in the aforementioned manner.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Tatkal Scheme (Indian Railways Board PDF).pdf", + "document_name": "Tatkal Scheme (Indian Railways Board PDF).pdf", + "document_path": "circulars/Tatkal Scheme (Indian Railways Board PDF).pdf", + "doc_category": "circular", + "rule_type": "tatkal", + "priority": 2, + "authority": "Railway Board", + "description": "Official Tatkal scheme issued by Railway Board", + "is_static": false, + "effective_year": null, + "page_number": 2, + "text": "(iv) Even for internet booking for Tatkal tickets, the passenger has to enter the \nidentity proof type and number, which is to be used for travel. These details \nare printed on the ERS/indicated on the MRM/VRM as well as in the \nreservation chart. \n \n(v) During the journey, the passenger, whose identity card number has been \nindicated on the ticket, has to produce original proof of identity indicated on \nthe ticket, failing which all the passe ngers booked on the ticket are treated as \ntravelling without ticket and charged accordingly. Indication comes on the \nticket regarding carrying the same original proof of identity during the \njourney, as indicated on the ticket. \n \n(vi) If the passenger whose identity card number is indicated on the ticket is not \ntravelling, all other passengers booked on that ticket, if found travelling in \ntrain, will be treated as travelling without ticket and charged accordingly. \n \nh. Keeping in view the short Advance Reservation Period and with a view to make this \nscheme economically unviable for unscrupulous elements/touts, refund rules of the \nscheme have been made stringent in wh ich no refund is granted on the confirmed \nTatkal tickets. However, full refund of fa re and Tatkal charges is granted on the \ntickets booked under Tatkal scheme under certain circumstances like non-attachment \nof coach, cancellation of train, as explained below:- \ni. If the train is delayed by more than 3 hours at the journey originating point \nof the passenger & not the boarding point if the passenger's journey \noriginating point and boarding point are different. \nii. If the train is to run on a diverted route and passenger is not willing to travel. \niii. If the train is to run on diverted route and boarding station or the destination \nor both the stations are not on the diverted route. \niv. In case of non attachment of coach in which Tatkal accommodation has been \nearmarked and the passenger has not been provided accommodation in the \nsame class. \nv. If the party has been accommodated in lower class and does not want to \ntravel. In case the party travels in lower class, the passenger will be given \nrefund of difference of fare and also the difference of Tatkal charges, if any. \n \ni. Tatkal charges have been fixed as a percentage of fare at the rate of 10% of basic \nfare for second class and 30% of basic fare for all other classes subject to minimum \nand maximum as given in the table below:- \n \nClass of Travel Minimum Tatkal \nCharges (in `) \nMaximum Tatkal \nCharges (in `) \nReserved Second \nSitting (2S) \n10 15 \nSleeper 90 175 \nAC Chair Car 100 200 \nAC-3 tier 250 350 \nAC-2 tier 300 400 \nExecutive 300 400 \n \nj. Tatkal tickets are issued for actual distance of travel, subject to the distance restriction \napplicable to the train. \n \nk. Agents/RTSAs have been restricted from the booking Tatkal tickets at the counters \nbetween 1000 hours and 1200 hours. This restriction is enforced through frequent", + "extraction_method": "text" + }, + { + "document_id": "circulars__Tatkal Scheme (Indian Railways Board PDF).pdf", + "document_name": "Tatkal Scheme (Indian Railways Board PDF).pdf", + "document_path": "circulars/Tatkal Scheme (Indian Railways Board PDF).pdf", + "doc_category": "circular", + "rule_type": "tatkal", + "priority": 2, + "authority": "Railway Board", + "description": "Official Tatkal scheme issued by Railway Board", + "is_static": false, + "effective_year": null, + "page_number": 3, + "text": "inspection at the counters. The agents both web service agents and web agents have \nalso been restricted from booking Tatkal tickets on the internet between 1000 hours \nand 1200 hours. \nl. It is possible to book a maximum of only four passengers per PNR for Tatkal tickets. \n \nm. The web services agents of IRCTC have been permitted to book only one Tatkal \nticket per train per day on the internet. \n \nn. Powers for earmarking of Tatkal accomm odation in different classes have been \ndelegated to Zonal Railways who take a deci sion in this regard keeping in view the \nutilization pattern in that class during the previous financial year as well as \navailability of accommodation. The accommodation so earmarked, however, in no \ncase exceed the maximum Tatkal accommodation permissible to be earmarked as per \nextant instructions, which is as under:- \n \nClasses Maximum Tatkal accommodation which \ncan be earmarked in a train \nExecutive Class 5 seats per coach \n2 AC 10 Berths Per Coach \n3 AC 16 Berths Per Coach \nAC Chair Car 16 Seats Per Coach \nSL 30% of the accommodation \nReserved Second Sitting (2S) 10% of the accommodation \n \no. Out of the total berth potential of around 12.95 lakhs berths/seats per day, on an \naverage, around 2.24 lakh seats/berths are available for booking under Tatkal every \nday i.e. approximately 17.32% of the total accommodation. \n(Based on information for the period from April 2013 to March 2014) \n \np. The earnings from Tatkal Scheme during the last few years has been as under:- \n \nFinancial Year Earnings from Tatkal Scheme \n(` in crores) \n2007-08 396 \n2008-09 605 \n2009-10 672 \n2010-11 729 \n2011-12 847 \n2012-13 994 \n2013-14 1298 \n \nq. Instructions have also been issued to zonal Railways to introduce Tatkal scheme in \nthe passenger trains in that train/class in which average utilisation during the previous \nfinancial year has been more than 60%. The minimum Tatkal charges prescribed for \ndifferent classes will be applicable as fl at Tatkal charges. All other conditions \napplicable to normal Tatkal scheme will be applicable in case of identified passenger \ntrains. \n \n********", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 1, + "text": "WESTCENTRALRAILWAY\nTICKETCHECKINGMANUAL\n(FOROFFICIALUSEONLY)\nChiefCommercialManager\nWestCentralRailway", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 2, + "text": "TICKETCHECKINGMANUAL\nWC.RLY. OFFICEOFTHE\nCHIEFCOMMERCIALMANAGER\nWESTCENTRALRAILWAY,JABALPUR\nPREFACE\nTheEditionofWestCentralRailwayTicketCheckingManualcomprisesofrulesandregulations\nfortheguidanceofticketcheckingstaff.ItisbasedontheprovisioncontainedinCommercial\nManual,CoachingTariffandOrdersissuedfromtimetotime.\nTheprovisionsofthisManualdonotsupersede,alterorsubstitutetherulesandinstructions\ncontainedinthestatutorypublicationslikeRailwayAct,Tariff,Conferencerulesetc.\nAnysuggestionstothismanualmaypleasebesentthroughproperchannelsoasto\nbringimprovementintheManual.Errors,discrepanciesifanynoticedinthiseditionmayalso\nbebroughttonoticeofthisoffice.\nValuableassistanceinpreparingthisManualhasbeengivenbythefollowing.\n1.\n2.\n3\n4.\n………..\nApril2002 ChiefCommercialManager(PS)", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 3, + "text": "CONTENTS\nChapter-1\nTicketCheckingOrganization\nParaNo. Description Page\nNo.\n101TicketCheckingOrganizationAtAGlace\nChapter-2\nDutiesandConductofCommercialStaffincludingDCTI,CTI,COR,TTE,TS,HDTC,TC,&\nCoachAttendant\nParaNo. Description Page\nNo.\n201General\n202DutiesofCommercialStaff\n203ConductofCommercialStaff\n204Discipline\n205AppearanceofStaff\n206DutiesofTicketCollector(Stationary)\n207DutiesofTravellingTicketExaminer\n208DutiesofConductorsin1stAC,2ndAC,3rdac,ACChairCar,1st\nClassand2ndClassSleeperCoaches\n209DutyListofCoachAttendantsinFirstClass\n210DutyListofTrainSuperintendent(TS)\n211DutyListofHeadTicketCollector\n212DutyListofChiefTicketInspector(CTI)\n213DutiesofProsecutingTicketCheckingExaminer/Sr.Ticket\nExaminer/Inspectors", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 4, + "text": "214ResponsibilitiesofSMs/DCTIinRelationtoWorkingof\nTCs/HDTCs/TTEs\n215DutyListofTicketCheckingStaffinCaseofAccident\n216DutiesofTicketCheckingStaffinCaseofAlarmChainPulling\n217UseofSummerandWinterUniformbyTicketCheckingStaff\n218DeclarationofPrivateCashbyCommercialStaff\nChapter-3\nTickets\nChapter-4\nReservation\nParaNo. Description Page\nNo.\n301DifferentTypesofImportantTickets\n302RoundingoffFares\n303CombinedTicket\n304SeasonTickets\n305IndrailPass\n306ProduceVendorTicket\n307Milk/MarketVendorTicket\n308CircularJourneyTicket\n309ReservationTickets\n310SupplementaryChargeTicket\n311MembersofParliament(MPs)IdentityCard\nParaNo. Description Page\nNo.\n401PeriodofAdvanceReservation", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 5, + "text": "Chapter-5\nRefundRules\nParaNo. Description Page\nNo.\n501ShortTitleandCommencement\n502Definitions\n503StationMastertoRefundFares\n504LevyofClerkageCharges\n505RefundonUnusedUnreservedTicket\n506RefundonUnusedReservedTicket\n506.1RefundwhenTicketIssuingandJourneyCommencement\nStationisSame\n506.2JourneyCommencementStationisOtherThanTicketIssuing\nStation\n506.3RefundofTicketatOtherThanTicketIssuingStationand\n402GeneralRules\n403ReservationAgainstCancellation(RACSYSTEM)\n404AllotmentofAccommodationtoRACPassengerinTrains\n405E-Ticket\n405.1MakinganE-Reservation\n405.2FullyConfirmed/RACorCombinationthereof\n405.3FullyWaitlistedPassengers\n405.4PartConfirm/RAC/WaitingList\n405.6JourneywithanE-Ticket(Reservation)\n405.7ElectronicReservationSlip(ERS)\n405.8VirtualReservationMessage-VRMandtheMRM-Mobile\nReservationMessage\n405.9CancellationofE-Tickets \n406TatkalReservation", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 6, + "text": "JourneyCommencementStation\n507RefundofFareUnderNormalCircumstances\n508RefundofFareUnderAbnormalCircumstances\n509RefundonUnusedWaitListedorRACTickets\n510CancellationofPartlyConfirmedandPartlyRAC/Waitlisted\nTickets\n511PostponementorPreponementofJourneyanaReserved,RAC\norWaitlistedTicket\n511.1PostponementofJourney\n511.2PreponementofJourney\n512ChangeofJourneyFromLowerClasstoHigherClass\n513NonCommencementofJourneyDuetoLateRunningofTrains\n514RefundDuetoRailwaysInabilitytoProvideReserved\nAccommodation\n515PartiallyUsedTickets\n516TicketDepositReceipt(TDR)\n517DiscontinuationofJourneyDuetoDislocationofTrainService\n518FailureofAirConditioningEquipment\n519WhenThePassengersAreMadetoTravelinALowerClassFor\nWantofAccommodation\n520RefundonLost/MisplacedTickets\n521WaitListedPassengersonConcessionandPrivilegeTicket\nOrder(PTO)\n522UnusedPortionofReturnTicket\n523RefundonTicketsonWhichLuggageIsBooked\n524RefundonDuplicateTicket\n525RefundtoThePersonWhoDidNotTravelonACombined\nTicket\n526RefundonTicketsUptoTheValueofClerkageCharges\n527RefundonPartiallyUsedTicketsByRajdhani/ShatabdiTrains", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 7, + "text": "528RefundonMissingTrainDuetoChangeinTrainTimings\n529RefundonTatkalTicket\n530RefundinOtherCircumstances\n531RoundingoffRuleForRefundofFares\n532ComputerizedCoachingRefundScheme(CCRS)\n532.1ExceptionalDataReport(EDR)\n532.2DateEntryPoint(DEP)\n532.3WhenandHowRefundIsAdmissible\n532.4RefundShallNotBeGranted\n532.5InstructionForTicketCheckingStaff/Supervisors/E&RCs\nChapter-6\nLuggageRules\nParaNo. Description Page\nNo.\n601Definitions\n602ArticlesNotAcceptedAsLuggage\n603LuggageCarriedByAC1st,SleeperClassand2ndClass\nPassengers\n604TheTableofFreeAllowanceandMarginalAllowanceFor\nDifferentClass\n605MaximumSizeofTrunks/Suitcase/BoxesEtc.ThatCanBe\nCarriedinAC3Tier\n606ArticlesAllowedFree(ExemptedFromWeighment)Are\n607PassengerDetectedCarryingUn-bookedLuggage\n608PassengerDetectedCarryingPartiallyBookedLuggage\n609PassengerDetectedCarryingPartiallyBookedLuggage\nExceedingMaximumPermissibleLimit\n610PassengerHoldingExtraTickets", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 8, + "text": "611PassengerFoundTravellingBeyondAuthorizedDistanceWith\nLuggage\n612PassengerUnableOrRefusingtoPayTheDueChargeFor\nCarryingUn-bookedOrPartiallyBookedLuggageEnroute\n613PassengerUnableOrRefusingtoPayTheDueChargeFor\nCarryingUn-bookedOrPartiallyBookedLuggageDestination\n614Carriageof“MusicalInstrument”,“TVSet”and“ChildTricycle”\nAsLuggage\n615CharpoyNotinPieces\n616ConveyanceofBicycles,Tricycles,Perambulators,Scooters\nandMotorCyclesEtc.AsLuggage\n617ChargesWillBeCollectedonActualWeightOrFollowing\nPrescribedWeightWhicheverIsHigher\n618GrantofFreeAllowanceonMerchandiseandOtherGoods\nCarriedAsLuggage:\nChapter-7\nBookingandChargingofLiveStock\nChapter-8\nRailwayPassesandAuthorities\nParaNo. Description PageNo.\n701BookingandChargingofDogs\n702BookingandChargingofSheepGoat,PigsandCalves(Under\nHeight0.76Mts.)\n703BookingandChargingofSmallAnimalsandAnimals(Puppies,\nCats,Mittens,Mongoose,Monkey,Rabbits,andGuineaPigs\nEtc.OtherThanPoultry)\n704BookingandChargingofPoultry\n705BookingandChargingofSnakes\nParaNo. Description PageNo.\n801Metaltoken-Gold,SilverandBronze", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 9, + "text": "Chapter-9\nConcessionRules\nParaNo. Description Page\n801.1CommonFacilitiesForRailwayofficerTravellingonMetal\nToken\n802RMSTokens\n803MetalTokenIssuedtoWorkshopStaff\n804PrivilegePass\n804.1AttendantonPass/Token\n805PostRetirementComplimentaryPass\n806SchoolPass\n807DutyPass\n808MedicalPass\n809Widow\n810CardPass\n810.1DutyCardPass\n810.2FreeResidentialCardPass\n810.3ProvisionofCardPass\n810.3SchoolCardPass\n811TravellingAuthority\n812Passes&PTOsIssuedtoGovt.RailwayPolice\n813EmergentPolicePass\n814EmergentPassenger`sPass\n815IdentityCardCumRailwayPasses(ICCRP)\n816ComplimentaryPasstoFreedomFighters\n817SuburbanTicketstoRailwayEmployees\n818PowertoIssue/SignPassesandPTOs\n819PenaltyForNon-FillingofDateonPass", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 10, + "text": "No.\n901GeneralRules\n902ConcessionsAtAGlance\n903ChildrenandStudentsConcessionsTable\n904MedicalGrounds\n905StudentsConcessions\n906SeniorCitizenConcession\nChapter-10\nMilitaryWarrants/Certificate/Concessions\nParaNo. Description Page\nNo.\n1001MilitaryPersonalFoundTravellingonExchangedWarrants\n1002MilitaryPersonnelTravellingWithUn-exchangedWarranton\nGuardsCertificate\n1003DisposalofUn-exchangedWarrantsCollectedByTicket\nCheckingStaff\n1004MilitaryPersonnelTravellingWithUn-exchangedCertificate\nonGuard`sCertificate\n1005MilitaryPersonnelTravellingWithUn-exchangedConcession\nFormIAFT1720A,IAFT1728OrIAFT1736WithGuard`s\nCertificate\n1006PermissiontoCommenceJourneyAfterDateofIssueofTicket\n(IAFT-1720B)\n1007FreeAllowanceofLuggageonMilitaryWarrants\n1008MilitaryPersonnelDetectedTravellingonUn-exchanged\nWarrantsOrOtherForms,RefusingOrUnabletoPayFares\nandExcessCharge\n1009WarrantsataGlance\n1010CertificatesataGlance\n1011ConcessionsVouchersataGlance", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 11, + "text": "Chapter-11\nIrregularTravel\nParaNo. Description Page\nNo.\n1101IrregularTravel\n1102TicketCheckingStations/Points(notcompletedyet)\n1103GuidelinetoDealwithCertainIrregularTravel\n1104ChargingofPassengerTravellingWithoutTicketsOrHolding\nWaitingListTicketsByRajdhani/ShatabdiExpress\n1105GrantingofPermissiontoWaitlistedChildrentoTravelAlong\nwithFamily/PartyinRajdhaniExpress\n1106RemovalsofBeggars,MendicantsandHawkers\nChapter-12\nRailwayAct1989\nChapter-13\nChargesheetandRailwayMagistrates\nParaNo. Description Page\nNo.\n1301DefinitionofCognizableandNonCognizableoffences\n1301.1Cognizable\n1301.2NonCognizable\nParaNo. Description PageNo.\n1201RailwayAct1989–Sections", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 12, + "text": "1302ChargeSheet\n1303RailwayMagistrate\n1304ChargeSheetforTicketlessPassengers\n1305ResultSlips\n1306DisposalofCashRealizedbySpecialRailwayMagistrate\n1307ChargeSheetsforoffencesotherthanTicketlessPassengers\n(UnderSection137&138)\n1307.1NonCognizableoffences\n1307.2Cognizableoffences\n1308ProsecutionofChildrenforNonCognizableandCognizable\noffences\n1308.1Section82(IndianPenalCode)\n1308.2Section83(IndianPenalCode)\nChapter-14\nVariousKindsofChecks-\nParaNo. Description Page\nNo.\n1401ObjectofCheckandCollectionofTickets\n1402KindsofChecks\n1402.1ConcentratedSectionCheck\n1402.2ConcentratedSpotCheck\n1402.3ReplacementCheck\n1402.4CrossCountryorSurpriseChecksByRoad\n1402.5MagisterialCheck\n1402.6FortressChecks\n1402.7AmbushedChecksRaids\n1402.8MassiveOperationalChecks", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 13, + "text": "1402.9Mid-SectionCheck\n1403SurpriseCheckstoCombatTicketlessTraveling\n1404SpecialStepstoCombatTicketLessTravelonPartofStudents\nChapter-15\nRulesregardingExamination,CollectionandDisposaloftickets\nParaNo.Description Page\nNo.\n1501CheckingofReservedandUnreservedComputerizedTickets\n1502CheckingofLadiesCompartment\n1503CheckingofRMS(RailMailService)Compartments\n1504CheckingofPantryCars\n1505CheckingofTicketsinReservedCoaches\n1506CheckingofUnauthorizedTravelByParcelTrains\n1507CheckingofAttendantsofCattleTravellingWithoutTicketin\nCattleWagons\n1508CheckingofWorkmen’sTrains\n1509CheckingofHighofficialsTravellinginSaloonsandin\nReservedCarriagesorCompartments\n1510TicketNippers\n1511CheckingandNippingofTicketsAtStationsof\nCommencementofJourney\n1512CollectionandDisposalofCollectedTickets\n1513TicketCollectedRegister\n1514T.C.ReturnforCollectedTickets\n1515SubmissionofJourneyFormsCollectedFromMemberof\nParliament", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 14, + "text": "Chapter-16\nEarningsofTTE/TCandJointAccountsandCommercialProcedureforPromptAccountalofEFTs\nandRemittanceofCash(T.C.Returns)\nChapter-17\nMiscellaneous\nParaNo.Description Page\nNo.\n1601EarningsofTicketCheckingStaff\n1602ActionByTicketCheckingStaff\n1603ActionbyBookingClerk\n1604RecordtobeKeptByCTI\n1605CheckstobeExercisedByCTI\n1606StatementtobeSubmittedByCTI\n1607ActionbyDRMoffice\n1608CheckstobeExerciseByTIAs\n1609ActionbyTrafficAccountsoffice\nParaNo.Description Page\nNo.\n1701TTEsRoughJournal\n1702TTEsEquipment\n1703CoachAttendant’sEquipment\n1704GuardCertificate(G.C.)\n1705IssuingGC/EFRinCaseLessPassengersTravellingon\nCombinedTicket\n1706ExtensionofJourneyTicket\n1707HandingOverMemo\n1708AcceptanceofRailMoneyValueCouponsFromMLAs/andMLC\n1709AttendantinSoleChargeofChildrenBelow12Years", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 15, + "text": "Chapter-18\n1710BreakJourneyRules\n1711RebookingofPassengersatIntermediateStationBySM\n1712PassengersDetrainedUnderInstructionofPolice\n1713DiversionofPassengerTrafficinCaseofInterruptionof\nThroughCommunication\n1714TicketStampedIndistinctly\n1715RighttoCorrectCharges/Reweighment\n1716PassengersCrossingRailwayLines\n1717IssuingCertificatetoAttendanton1stClassPass\n1718ResponsibilityforEnsuringthatTariffs,Etc.areCorrectly\nPostedandAssimilated\n1719AmenitiestoPassengers-(1)General(2)FacilitiestoLadies\n1720EnquirySystem\n1721PublicAddressSystem\n1722PlatformPorters(Coolies)atImportantStations\n1723WaitingRooms\n1724SafetyandComfortsofPassengers\n1725MedicalAssistancetothePassenger\n1726CarriageofPassengersSufferingfromInfectiousand\nContagiousDisorder/Diseases\n1727ProceduretobeAdoptedinCaseofSickandDeceased\nPassenger\n1728ProceduretobeAdoptedinCasesofMurderOrSerious\nAssaultsinRailwayCarriages\n1729CarryingCapacityofCoaches\n1730OneorMorePassengersDesiringtoBreakJourney/Extend\nCombinedTicketIssuedtoAGroup\n1731GratuitiesorFeestoRailwayServant", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 16, + "text": "BooksofReference\nParaNo. Description Page\nNo.\n1801BooksofReference\nChapter-19\nImportantPhoneNumbers\nParaNo. Description Page\nNo.\n1901TelephonenumbersofCommercialControlofIndianRailway\nason01.01.2010\nChapter-20\nAnnexure\nParaNo. Description Page\nNo.\n2001HandingoverMemo(Com/P.20Rev.)\n2002GuardCertificate(Com164B)\n2003GuardCertificateStatement\n2004FIRForminCaseofLoss/Theft\n2005ChargeSheetforSection137and138ofIRA\n2006ChargeSheetforotherSectionsthanSection137and138of\nIRA\n2007RegisterforChargeSheetsCaseDealt\n2008EFT(ComT.12)\n2009Coupons\n2010VariousChecksReportForm\n2011ACPReportFormbyGuard", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 17, + "text": "2012EFTReturns,TravellingAllowance,NightDuty,Convenience\nandMovement\n2013CTIRegisterforEFT\n2014ErrorSheetbyAccounts\n2015CertificateforPoliceDetrainPassenger\n2016RevalidatingTicketsbySM(Seal)\n2017BreakJourney/Commencement(Seal)\n2018MedicallyInfectiousPassengerbyMedicalOfficer(Seal)\n2019TicketEntryRegister\n2020TicketCollectedReturns\n2021RoughJournalBook\n2022LogBook\n2023DailyTripReportForm/DailyMovementReport\n2024Wire(Message)Book\n2025HighOfficialRequest(HOR)\n2026PoliceWarrant\n2027JailRequisition\n2028BPTforMorethan4Passenger\n2029StudentConcession\n2030MilitaryWarrant,CertificatesandConcessions-IAFT-1707‘A’,\nIAFT-1707‘B’,IAFT-1719,IAFT-1720(A),IAFT-1728,IAFT-1736,\nIAFT-1752,IAFT-1753,IAFY-1954,I.N.-46", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 18, + "text": "Chapter-1\nTicketCheckingOrganization\n101.Ticketcheckingorganizationataglance-\nBoardLevel\nMemberTraffic\nAdvisorCommercial.\nExecutiveDirectorTrafficCommercial.\nDirectorTrafficCommercial.(G).\nJointDirector.\nDeputyDirector.\nofficeronSpecialDuty.\nCTI(Rly.Board).\nCTI(centralticketcheckingsquad).\nZonalLevel\nChiefCommercialManager.\nChiefCommercialManager(PassengerService).\nDy.Chiefcommercialmanager(Passengerservice).\nAssistantcommercialmanager(Ticketchecking)\nCTIHQ(Incharge).\nCTIHQFlyingsquad/CTI.AntiFraudSquad.\nDivisionalLevel", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 19, + "text": "Sr.DivisionalCommercialManager\nDivisionalCommercialManager.\nAssistant,CommercialManager(TicketChecking).\nDivisionalChiefTicketInspector\nChiefTicketInspector.\nTravellingTicketInspector.\nTravellingticketexaminers/Sr.TicketCollector\nTicketCollector.\nChapter-2\nDUTIESANDCONDUCTOFCOMMERCIALSTAFFincludingDCTI,\nCTI,COR,TTE,TS,HDTC,TC,&COACH/ATTEDENTS\n201.General-\n1.Theprimaryfunctionsoftheticketcheckingorganizationistoensurethatnopersontravelson\nrailwayswithoutproperpassorticketandthattheluggageexceedingfreeallowancehasbeen\npaidfor.Anotherimportantfunctioniswhenperformingdutiesofconductororsleepercoach\nTTEtheyshouldseethatberthsareallottedstrictlyaccordingtotherulesandpaydue\nattentiontopassengerscomforts.\n2.Theadministrationalsoexpectsthateverymemberoftheorganizationshouldbecourteous,\npoliteandsympatheticwiththepassengersirrespectiveoftheclassinwhichtheytravel.\n3.Themembersoftheorganizationarealsoexpectedtobehelpfultothepassengersbygiving\ninformationandpromptguidance.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 20, + "text": "202.Dutiesofcommercialstaff-\n1.Allmembersofthecommercialstaffmustmakethemselvesthoroughlyconversantwiththe\nrelevantrulesandregulationslaiddowninthevariousTariffs,Codes,Indianrailway\nCommercialmanualandotherManuals,Booksandcircularsissuedfromtimetotimebythe\nrailwayadministrationfortheperformanceoftherespectiveduties.\n2.Dutylistsshowingthedutiesofeachcategoryofcommercialstaffonthedivisionwillbelaid\ndownwiththeapprovalofthedivisionalcommercialmanager.Stationmastershouldensure\nthatdutylistisproperlydisplayedattheappropriateplaceandthestafffullyunderstandtheir\ndutiesanddischargethemeffectively.\n203.ConductofCommercialstaff-\nAllcommercialstaffmust:\n1.Bealert,prompt,helpful,courteousandobliging.\n2.Furnishcorrectinformation,orwhennotabletodoso,behelpfulanddirectenquiriestothe\nofficialwhocandoso.\n3.Attendthecomfortsofallpassengers,speciallywomenandchildrenunaccompaniedbymal\nmembers.\n4.Maintainaclosewatchonthemovementoftrafficandsuggestwaysandmeanstopromote\nflowoftraffictotherailways.\n5.Give,whenaskedtheirnames,designationand/ordistinguishingnumberwithouthesitation.\nAllcommercialstaffmustnot:\n1.Solicitoracceptgratuities.\n2.Beinstateofintoxicationonduty.\n3.Smokeonplatformwhileonduty,orinuniform.\n204.Discipline-\nStationmasterandothersupervisorystaffmustinculcateastrongsenseofdisciplineamongthestaff\nnotonlybyconstantvigilanceandalsobyexample.Lapseofminornaturemustbepromptly\ncorrectedonthespotandseriousonestakenup.\n205.Appearanceofstaff-\nAllcommercialstaffmust:\n1.Wearcleanuniformwhereverprescribedandputondistinguishingbadge-number,armletand\nheadgearsetc.\n2.Besmartinappearance.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 21, + "text": "206.DutiesofTicketCollector(stationary)-\n1.Shouldbeinneatandtidyuniformwithnameandnumberbadge,etc,.whileonduty.\n2.Shouldreportfordutyattheprescribedscheduletime.\n3.Shoulddeclaretheprivatecash(inwords)intheregistermaintainedbeforetakingupduty.\n4.Shouldensurethateverypersonentersorleavestheplatformortrainwithaproperticket.\n5.Shouldnipthepassengerticketswith‘V’shapenipperwhileenteringandcollectedtickets\nwith‘M’shapenipper.\n6.Shouldcheckthatthepassengersdonotcarryluggageinexcessofthepermissibleweight\n&limits.\n7.Shouldcheckthetrainatcheckingstationandatotherstationswherethereistimetodoso.\n8.ShoulddealwiththepassengershandedoverbythetrainstaffwithHOM.(HandingOver\nMemo)\n9.Shouldguideandgivecorrectinformationtothepassengers.\n10.Shouldprepareexcessfarereceiptscollectingduefaresincasesofextensionofjourney;or\njourneybyotherthanbookedrouteorinhigherclassortrainetc.\n11.Shouldcancelallcollectedtickets,enterthemintheregisterofticketscollectedandsend\ndailytoaccountoffice,trafficbranch.\n12.Shouldremitthecollectedcashinbookingofficeimmediatelyaftercompletionofduty\ncorrectlyandobtaintheacknowledgementinthecashbookaswellasontherecordportion\nofthelastEFRissued.\n13.Shouldgettheremittanceofcashcheckedbythesupervisorincharge,shortremittanceof\ncashshouldnotbedone.\n14.DepositthecancelledEFTswithcashandobtainacknowledgementforthem.\n15.Shouldhandoverthereservationchartstotheondutyconductors/sleepercoachTTEsof\ntherespectivetrainsatstation.Thestationquotaw/lchartshouldnotbehandedover.\n16.Shouldcheckwaitingroomsandplatformsatregularintervals.\n17.Tosubmitmonthlyreturnsintime.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 22, + "text": "18.EFR/EFTbooksunusedandcurrentshouldbekeptundersafecustodyunderany\ncircumstancesshouldnotbelostorstolen.\n207.DutiesofTravellingTicketExaminer-\n1.Towearneatandtidyuniformwithnameandbadgenumberetc.\n2.TTEauthorizedtoconductcheckinplainclothesandshouldkeepwithhimauthorityletterto\nshowwhendemandedbypassengers.\n3.Toreportfordutyatprescribedscheduledtime.\n4.Tosign‘ON’and‘OFF’correctlyonaregistermaintainedatstations.\n5.Todeclareprivatecashintheregistermaintainedforthispurpose.\n6.Tocarrynecessarydocuments/book/equipmenti.e.excessfarebookfaresandluggagerate\ntables,ticketcheckinghandbook,dutycardpass,ticketcheckingauthority,handingover\nmemo,nipperetc.\n7.Toexamineticketsofthepassengerstravellingbythetrainandinitial/nipeveryticket,\nchecked\nproperly.\n8.Tocheckwhetherchargesforluggageinexcessoffreeallowancehavebeenpaidornot.\n9.Tocollectanychargesduefromthepassengerandissueexcessfarereceiptscorrectlyfor\nthem.\n10.Todealwiththepassengerswhoareunable/refusingtopayduechargesasperrules.\n11.Torecordperiodicallycensuscorrectlyasinstructed.\n12.Toguidethepassengersproperly.\n13.Togetcountersignatureofthesupervisoryofficersondutyforprivatecashcarriedinexcessof\npermissibleamountmentionedintheprivatecashregisterandEFT.\n14.Toremitthecollectedcashimmediatelyafterfinishingthedutyandobtainclearsignatureon\nthe\nrecordfoiloftheEFRissuedwithstationstampandobtainamoneyreceiptforthesame.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 23, + "text": "15.Ladiescompartmentshouldbecheckedattheplatformandnotinarunningtrainbymalestaff.\n16.EFRsshouldnotbecancelledexceptinexceptionalcircumstances.CancelledEFTsshouldbe\ndepositedalongwithcashobtainingacknowledgmentofthesame.\n17.Tocontactthe‘guard’or‘conductor’ofthetrainenquirewhetheranypassengerhaspermitted\nbythemtocommencejourneywithoutticketorwithinproperticketsandissuenecessaryEFR\naftercollectingfaresdueandalsobeinassistancetoGuard/TrainConductor/TSincases:\na.ACP.\nb.Detentiontotrainincasesofderailmentaccident.\nc.Cancellingoftrainshortofdestinationorenrouteduetoimpeachment/floodingof\ntrack/dueto\nUnforeseenreason.\nd.Theftcases/decoity.\ne.Death/Murdercases.\nf.Fireontrain.\n18.Todealasperrulesincaseof:\na.Unauthorizedhawkingontrain/coach.\nb.Beggar/urchins.\nc.Unauthorizedovercrowding,oncoach.\n19.Complaintsfrompassengersregardingnon-workingoffan,lightnon-availabilityofwater,AC\nequipment.\n208.DutiesofConductorsin1stAC,2ndAC,3rdAC,ACChairCar,1stclassand2ndClassSleeper\ncoaches-\nToreportfordutyat-leasthalfanhourbeforethescheduledepartureofthetrainatthetrain\noriginationstationandat-least15minutesbeforethescheduledepartureofthetrainatintermediate\nstation.\n1.Towearneatandcleanuniformwithnumberbadge,nameplate.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 24, + "text": "2.Tosign‘on’and‘off’registermaintainedatthestation.\n3.Todeclareprivatecashinwordsintheregistermaintainedforthepurposebeforetakingup\nduty.\n4.Tocarrynecessaryequipment.\n5.Toobtaincompletepositionofthereservations,checkthesameontrainmaintainrecord\n(chartsetc.)initsconnection,tohandovertherelievercompleteandcorrectdetailsshowing\nvacantberths/seats.\n6.Tochecktheticketsofthepassengersinthecoachandguidethepassengersinoccupyingtheir\naccommodationtopreventillegal/unauthorizedentryinthecoach.Toprevententryof\nplatformticketholdersinthecoach.\n7.Toensurethatthenumberofpassengersdonotexceedthecarryingcapacityofthecoach.\n8.TocollectduessuchasreservationfeesupplementarychargesandissueEFRs/Coupons/EFT\nforthem.\n9.Toensurethatpassengersinthecoachdonotcarryheavyluggageintheircompartments\ncausinginconveniencetofellowpassengers.Toassistsuchpassengerstotransfertheluggage\ntoluggagevan/cabin.\n10.Toassistthepassengersinthecoachinobtainingfood/refreshmentsetc.toissuemessageto\nproperstationforthisserviceintime.\n11.Topreventandremovemalepersonsoccupyingaccommodationreservedforladiesandsee\nthatsuchaccommodationisallottedtoladypassengersonly.\n12.Tofurnishinformationofvacantseats/berthsproperlytopassengerdemandingsuch\ninformation.\n13.Toensurethatdrinkingwatercontainersprovidedarefilledinatconvenienttrainhaltsand\nwatchtheirsafetyandutility.\n14.Topayheedtocomplaintsfrompassengers,regardingnon-workingofamenityequipmentsviz\nfans,lights,tapsetc.\n15.Toensurecleanlinessinthecoachbyarrangingsafaiwalasatregularintervals.\n16.Toensurethatthedoorsofthecoachesarekeptlatchedduringrunofthetrainandopenthem", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 25, + "text": "asandwhenrequiredbythepassengersduringnighttime.\n17.Tokeeptheenddoorsofthevestibulecoachlockedduring22.00to06.00hrs.toprevent\nunauthorizedentry.\n18.Toremainvigilantparticularlyduringthenighttimeandprevententryofunauthorized\npersons/beggars/intrudersinthecoach.\n19.Tolockthevacantsleeperberthsinthe2tierscoachbyfoldingupandtoopenthemonlyon\nallotment.\n20.Tobealwayspolite,tactfulandcourteoustothepassengers,leavingnoreasonforcomplaints.\n21.Toattendthecomfortsofpassengersspeciallywoman,childrenandagedpassengers\nunaccompaniedbymaleadults.\n22.Incaseanycompartmentcouldnotbechecked,therebeingmorecoachesallottedtothe\nsuitableremarksshouldbegivenonthechartfortheconvenienceoftheoutgoingTTE.\n23.Toprepareamendedchartsofallcoachesirrespectiveoftrainsarrivingintoheadquartersor\notherwisecorrectlyhandedoveronecopytotheoutgoingTTEanddepositanothercopywith\ntheheadquarters.\n24.Togivecalltoneedypassengersduringnight.\n25.ToseethatcoachattendantmandifferentcoachthantheoneTTE/CORistravelling.\n26.Toremovethepersonenteringthecoachunauthorizedatthesamestationoratleastatthe\nnexthalt.\n27.TotakeassistanceofGRP/RPFifnecessaryforremovalofunauthorizedoccupantsanddeal\nwiththemunderprovisionsofsection155(1)railwayact.1989.\n28.Tobepresentintheallottedcoachduringdutyhoursandifmorethanonecoacharetobe\nmanned,givefrequentvisitstoallthecoachestobemanned.\n29.Tobepresentinthecoachhavingberths/seatsavailablevacantincasemorethanonecoach\narebeingmannedbytheTTEinatrainwithvestibulesarrangement.Thelatchesofother\ncoachestobesecuredatsuchevent.\n30.ToissueGC/EFR/RCtoacpassengersincaseoffailureofacequipmentorwhenpassengeris\ncompelledtotravelinlowerclasswithahigherclassticketforwantofaccommodation.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 26, + "text": "31.Toattendandcomplaintofloss/theftofpassengersbelongingsandlodgethefirstinformation\nreportwiththeGRPintheprescribedformattoenablethepassengerstocontinuehisjourney.\n32.Toremitthecollectedcashimmediatelyafterfinishingthedutyandgetitcheckedbythe\nsupervisorystaffattheheadquartersasperprocedure.\n33.TodepositcancelledEFTsalongwiththecashandobtainacknowledgementforthesame.\n34.Toperformsuchotherdutiesasareprescribedfromtimetotime.\n35.Ensurethatpassengersholdingticketsbeyondthequotastationarenotallotted\naccommodationagainstenroutestationquota/enroutereservation.\n36.Shouldrepeatthepositionofarrangedreservationi.e.ex.reservationwellinadvance.\n37.ToprovideFirst-Aidandallpossibleassistanceincaseoftrainaccident/derailment.\n38.ItwillbedutyoftheTTEasfaraspracticabletodirectpassengerstogooutthroughtheproper\ngatesatstationsinordertopreventpassengersgettingawaywithoutsurrenderingtheir\ntickets.Thiswillalsopreventticketlesspassengersfromgoingoutofthestationwithout\npayingRailwaydues.\n39.Theyshouldalsoassistpassengersinfindingtheiraccommodationontrains.\n40.Toallottheaccommodationavailableenroute(aftertrainhaslefttheoriginationstation)on\nthefollowingpriorityorder.\ni.TotheRACpassengers;givensittingreservationinthecoach.\nii.Aftergivingpreferenceasabove,remainingaccommodationswillbeallottedstrictlyonthe\nbasisoffirstcomefirstserved.\niii.Atstationwherereservationboothisavailabletoallotaccommodationavailablethrough\nboothtothepassengersonwaitinglistatthestation.\nNote:-ifapassengershavingconfirmedreservationcomestoTTE/CORbuthisnamedoesnotappear\ninthechart,thenthispassengersshouldbegivenentryinthecoachevenifthereisnoroomandas\nsoonastheroomisavailable,thispassengerwillbegivenaccommodationonprioritybasisignoring\ntheRACpassengersandthemattershouldbereportedtoSrDCM/DCM.\n209.DutylistofCoachAttendantsinFirstClass-\nCoachattendantwillbepresentinthecorridortypefulllengthfirstclasscoachesandtheirdutiesare\nasunder:-", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 27, + "text": "1.Tobepresentinthecoachhalfanhourbeforethedepartureofthetrainandcheckthatall\ninternal\nfittingsinthecoachprovidedfortheconvenienceandsafetyofpassengersareintactandin\nworking\norderandthatwatertankshavebeenfilledandallfittingforsupplyanduseofwaterinbath\nroomsare\ningoodworkingorder.\n2.Tocarrythelistofpassengerstravellinginhiscoachandaccommodatepassengersjoining\nenroute\nunderthedirection/supervisionoftheconductors/guardofthetrain.\n3.Tokeepcompartmentlockedwhenthetrainisontherunandopenthemforoccupationasand\nwhen\nrequired.\n4.Prevententryofunauthorizedpassengersinthecoachespeciallyincorridor.\n5.Toassistpassengersinobtainingfoodrefreshmentsandlook-aftertheirconvenience\ngenerally.\n6.Toensurethatbathrooms,compartmentcorridors,washbasinsandmirrorsarecleanedby\nsafaiwalasat\nregularintervals.\n7.Toattendpersonallytominorelectricalandmechanicaldefectsdevelopinginthecoachesand\ncall\nmaintenancestaffconcernedforattendingtoamajorrepair.\n8.Tocheckticketsofpassengerswhentheyfirstentertocoachtooccupyaberth/seatinthe\ncoachif\nTTE/CORisnottheretoexercisethischeck.\n9.Heshouldbeinpossessionofthefollowingequipment:-", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 28, + "text": "a.Twolightingbulbs.\nb.Onesetofbrushforfans.\nc.Akeyforopeninglamps.\nd.Emerypapers.\ne.Plier.\nf.Duster.\ng.Screwdriver.\n10.Hemustalsobeinpossessionofdusterandjerry-canwithdrinkingwaterandaglass.Drinking\nwater\nshouldbefilledaswhenitgetsempty.\n11.Givecalltoneedypassengersduringnight.\n12.Tokeeptheberthandseatsofcompartmentproperlycleanedatregularintervalsby\npersonallydoingthe\nsame.\n13.Heshallensurethatthedoorsofthevestibulestrainsarekeptlockedbetween22.00and6.00\nhoursto\npreventoutsiderenteringthecoach.\n14.Toappearinproperuniformandhavenamebadgessothathecanbeidentifiedbythe\npassengers.\n15.Tokeepaclosewatchonthecorridorsofthecoachfromtheattendant’sseatparticularly\nduringnight\ntime.\n16.Toarrangesupplyoftravelbagsatstartingstationandtakingbackofthetravelbagsatthe\ndestination\nundertheguidanceoftheconductor.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 29, + "text": "17.Toconductgeneralcheckofthevacantcabinsimmediatelyafteritsbeingvacatedbythe\npassengersand\nsubsequentlyafterhalfanhourtillitremainsvacanttoensurethateverythingsisinorderin\nthecabin.\n18.Heshouldnottravelinthesamecoachinwhichtheconductoristravellinginsteadheshould\nmanother\nFCcoachremainingunmanaged.\n210.DutylistofTrainSuperintendent(TS)-\n1.ThetrainSuperintendentwillreportfordutyonehourbeforethedepartureofthetrain.He\nmustbeinproperuniformwithprescribedbadges,scrollsandhisnameplate.\n2.HewillbetheoverallinchargeoftheConductors,TTEs,coachattendantsamenitiesstafflike\nsafaiwalas,electric,C&W,airconditioningstaff,cateringmangerandcateringstaffonduty\nbythesametrainandwillberesponsibleforexercisingeffectivesupervisiononthequalityof\ntheirwork.\n3.Allthestaffondutyinthetrainexceptdriver/asst.driver,guardwouldreporttohimwell\nbeforethescheduleddepartureofthetrainatthetrainoriginatingstation.Thestaffenroute\nwouldalsoreporttohimatthepointfromwheretheyaretoboardthetrainaspertheir\nscheduledlinkprogramme.\n4.ThetrainSuperintendentWillrecordinaregisterthenamesanddesignationofthestaffwho\nreporttohimfordutyonthetrainandmentiontheparticularoftheabsenteesinhistrip\nreportattheendofthejourney.\n5.Afterascertainingthedetailsofthestaffthathaveturnuphewillallocatetheworkof\nmanningofcoachesarepropertymanned.\n6.ThetrainSuperintendentshouldensurethatthestaffareinproperuniformswithname\nbadgesandperformtheirdutiesproperly.\n7.ThepositionregardingthedetailsoftheberthsremainingvacantafterallotmenttoRAC\npassengerortheRACpassengersleftoverineachcoachwillbereportedtohimbythe\nConductorandeachTTEandhewillhavethevacantberthsallottedtotheRACpassengers’", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 30, + "text": "stillawaitingallotmentofberths.\n8.Hewillberesponsibleforgivingthevacancypositionoftheberths/seatstothecommercial\ncontroller/SMofroadsidestationsiftheberthsareavailableintrainsafteradjustingallthe\nRACpassengers.\n9.Hewillalsoexercisenecessarychecksonthereservationsgiventopassengersandexcess\nfareticketbooksoftheTTEsandConductorstoensurecorrectrealizationsofdues.\n10.Wheneverthestaffbelongingtootherrailway,iftheydonotco-operatewithhim,ordonot\nattendtheirdutiesproperlyandpromptly,heshouldmakeareportagainstsuchstaffto\nSr.DCM\nofthedivisionconcernedandalsotoCCMdisobedienceforwhichthepersonisheld\nresponsible.\na.Reportfordutyorfailtoperformtheirduty,heshouldimmediatelysendmessagereporting\nthismattertoDRMconcernedfromthenexthaltstation.\n11.Inthisroleasthecaptainofthetrain,hewillco-ordinatetheworkofalltheteammembers\nandwillalwaysbevigilantinensuringcustomersatisfaction.\n12.AtthetrainstartingstationthetrainSuperintendentwillmakeaquickinspectionofthetrain\ntoensurethatthepassengeramenities,fittingsareinproperworkingorder.Thedefectsand\ndeficienciesshouldbereportedtoSMinchargeandgotrectifiedbythestaffconcernedandif\nnecessarysendadvanceinformationtothestationaheadandgetthedefectsattendedtoby\ntheelectrical,andtoiletsareintermittentlysweptandcleanedbythestaffconcerned.\n13.ThetrainSuperintendentwillensurethatproperprecoolingisdoneinaccoachesbeforestart.\n14.ThetrainSuperintendentwillensurethattheAC1st,2ndAC&3tiercoachattendantsare\ncarryingthebedrollsontraintomeetthedemandsofthepassengers,ensuringthatthebed\nrollsaresuppliedasearlyaspossibleavoidingdisturbancetopassengerlateinthenight.\n15.ThetrainSuperintendentwillalsomaintainacomplaintbookinhiscustodyandmakethe\nsameavailabletopassengersondemandforrecordingcomplaints,ifany.Heshouldensure\nthatpromptactionistakentoremovethecauseofthecomplaintandrendersatisfactory\nservicetothepassengers.\n16.ThetrainSuperintendentwillexercisechecksonthecateringserviceontrainsinrespectof", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 31, + "text": "qualityandquantityoffood,cleanlinessofuniformandutensils,behaviorofthemanager\nandbearers,productionofvouchersbythebearers,timelyserviceofmeals,propervending\noftea,coffee,snacksandcolddrinks.\n17.Pantrycarmanagersaretomaintaincomplaintbooksseparately.Thetrainsuperintendent\nwillensurethatthecomplaintbooksarereadilyavailablewithmanagers.Hewillcheckthe\nnatureofcomplaintsandtheirproperdispatchtoCCM(catering)forfurtheraction.Hewill\nalsotakestepstorectifythedeficienciesleadingtocomplaints.\n18.Heshouldtrytoeffectivelypreventunauthorizedhawkingandbeggingonhistrains,utilizing\ntheTTEsandotherstaffpresentonthetrain.\n19.HeshouldensurethatthesleepercoachTTEsandcoachattendantsfollowthestanding\ninstructionsregardingthesecuringandlatchingofthedoorsonrunandatstationsandalso\nclosingandboltingthevestibulesdoorsatnighttimearescrupulously(Strictly)observedby\nhisstaff.\n20.Incaseoftheftduringtherunofthetrain,hewouldguidethepassengerstotheGRPescort\nparty,iftravellingbythetrain.Otherwise,hewillmakeavailabletothepassengersablank\nF.I.RformforlodgingthecomplaintandhandoverthesameatthefirstGRPpostavailableat\nthescheduledstoppageofthetrainforinvestigation.Aninformationwillalsobemadetothe\nconcernedCommercialControlbyphonebyhiminthisregard.\n21.AttheendofeachtripthetrainSuperintendentshouldmakeoutabriefreport(Captain\nReport)indicatingspecialoccurrences,ifanyandcommentinguponallaspectsof\npassenger’samenitiesnamelycatering,supplyofdrinkingwater,fillinguptowatertanks,\ncleanlinessofcoaches,andentryofunauthorizedpassengersinreservedcoaches.Workingof\nlights,fansandotherfittings,incidentsoftheftsofluggage,non-functioningofair\nconditioningandotherpubliccomplaintsetc.andsubmitthesametothedestinationstation\nSuperintendentwhoshouldsendthesametoSr.DCM/DCMforinitiationimmediatenecessary\naction.HewouldalsoensurethatTTEsworkingunderhimsubmittheEDRinfulldetails\nbeforeoff-duty.\n22.Anyotherdutyassignedtohimfromtimetotime.\n211.DutylistofHeadTicketCollector(DyCTIstation)-\n1.Toensurethathisstaffreportfordutywellintimeandinneatandcleanuniformwithname", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 32, + "text": "platesandbadges.\n2.Toensurethathisstaffentersprivatecashinprivatecashregister.\n3.Toensurethatstaffishaving’v’typeand‘m’typenipper.\n4.Keeppositionofrunningoftrainspassingthroughhisstation.\n5.TomaintainstationdiaryofHead.T.C.\n6.Toseethathisstaffaredeputedatstrategicallypointsonthestation.\n7.Toensurenippingofticketsby‘v’typenippersbyTCsatentrancegates\n8.Toensurecollectionoftickets,properentriesanddisposalofthesame.\n9.Toexercisecheckovertheearningsofstationerystafffromtimetotime.\n10.Toensurethatindividualaswellasstationtargetsetbytheadministrationisreached.\n11.Toresolvereservationdisputesandtoensurehandingoverreservationchartsofstation\nquotatotheTTEsontrainintime.\n12.ToattendtheVIPsandensuretheiraccommodationontrainservice.\n13.Toensurethatthereisnodetentionoftrainoncommercialaccount,ACP.Etc.\n14.Tokeepliaisonwithcommercialcontroller.\n15.Toensurethathisstaffsubmitstheirmonthlyexcessfarereturnsintime.\n16.Toredressthegrievancesofpassengers,pertainingtopassengeramenities\n17.Toguidehisstaffforcorrectchargingofpassengers.\n18.Toseethatthestationisfreefromantisocialelementslikeunauthorizedhawkers,beggars&\ncattlesetc.forwhichhecantakehelpformGRP&RPFstaff.\n19.Issueofticketdepositreceipt,GCtoneedypassengers.\n20.Toactasperinstructionsofadministrationincaseofanyabnormalityarisingatstation.\n21.Toensurethatthedebitraisedagainstthestationstaffiscleared.\n22.Toensurethatthecashcollectedbythestationarystaffisremittedinbookingoffice", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 33, + "text": "correctlyandimmediatelyafterthedutyhours.\n23.Atnominatedstationstoensurethatthelinestaffbookedbytrainsreportintimeandincase\nofnonturningupofstafftobookleavereservestomanthetrain.\n24.Toensurethattheincomingstaffsignoffintheregisterprovided.\n25.Toensurecleanlinessofstationandtrains.\n26.InadditiontothiscarryoutwhateverworkassignedtohimbycommercialofficersandCTI.\n212.DutyListofChiefTicketInspector(CTI)-\n1.Generalsupervision,includingsurprisechecksovertheworkingofallticketcheckingstaff\nincludingcoachattendantsovertheirjurisdiction.\n2.ToconducttestchecksontheEFTbooksofstaffforthecorrectremittanceofcashbythem.\n3.Toconductsurprisechecksonthedeclarationofprivatecashbythestaff.\n4.Toconductsurprisechecksontheuniforms/badges/nameplatesallequipmentofticket\ncheckingstaffincludingcoachattendantsontrain&stations.\n5.Tomakenecessaryarrangementsofticketcheckingstaffforfairs,melasandspecialticket\ncheckingdrives.\n6.Tokeepcloseliaisonwiththemagistrate,GRP/RPFinconnectionwithdrivesagainst\nticketless/alarmchainpullingandarrangeprosecutionsasandwhennecessary.\n7.Todrawconfidentialprogrammesforspecialraids/checksatimportantstations/trainsin\nordertopinpointthebedspotsandtakeremedialsteps.\n8.ToconductsurprisechecksonConductors/SleeperpercoachTTEs/coachattendantsand\nreportirregularitiesforsuitableaction.\n9.Toarrangepassengerscensusperiodically.\n10.Toconductsurprisechecksoncollectedticketsandaccessthenumbersofunclippedticket\ncollectedandkeepawatchonresaleofticketsandensurecorrectmaintenanceofrecords.\n11.Toconducttestchecksonpercentageofmissingticketsandsuggestwaysandmeansto\nminimizethepercentageofmissingtickets.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 34, + "text": "12.Toconductalltypeofenquiriesinconnectionwithcomplaintsagainstticketcheckingstaff.\n13.Toensurecorrectsubmissionofallreturnstoaccountofficeintime.\n14.Heholdsofficeandallpapersandensurespromptreply,inadditiontohisinspection\n/supervisionontrains/stationetc.\nNote-Thechiefticketinspectororhisequivalentwillberesponsibleforbookingoftravellingticket\nexaminersbytrainsinaccordancewiththeprogrammeapprovedbytheDCM.Aregisterinform\nCOM/T.30willbemaintainedinwhicheverytravellingticketexaminerwhilegoingondutywitha\ntrainorterminatinghisjourneyathisheadquartersstationoratanyotherstationwillmakeentryin\ntheregister.\n213.DutiesofProsecutingTicketCheckingExaminer/Sr.TicketExaminer/Inspectors-\nAProsecutingTicketExaminer/Sr.TicketExaminer/Dy.ChiefTicketInspectoris,generally,\nprovidedateachrailwaycourt.TheprimarydutyistorepresentRailwaysinCourtsandprotectthe\ninterestofrailways,apartfromcheckingtrainsandrealizingExcessFare.Hewillalsoensure\nrealizationoffaresandexcesschargeduefromthepassengers,whofailedtopaytherailwayson\ndemand,throughthecourtbyfilingapplicationsunderSection138(4)ofRailwayAct.Heshall\nmaintainstatisticsasregardstonumberofcasesfiledinthecourt,Amountsrealizedasfareand\nexcesscharges,finesifanyimposed,numberofpersonsletoff,numberofpersonssenttojailand\nsubmitperiodicalreturnstoSr.DCM’sofficeintime.\nBeforefilingapplicationsunderSection138(4)ofRailwayActthefollowingpointshavetobe\nkeptinmind.\na)TheapplicationmustbemadebeforethelocalMagistratehavingjurisdictionovertheplaceof\nincidentwherethecase/defaulterhasbeendetectedorbeforeaRailwayMagistrateasthe\ncasemaybe.\nb)Itmaybementionedthatapplicationofthenatureundersection138(4)ofRailwayAct,have\nnopenalconsequencesasinthecaseofpunishmentsarisingunderpenalsections.\n214.ResponsibilitiesofSMs/DCTIinrelationtoworkingofTCs/HDTCs/TTEs-\n1.Stationmaster/othersupervisorystaffareresponsiblefortheworkingofticketcollectorsof\ntheirstationsandformakingadequatearrangementsatstationtoensurethatthepassengers\nleavetheplatformsthroughproperexitonly,wheretheyarerequiredtosurrenderorshow\ntheirticketsorpasses.Theywillalsoensurethatallcollectedticketsarecancelled\nimmediatelyaftercollectionandnecessaryrecord/returncompiledproperlyandintime.\n2.Atstationwhereheadticketcollectorispostedtheresponsibilityforcarryingoutticket\ncollectorsdutieswillliewiththemandatstationwherenoheadticketcollectorisposted,it\nwillbedutyofSr.TicketcollectororasmaybenominatedbyDCM.Thestationmaster/manger\ninsuchcaseswillonlyberesponsibleforensuringthattheticketcheckingandotherauxiliary", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 35, + "text": "workontheirstationisbeingcarriedoutinaccordancewiththeruleslaiddownonthesubject.\n3.Atstationswherenoticketcollectorsareposted,SMswilldeputetheASMondutyorsome\nothercommercialortransportationclass3stafftocollecttheticketandwillensurethatthe\nstaffsodeputedperformtheworkallottedtothemproperly.Theyshouldalsodepute\nadequatenumberofclass4stafffordirectingthepassengerstopassthroughexitgateat\nwhichthestaffdeputedforcollectingticketsisposted.SMswillalsoallottheworkof\ncancellationofticketsandpostingthesameinappropriateregisterandpreparationofreturns\ntospecificstaffandensurethatthelatterexecutetheworkallottedtothemproperly.\n4.DivisionalchiefticketinspectorswillberesponsibleforbookingofTTEsbytrainsinaccordance\nwiththeprogrammefixedbydivisionalcommercialmanagers.Theywillmaintainrecordof\ntheirattendance,preparetheirmusterrolls,arrangetheirreliefintheeventofcausalitiesetc.\nandensureproperaccountalofcashcollectedanddepositedandtimelysubmissionofMonthly\nExcessFare(EFT)returns.\nThestaffshallperformthedutieswhichmaybeentrustedtothemfromtimetotimebytheir\nimmediatesupervisorsandofficersauthorizedinthisregard.\n215.DutylistofTicketCheckingStaffinCaseofAccident-\nRailwayshaveoftenbeenatargetofcriticismbothbypressandpublicfortheinsufficienthandlingof\ntheaftermathofanaccidentespeciallyinvolvingpassengerscarryingtrains.Thepublicimpressionof\nRailwaysisformedonthebasisofperceptionoftheirneedandcomfortsatsuchtimeofcrisisand\naboveallonthevisiblepresenceandsympatheticattitudeoftheRailwayofficialspresentatthesite\nwhomustadoptahelpfulandhumanapproachindealingwiththeeffectedandtraumatized\npassengers.Inanumberofcasesevencoachattendantleftthesiteontheirownorhaveremained\nsilentspectatorswithouttakingpartinpostreliefoperations.Thefollowingaretheimportantduties\nandresponsibilitiesofthetravellingcommercialstaffi.e.ticketcheckingstaffandcoachattendants.\n1.Alltherailwaystaffandofficersincludingticketcheckingstaff/coachattendantstravellingby\nthetrain,onleave/duty,shouldactivelyassociatewithreliefoperationandshouldnotleave\nthesitewithoutpriorpermissionofthecontrollingofficeratthesite.\n2.TTEs/TCs/ConductorswhilestartingtheirjourneyshouldnoteinthechartaboutRailway\nofficials/Doctorstravellinginvariouscoaches,soustoutilizetheirservicesincaseof\nemergency.\n3.Onordertoovercometheproblemofidentifyingaccidentsvictims,allTTEs&Conductorsof\naffectedtrainsshouldimmediatelyreporttheseniormostofficeratthesiteortheGuardofthe\ntrain.Effortsshouldbemadetocollectthereservationchartsandusethesechartswhenever\nnecessaryinidentifyingtheinjuredordead.\n4.TTEs/TCs/Conductorsshouldbeavailableattheaccidentsiteintheiruniforms.\n5.Allthestaffincludingticketcheckingstaffshouldweararmbandsoforangecolourfor\n‘Accidentrelief’whichshouldbeobtainedfromtheGuardofthetrainattimeofaccident.\n6.IfGuard,driveroranyRailwayofficialisnotavailableontheaccidentspot,theticketchecking", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 36, + "text": "staffavailableonthespotwillrenderallpossibleassistancetoaffectedpassengersandwill\ntrytocontactneareststationtoinformcontrolabouttheaccident.\n7.Immediatelyaftertheseriousaccident,specialenquiryboothshouldbeopenedatoriginating,\nterminatingandimportantstationsenroutewhichshouldbemannedbycompetent\nauthority/supervisorincludingstationticketcheckingsupervisorswhowouldmaintain\nupdatedinformationofnamesandaddressesofthedead,injured,theexactlocationofthe\ndeadbodyandinjuredpatients.Theyshouldalsohaveinformationregardingarrangementsof\nthespecialtrainsbeingmadetoevacuatepassengersand/orforthereturnjourney.\n8.Theaffectedpassengersandtheirrelativesshouldbetreatedwithutmostcourtesy,concern\nandsympathytoalleviatetheirtraumaanddiscomfort.Officersandsupervisorsshouldbe\nassignedtothetalktotheinjuredtoascertainfromthemwhethertheywishtocallrelatives,\nfreepassescanbegiventotheirrelatives.\n9.Specialcareshouldbeexercisedtocollectandprovidesecuritytothebelongingsofall\npassengers,speciallythedeadorinjuredinco-ordinationwithRPFandothersecurityforce.\n10.Alltherailwaymentravellingonthetrainondutyorotherwise,involvedinaccidentsshould\nreporttotheGuardwithoutdelaywhatsoever.Aftertheaccidentshasbeentackled,the\ndivision/railwayshouldalsotakestockwhetherallrailwaymentravellingonthetrainreport\ntothe“accidentmanager”andwhatcooperationmadebythem.Henceintheirowninterest\nTTEs/TCs/Conductors/Coachattendantsshouldnotleavethesiteoftheaccidentwithoutprior\npermissionofofficerinchargeatthesite.\n216.DutiesofTicketcheckingstaffincaseofalarmchainpulling-\nUnauthorizedACP/Disc-operation/DisconnectionofHosePipeshouldbereportedtoGRP/RPFunder\nappropriatesectiononIRA141.\nNote-ByamendmentinIRAin1985offenceofdisconnectionofhosepipwasprovidedundersection\n100-B.Itcannowalsobecoveredundersection153ofIRAwhichismoredeterrentandeffective\nprovidedFIRismadeout.\nFollowingprocedureshouldbeadoptedincaseofACP:\n1.Assoonasthedriverofthetraingivesindicationbywhistling,regardingACPortheoperation\nofthedisk,allRailwaystaffondutymainlycoachattendant,ticketcheckingstaff,conductor,\nguard,assistantdriverandRPF/GRPifdetailedfortrainescortingduty,shouldbecomealert\nandgetdownthemomentthetrainstopstolocatethecoach,inwhichalarmchainapparatus\nhasbeeninterferedwith.\n2.Anyonefirstcomeacrosstheaffectedcoachshouldtakeimmediateactiontoputthediscright\nsothatthetrainisstartedimmediatelywithleastdetention.\n3.Theywillmakeefforttodetectandapprehendtheculprit.\n4.Theguardofthetrainwillcollectnecessarydetailsinregardtochainpulling/disc", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 37, + "text": "operation/HPDandfillupthesamewithenclosedperformabelow.\n5.TheformsfilledbytheguardwillbehandedoverbyhimwithacoveringmemotoASM/SMon\ndutyatfirststationwithGRP/RPFposthaltwherethetrainisscheduledtohalt.TheSM/ASM\nondutywillpassontheseformstotheGRP/RPFpostunderamemoobtainingtheir\nacknowledgementforthesame.\n6.GRP/RPFstaffwilltakefurtherlegalactiononreceiptofsuchforms(complaint).\n7.Theguardinchargeofthetrainwillpassremarkinguard’sjournalbookregardingACPand\nhavinglodgedthecomplaint.Onthebasisofremarkpassedinthejournaltheofficeof\ndivisionaloperatingmanagerwillprepareamonthlystatementandenclosecopiesto\nsuperintendentofpoliceGRP/Sr.DSCconcernedandalsotoCOM,CCMandCSC.Thestatement\nshouldindicatethenumberofACPcasesinwhichcomplaintswerelodgedwithGRP/RPFand\nnumberofcasesregisteredbyGRP/RPF,ifknown.\n217.Useofsummerandwinteruniform-\nStationmasterandothersupervisorystaffensurethatthestaffwhereversuppliedwithuniforms\nchangeovertothewearingsuppliedwithuniformschangeovertothewearingofsummertowinter\nuniformsandviceversafromtheactualdatesnotifiesforthesechangesbytheadministration.The\nappearanceofsomestaffinsummeruniformsandothersinwinteruniformonthesamedaymustbe\navoided.Likewise,acombinationofwinterandsummeruniformssuchaswintercoatsandsummer\ntrousersshouldnotbeallowed.\n218.Declarationofprivatecashbycommercialstaff-\nThefollowingcategoriesofstaffthathandlecashand/orhavedirectdealingwithpublicarerequired\ntodeclareprivatecashbeforetakingupduty-\n1.Parcelclerk,ECRC,Bookingclerk,GoodsclerkandSidingclerk.\n2.Ticketcollectors,HeadTicketcollectors,Chiefinspectoroftickets,TTE,Conductors,Guard,\nAssistantGuard,Chiefticketinspector,Coachattendant\n3.Stationmaster,Assistantstationmaster(duringcommercialwork/dutywithcashtransactions).\n4.Parcelporters,ScaleportersaccompanyingTTE.\n5.Billissuer,Assistantmanagers,Managersinfixedmobilecateringunits.\n6.Markmen.\nMonitoryceilingwillbeRs.750/-forstationarystaffandRs.1500/-incaseofmobilestaffasper\nRailwayboardcircular81of2006.\nMinistryofRailwayhavedecidedthattheTTE’sshoulddeclaretheirprivatecashonthereverse\noftherecordfoilofthelastEFTissuedorincaseanewEFTbookissupplied,onthereverseofthe\nfrontcoverpage,beforecommencementofdutyinadditiontodeclaringthesameatthestationas", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 38, + "text": "usual.\nNote-DutylistreferenceRailwayBoardofficeorderNo.98/TG-V/12/1.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 39, + "text": "Chapter-3\nTickets\n301.Differenttypesofimportanttickets\nVariousclassesofaccommodationsavailableonIndianrailwaysandcolourofcardtickets,computer\ntickets.\nClass Colouroftickets\nA.C.1stclass White\nA.C.Sleeper Green\nFirstClass Green\nA.C.3-TierSleeper Green\nA.C.Chair-Car Orange\nSleeperClassM/E Pink\nSleeperClassOrdinary Pink\nSecondClassM/E Drab\nSecondClassOrdinary Yellow\nNote-TheminimumfareisapplicableincaseofchildticketbutnotapplicableincaseofPTOand\nconcession\nticket.\n302.Roundingofffares:", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 40, + "text": "FaresofallclassesexceptSecondclassOrdinary(Suburban):ChargeableFares,asobtainedafteradding\nMiscellaneousChargeslikeReservationFee,SupplementarychargeforSuperfasttrains,CateringCharge,\nServicetaxetc.totheBasicFare,willberoundedofftothenexthighermultipleofRs.5.[CoachingtariffNo.26\n(part2)w.e.f.22.01.13]\n303.Combinedticket:\nCombinedticketareissuedwheresameclassofaccommodationisnotavailablethroughoutthe\nrailwayportionofajourney,faresforcombinedticketwillbecalculatedasfollows:-\n1.Faresfortheentiredistancefortravelinlowerclass;and\n2.Faresfortheentiredistancefortravelinhigherclass.\nThefaresvideitemno.(2)aboveshouldbeaddedtothefaresvideitemno.(1)togetthecombined\nfare.(Differenceoffarebetweenthehigherclassandlowerclasstobeaddedtoportiontravelledby\nhigherclass)\nNote-Iftheupperclassfareforentiredistanceislessthanthecombinedfare,thanlessfarewillbe\ncollected.\n304.SeasonTickets-\n1.Berths/Seatswillnotbereservedonseasontickets.\n2.Seasonticketholdersarenotallowedtotravelbyrestrictedtrainsmentionedinpublictime-\ntable;iffoundtravellingtheywillbetreatedastravellingwithouttickets.\n3.1stseasonticketholdersarenotallowedtotravelinacsleeperclassevenonpaymentof\ndifferenceoffare;theyarealsonotallowedtotravelinACchaircarandSleeperclass\ncoaches,ifdetectedtravellingtheywillbechargedwithoutticket.\n4.Seasonticketholdersarenotallowedtotravelinsleeperclassifdetectedtheywillbe\nchargedwithout\nticket.\n5.Seasonticketholdersfoundtravellingwithoutidentitycardorwithdefacedidentitycardwill\nbechargedwithoutticket.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 41, + "text": "6.Passengerdetectedtravellingonunsignedseasonticket,butholdingavalididentitycard\nshouldberequestedtosigntheseasonticket.\n7.Seasonticketholderwishingtotravelbeyondthestationforwhichseasonticketisissued,\nshouldobtainextensioneitheratthestartingstationforwhichseasonticketisissued,orat\nanintermediatestationforwhichsinglejourneyfarewillbecollectedfortheextended\nportion.\n8.Afreeallowanceof15kg.on1stclassseasonticketand10kg.on2ndclassseasonticketis\npermitted,inboththeclassesamarginalallowanceof5kg.isapplicable.\n9.SeasonticketholderscanbreakandcommencetheirjourneyfromanystationEn-route.\n305.IndrailPass-\nAspecialtypeofticketissuedtobonafideforeigntourist,Indianwifeofforeigntourist,Indianguideof\nforeigntouristandNRI.(NonresidentIndian).\nTheticketisissuedfromcertainstationsoncollectionoffaresinforeigncurrencyUSdollar.These\nticketsareissuedfordifferentclassesfordifferentvalidityperiodssuchas½,1,2,4,7,15,21,30,60,and\n90daysoncollectionofnotifiedfaresdependingontheclassoftravelandperiodofvalidity.Holder’s\nnameanddescriptionofpassportistobewrittenontheticket.\n1.Holder’scantravelfromanystationtoanystationonIndianrailwayswithinthevalidityPeriod.\n2.Holderisrequiredtofillupthedateofcommencementofjourneyincolumnprovidedonthe\nticket.\n3.Holderisexemptedfrompaymentofreservationfeeandsupplementarycharges.\n4.Freeallowanceasperclassofticket.\n5.Norefundonpartiallyusedticket\n6.RefundonunusedticketwillbegrantedinIndiancurrencyfromissuingoffice.\n7.ValidityoftheticketcanbeextendedinexceptionalcasesbySr.DCM/DCMwhenholderis\nheldupsomewhereaftercommencementofjourneyduetosickness,accidents,ordueto\nunavoidablecircumstances.\n306.ProduceVendorTicket-\nAspecialtypeof2ndclassMSTissuedoverBBsuburbansectiononcollectionof2ndMSTfareand", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 42, + "text": "certainnotifiedcharges.Otherrulesapplicabletoseasonticketswillalsoapply.\n1.Inoutwardjourneyholderofproducevendorticketsareallowedtocarrywiththemupto60\nkganykindofperishablearticlesintendedformarketusesuchasmilk,fishvegetables,fresh\nfruits,otherbazaarsuppliersandarticleschargeableatparcelratecp.5kgsmarginal\nallowanceisapplicableinoutwardjourney.Un-bookedexcessweightwillbechargedasper\nrulesinforce.\n2.Inreturnjourney15kgsproduceandemptycontainerscanbecarried.\n3.Holder’sarenotallowedtotravelinupdirectionbetween8.30to11hoursandindown\ndirectionbetween16.30to19.30hoursotherwisetheywillbetreatedastravellingwithout\nticketandchargedaccordingly.\n4.Holder’swishingtotravelbeyondthedestinationtowhichtheirPVTsareavailablemust\nobtainextensionatthestartingstation.Singlejourneyfareandfullluggagerateswillbe\ncollectedfortheextendedportion.\n5.HoldersofPVTsareissuedformstationsbeyondKalianonKYN-Kasarasectionareallowedto\ntravelbyN4&N6up.Thehoursofrestrictionontheseticketswillbe10to11UP.direction\nand16.30to19.30inDN.direction.holdersofPVTtoandfromKarjatareallowedtotravelby\nS14up.\nNote:RestrictiononPVTsappliesonlyontheiroutwardtripwhentheycarryloadtotheextentof60\nkg.\nThereisnorestrictionwhentheytravelinreturndirection.ForexampleholderofPVTissued\nto\nstationinupindn.Directionontheirreturntrip.\n307.Milk/MarketVendorTicket-\nAspecialtypeof2ndclassMSTissuedovernonsuburbansectiononcollectionof1.5of2ndMSTfare.\n1.Holdersallowedtocarryupto60kgmarketproducesuchasmilk,vegetable,freshfruits,fish\nandotherbazaarsupplieschargeableatparcelratecp.Inoutwardjourney,nomarginal\nallowanceisapplicable,excessweightwillbechargedaspernormalrules.\n2.Inreturnjourneyonlyemptycontainersareallowed.\n3.Otherrulesapplicabletoseasonticketsholderswillalsoapply.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 43, + "text": "308.CircularjourneyTicket-\nTicketsareissuedbynormalandreasonablydirectroute.Thetermnormalandreasonablydirect\nroutebywhichtheseticketsareissued(otherthancircularjourneyticket)means:-\n1.Ashortroute;or\n2.Alongerrouteprovidedthetotaldistancedoesnotexceedsthedistanceofshortrouteby\nmorethan15%,or\n3.Timeconsumedinjourneybylongerrouteislessascomparedtojourneytimebyshorterroute\nor\n4.Wheretherearedirectandfastervialongerrouteandtherearedirectbogiesvialonger\nroutes.Ifthejourneyistobeperformedbyother4routesmentionedabovethenitwill\ntreatedascircularjourneyandsuchjourneywillbeundertakesoncircularjourneyticketwill\nbeissuedbycertainnotifiedstationsoncollectionoffollowingfares:-\na.Halfofthetotaldistancewillbetreatedassinglejourneyandtwosinglejourneyfares\nwillbe\ncollected.\nb.validityoftheticketwillbeasshownontheticket.\nc.Holdercanbreakjourneyatanystationenrouteforanynumberofdaysbutwithinthe\ntimeframe/daysmentionedontheticket,butbreakjourneyremarkshouldbeobtained\nandiffoundwithoutendorsementofBreakjourney/Journeystarthe/shewillbetreated\nastravellingwithoutticket.Onlyamaximumofeightbreakofjourneywillbeadmissible\nontheseticketsandjourneymustbecompletedwithinthevalidityofticket.\nd.Freshreservationfeewillbecollectedaftereverybreakjourney.\ne.Supplementarychargefortravelbysuperfasttrainswillbecollectedonceforentire\njourney.\nf.Passenger,cantravelbyshortroutesbutnorefundwillbegranted,canalsotravelby\nlongerroute", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 44, + "text": "bypayingthedifferencebetweenthefarespaid&payablebyalongerrouteandshort\nroute.\nStandardcircularjourneyticket,circularjourneyticketshavebeennotifiedinzonalrailwayTime-\ntable,passengercanpurchasetheseticketsifitsuitstheirtourprogramme.Fordetailsregarding\nfares,validitytermsandconditionspleasereferrailwayTimetable.\nOtherrulesasapplicationtocircularjourneyticketwillapply.\n309.ReservationTickets-\nThisisanonjourneyticketissuedfromreservationofficealongwiththejourneyticketon\nwhichconfirmedreservationhasbeengranted.Reservationchargesarecollectedperberth/seat,for\nthefollowingclasses:-\nClass\nAC1st\nACSleeper/2Tier\n1stclass\nAC3Tier\nACchaircar\nSleeperclass\n2ndclassseating\nReservationfeeisrealizedfromallpassengerstravellinginreservedcoaches.Reservationfeewillbe\nleviedonwaitlistedticketsalso.\nAfterbreakofjourneyfreshreservationfeeswillbecollected.\nExemption:1.Railwaypasses,P&Tpasses.\n2.‘Indrail’pass.\n3.Passengerstravellingonticketsissuedinexchangeofmilitarywarrants,concession\norderandvoucher.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 45, + "text": "4.Attendantsonfirstclasspasses.\n5.TicketsissuedonP.T.O’s\n310.Supplementarychargeticket-\nSupplementarychargesarebeingcollectedfrompassengertravellingbysuperfasttrainsforthe\nfollowingclasses:-\nAC1st\nACSleeper/2Tier\n1stclass\nAC3Tier\nACchaircar\nSleeperclass\n2ndclassseat\n2ndclassgeneralcoach\nthechargesarecollectedonceforentirejourney.\nIfapassengerholdingproperticketisdetectedtravellingfromstartingstationoftheticketsbysuper\nfasttrainwithoutpaymentofsupplementarycharges,thensupplementarychargewillbecollected\nwithexcesschargesofRs.250/-\nIfapassengerholdingthroughtickethasboardedthesuperfasttrainfromenroutestation,without\npaymentofsupplementarychargesthenthesupplementarychargeswillbecollectedwithoutexcess\ncharge.\nExemption:\nPassengerstravellingontravellingauthorityconsistingof–\n1.Railwaypass,PTOtickets.\n2.‘Indrail’pass\n3.Freedomfightercardpasses.\n4.MPidentitycard.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 46, + "text": "311.MembersofParliament(MPs)Identitycard-\nRailtravelfacilitiesofmembersofparliamentaregovernedbysalaryallowancesandpensionof\nmembersofparliamentact,1954.Theentitlementofrailtravelfacilitiesofmembersofparliamenton\ndatearebroughtoutasbelow.\ni.FreetravelinFirstclassAir-Conditionedorexecutiveclassinanytrainwiththespouse,ifany,\nfromanyplaceinIndiatoanyotherplaceinIndia.\nii.Freeair-conditionedtwo-tieraccommodationforonepersontoaccompanythemember.\niii.AmemberhavingnospousehasbeenallowedtotakeonepersonwithhiminplaceofSpouse\ninAC-1st/ExecutiveclassinrailjourneyalongwiththecompanionalreadyallowedintheAC\n2Tier.\niv.ThespouseofamembershallbeentitledtotravelbyrailwayinFirstclassAir-Conditionedor\nexecutiveclassinanytrainorbyairorpartlybyrailandpartlybyairfromtheusualplaceof\ntheresidenceofthemembertoDelhiandbackonceduringeverysessionandtwiceinbudget\nsessionofparliamentsubjecttotheconditionthattotalnumberofeachsuchjourneyeitherto\nDelhiorbackshallnotexceedeightinayear.\nv.Amemberwhoisblindorwhois,intheopinionofthechairmanofthecouncilofstatesor,as\nthecasemaybe,thespeakerofthehouseofthepeople,soincapacitatedphysicallyasto\nacquirethefacilityofanattendantshallbeallowedtotakeanattendantwithhiminsame\nclassofrailjourneyinwhichhehimselftravelsinlieuofthecompanionearlierallowedinAC\n2Tier.thiswillbeinadditiontothespousealreadyallowedtoaccompanysuchmemberinthe\nAC-1st/executiveclassofrailjourney.\nNote:ReservationrequestfromMPsfromintermediatestationshouldbeacceptedupto24hrs.\nbeforescheduleddepartureofthetrainfromthestartingstation.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 47, + "text": "Chapter-4\nReservation\n401.Periodofadvancereservation-\n1.Upto60daysinadvancefromallstationinallclassesbyalltrains.\n2.Upto360daysinadvanceforbonafideforeigntourists.\nNote:-dayofjourneywillnotbecountedforthepurposeofcountingperiodofadvancereservation.\n402.Generalrules-\n1.Reservationwillbegrantedonproductionofvalidjourneyticket/pass.\n2.Reservationwillnotbegrantedontelephonicrequest.\n3.ApplicationforReservationmustbesubmittedonaprescribedformi.e.onReservationform.\n4.Onlyoneformwillbeacceptedgenerally,except2incaseofreturnReservationforthesame\npassage.\n5.Apersoncanbookupto6reservationsincaseofpartyorfamilymember.\n6.ChildticketistreatedasadultticketforReservationofberth/seat.\n7.Reservedticketisvalidonlybyaparticulartrainonaparticulardateandclass.\n8.Reservationbyconnectingtrainisnotguaranteed.\n9.Reservationitselfisnotguaranteedandrailwaywilladmitnoclaimforcompensationdueto\nnonavailabilityofreservationontrain.\n10.Ifapassengerhavingreservationfromaparticularstationdesirestoboardthetrainfrom\nenroutestationpermissionwillbegrantedsubjecttofollowingconditions:\na)AwrittenrequestshouldbesubmittedtotheSMofthestartingstationatleast24\nhoursbeforescheduleddepartureofthetrain.\nb)Norefundwillbegrantedfortheuntraveledportionofjourney.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 48, + "text": "c)Railwaymayallottheaccommodationtoanotherpassengeruptotheintermediate\nstationorboardingstationofthepassenger.\nd)Thisfacilityisgrantedonlyonthosecoacheswhicharemannedbyticketcheckingstaff.\n403.Reservationagainstcancellation(RACSYSTEM)-\nThesystemofRAChasbeenintroducedinordertoproducemoreaccommodationtothe\npassengerfromthetrainstartingstation.\nUnderthesystemofRAC,sittingreservationisprovidedtothepassengerinreservation\ncoaches,thesepassengerarealsowaitinglistforreservationofberths.\nAfterthetrainhasleftthestartingstation,accommodationavailableatenroutestation,\nduetoreservedpassengersnotturningup,enroutestationquotafoundvacantor\notherwise,suchaccommodationwillbeallottedinthefollowingorder:-\n1.ToRACpassengergivensittingreservationinthecoach.\n2.Aftergivingpreferenceasabove,remainingvacantaccommodationwillbe\nallottedstrictlyonthebasisoffirstcomeforserved.\n3.Atstationwherereservationboothsisavailable,accommodationavailablewill\nbeallottedthroughtheboothtothewaitlistedpassengerofthatstation,butvacant\naccommodationwillbeallottedthroughthebooth,onlywhenRACofthecoachhasbeen\ncleared.\nNote-\na)IfapassengerhavingconfirmedreservationcomestoTTE/CORbuthisnamedoesnot\nappearinthereservationchart,thenthispassengershouldbegivenentryinthecoach\neveniftheseisnoroomandassoonastheroomisavailablethispassengerandthis\nmattershouldbereported,toconcernedSr.DCM.\nb)RAC:-Inthesleeperclass,wheretwoRACpassengersaregivensittingreservationona\nsidelowerberthandoneofthemisnotturningup,leftpassengerwillbeallottedthat\nparticularsidelowerberth.\nSleeperclass:", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 49, + "text": "a)Thisclassinhigherthan2ndclass,passengersfoundtravellinginthisclasswith2nd\nticketwillbetreatedastreatedastravellingwithimproperticketandchargedthe\ndifferenceoffareandexcesschargepenaltydue.(Ifhe/shehasnotinformedthecoach\nconductorinadvanceandalsothethereisnoaccommodationisavailable)\n404.AllotmentofaccommodationtoRACpassengerintrains-\nInallvestibuletrainstheTTE/COR,afteraccommodatingtheRACpassengersasperextant\ninstructionwouldadvicethepositionregardingthenumberofberthvacantorthenumberofRAC\npassengersyettobeprovidedsleepingberthintherespectivecoachesundertheircharge,tothe\nTS/CORin-chargeofthetrainwhowillhavethevacantberthsallottedtotheRACpassengersstill\nawaitingsuchallotmentbeforethesamearereleasedtowaitlistedorotherpassengers.\n405.E-Ticket–\nE-Tickets(e-reservation)areanotherinnovativeserviceprovidedbyIRCTC,whichdispenseswiththe\nneedforthephysicaltickettobecarriedforarailjourney.Theusercantakeaprintoutoramobile\nSMSsentbyIRCTCofthereservationdetailsandperformthejourneywithoriginalpersonnelphoto\nidentificationwithoutcarryingtheregularrailwayticket.\n405.1.MakinganE-reservation-\nToavailthisservice,theusercanlogontowww.irctc.co.inandbookhisticketontheInternetjustlike\nanynormalbooking,andselecting‘e-Ticket’inthePlanMyTravelpage.Onconfirmationofhis\nbooking,theusercantakeaprintoftheElectronicReservationSlip(ERS)andcanperformthejourney\nwiththeERSandthephotoidentitycard.\nApartfrombookingconfirmedticketsthroughe-reservation,passengerscanalsobookRAC\nandwaitlisttickets.\nHoweverduringthejourney,ifanyoneofthepassengersbookedonthe‘e’ticketpresentany\noneofthesevenidentitycardsmentionedbelowinoriginal,thesamewillbeacceptedasproof\nofidentity.Thefollowingphotoidentitycardsareconsideredvalid.\noVoterIdentityCard\noPassport\noPANcard\noDrivingLicense\noCentral/stateGovernmentissuedPhotoIDcard.\noStudentIDcardwithphotographissuedbyrecognizedschool/collegefortheirstudents.\noNationalizedbankpassbookwithphotograph.\noUniqueIdentificationCard\"Aadhaar\"", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 50, + "text": "Atpresent,paymentsfore-ticketscanbemadeonlybydirectdebit(InternetBanking,with15\nBanks)orwiththeCashCardOption.Paymentsthroughcreditcardsarenotavailablefore-\nticketReservationatpresent.HoweverordinaryInternettickets(I-ticket)canbepurchased\nusingCreditCard.\nThestatusoftheseticketsmaygetupdatedonaccountofcancellationofalreadybookedticketsetc.\nandthestatusafterpreparationofchartsmaybeeitherfullyconfirmedRAC/waitlistorcombination\nthereof.Thesecaseswillbedealtwithasunder:-\n405.2.Fullyconfirmed/RACorcombinationthereof-\nNamesofthepassengerswhosestatusatthetimeofpreparationofchartsisfullyconfirmed/fully\nRACorcombinationthereofwillappearinthechartandtheycanundertaketheirjourney.\n405.3.Fullywaitlistedpassengers-\nFullywaitlistedtickets(theticketinwhichallpassengersononePNR,allthepassengersareon\nwaitlist)PNRswillbedroppedfromthereservationchartinthesystem.\nOnaPNRwhichhasallthepassengersonwaitinglistatthetimeofcharting,thenamesofsuch\nwaitlistedpassengerswillnotappearinthechartsandsuchpassengers,iffoundtraveling,willbe\ntreatedasunauthorizedandchargesaccordingly.HoweveronaPNRwhichhassomepassengers\nconfirmedorRACstatusandsomeonwaitinglist,allthenamesincludingthoseonwaitinglistwill\nappearinthechart.\n405.4.Partconfirm/RAC/Waitinglist-\nIfononePNRtherearemorethanonepassengerandonepassengerishavingconfirmed/RACstatus\nandrestareonwaitinglistorvice-versa,thenamesofallthepassengersbookedonsuchPNRwill\nappearinthechart.\nAcertificatecanbeobtainedfromtheTicketCheckingStaffinthetrainregardingnon-travelingof\nwait-listedpassengersonsuchtickets.Refundscanbeobtainedthereafter.\nIfallsuchpassengersdonotwanttotravelbeforechartpreparation,onlinecancellationcanbedone\nasatpresent.However,afterchartpreparation,onlinerequestcanbesenttoIRCTCforseeking\nrefund.IRCTCwillarrangetherefundasperextantrefundrulesafterverificationofthesamefrom\nZonalRailwaysconcerned.\nThefacilityofchangeofnameandboardingpointwillalsobepermissibleone-ticketsasperextant\nprocedureapplicablefornormalPRSticketthroughRailwayReservationofficesandthesefacilities\nwillnotbeavailableonline.\n405.6.Journeywithane-Ticket(Reservation)-\nThepassengerhastonecessarilycarryanyoneofthesevenPhotoIdentitycardmentionedabove\nalongwiththeElectronicReservationSlip(ERS).IfthepassengerisnotabletocarrytheERSbutis\ncarryingtheproperIdentitycard,anexcessfareticketwillbeissuedbytheTTE/Conductoragainst\npaymentofRs.50/-perticket,providedifhisnameisavailableinthechart.Ifthenameisnot\navailableintheChart,heisnotauthorizedtoboardthetrainandthecasewillbetreatedasticketless\ntravel.\nThisElectronicReservationSlipwouldalsobetreatedasavalidauthorityforenteringtheRailway\npremisesasforanormalticketwhenaccompaniedbytherelevantphotoIdentityCard.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 51, + "text": "405.7ElectronicReservationSlip(ERS)-\nAftersuccessfulpaymentandbookingofaccommodations,theUserisshowntheticketdetailsalong\nwitha“PrintReservationSlip”Button”.OnclickingthebuttonERSisshownwithanoptiontoprint.\nThecustomerscansubsequentlyalsoprintElectronicReservationSlipfromthe'BOOKEDTICKETS'\nhistorypageandthe'CANCELTICKETS'page.\nNamesofthepassengerswhosestatusatthetimeofpreparationofchartsisfullyconfirmed/fully\nRACorcombinationthereofwillappearinthechartandtheycanundertaketheirjourney.\n405.8VirtualreservationMessage-VRMandtheMRM-Mobilereservationmessage-\nIthadbeendecidedtotreatthescreenshotofthee-ticketdisplayedthrough\nlaptops/palmtops/mobilephonesreferredtoasVirtualreservationMessage-VRMandtheMRM-\nMobilereservationmessageforticketsbookedonmobilephonescombinedwithvalidphoto-idin\noriginal,asaninstrumentonparwithElectronicReservationSlip(ERS),evenforticketsbooked\nthroughIRCTCwebsite.\nIthasnowbeendecidedtopermitShortMessagingService(SMS)sentbyIRCTC/Railways,containing\nvitaldetailsasaninstrumentonparwiththeElectronicReservationslip-ERS.\nThemandatoryfeaturesoftheauthorizedSMSareasunder:\na)SMSsentbyIRCTC/Railwayswillbeconsideredforthispurpose.\nb)TheSMSshouldcontainallthevitalticketdetailsasillustrated:\nPNR:4231009529,Train:16723,DOJ:15/07/2011,3AC,NDLStoBCT,HariKrishna+3,SI10-13,Fare:\nfl0000,SC-fl0(+PGchargesasapplicable).\nc)Alsoiffeasible,theSMSwillaccommodatethenamesofallpassengers\nbookedonthee-ticket,otherwisemaximumnumberofpassengers.\nTheauthorizedSMScontainingalltheaforementionedvitaldetailswhendisplayedthrough\nlaptops/palmtops/mobilephonescombinedwithvalidphoto-idinoriginalshallbetreatedasan\ninstrumentonparwiththeERS.\nTheERS/SMS/VRM/MRMalongwiththefollowingwill,bethecomponentsofavalidauthorityto\ntravel:-\n(i)ConfirmedRACreservation,\n(ii)ValidID-proof,and\n(iii)Appearanceofnameofthepassengersonthechart.\nTheSMSwillalsohavetobedisplayedduringthecourseofOn-board/off-Boardchecking.Ifthe\npassengerfailstoproduce/displaythisSMSduetoanyeventuality(loss,dischargedmobile/laptop,\netc)buthastheprescribedproofofidentity,apenaltyofR50/-perticketasapplicabletosuchcases\nwillbelevied.TheticketcheckingstaffOnboard/offboardwillgiveEFTforthesame.\n405.9.CancellationofE-Tickets \nE-TicketscanbecancelledonInternetatthiswebsitetillChartpreparationofthetrain.\nCancellationsarenotallowedatfacetofaceRailwayCounters.Iftheuserwishestocancelhise-\nTicket,hecandosotillthetimeofchartpreparationforthetrain(whichisnormally4hoursbefore", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 52, + "text": "thescheduleddepartureofthetrainfromthetrainoriginatingstation).Hecanlogonto\nwww.irctc.co.inandgotoBookedTicketslinkandselectthetickettobecancelledandcaninitiatethe\ncancellationbyselectingthepassengerstobecancelled.HoweveriftheIdentityCardholderinthe\noriginalticketisselectedforcancellation,allthepassengersintheticketwouldbecancelledanda\nfreshreservationwillhavetobemade,dulyincludingtheIDparticularsofanotherpassengers.\nCancellationwouldbeconfirmedonlineandtherefundwouldbecreditedbacktotheaccountused\nforbooking.Ifthereisanypartialcancellationofticket,pleaseensurethatafreshe-reservationslip\n(ElectronicReservationSlip)isprintedseparatelyasdonefortheoriginalticket.\nForanyclaimsone-ticketstobecancelledafterthepreparationofReservationcharts,theuserhasto\nsendanemailattheearliestpossibletimetoetickets@irctc.co.ingivingfulldetailsoftheticketand\nstatingtheclaim,whichwouldthenbeprocessedbyIRCTCwiththeRailwayadministrationoffline\nandrefundsassanctionedbytheRailwayadministrationwouldbecreditedbacktotheuser’saccount.\n[Reference:RailwayBoardCircularNo.-\n49/2004,49/2005,60/2005,13/2006,16/2006,21/2006,84/2007,2/2008,43/2008,56/2008,59/2008,14/\n2009,13/2010,27/2010,36/2010,36/2011,7/2012,51/2012,17/2013]\nReservationfeesforvariousclass-\nClassofTravelCharges(inRs.)SupplementaryCharges(inRs.)\nSecond(sitting) 15.00 15.00\nSleeper 20.00 30.00\nACChairCar 40.00 45.00\nAC3Tier(Economy) 40.00 45.00\nAC3Tier 40.00 45.00\nFirstClass 50.00 45.00\nAC2Tier 50.00 45.00\nAC1st 60.00 75.00\nExecutive 60.00 75.00\nNote:-Enhancedreservationfeewhichisleviedonticketsbookedforjourneyoriginatingotherthan\ntheticketbookingstationlikereturntickets,onwardjourneytickets,etc.iswithdrawn.[circular-\n20/2013]\n506.Tatkalreservation:\n1.Onproductionofeitherofthefollowingdocumentsforidentification.Passengercanobtain\nconfirmedberthsonfirst-come-firstservebasisonlyonedayinadvance.Tatkalbookingopens\nat 10AMonOnedaysinadvance actualdateofjourneyexcludingdateofjourneyw.e.f.of\n10.07.2012(commercialcircularno:43of2012).e.g.fortrainleavingon6th,TatkalBookingwill\nCommenceat10AMon5th.Tatkalticketsshallbeissuedonlyonproductionofoneoftheten\nprescribedproofsofidentityshownunder(asmentionedinCommercialCircularNo.68of2012\nissuedvideletterNo.2011/TG-I/20/P/IDdated01.11.2012)asperprocedureexplainedbelow:\n-", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 53, + "text": "a.VoterPhotoidentitycardissuedbyElectionCommisionofIndia.\nb.Passport\nc.PANCardissuedbyIncomeTaxDepartment.\nd.DrivingLicenseissuedbyRTO.\ne.PhotoidentitycardhavingserialnumberissuedbyCentral/StateGovernment.\nf.StudentIdentityCardwithphotographissuedbyrecognizedSchool/Collegefortheir\nstudents.\ng.NationalizedBankPassbookwithphotograph.\nh.Creditcardsissuedbybankswithlaminatedphotograph.\ni.UniqueIdentificationCard\"Aadhaar\".\nj.PhotoidentitycardshavingserialnumberissuedbyPublicSectorUndertakingof\nState/CentralGovernment,DistrictAdministration,MunicipalbodiesandPenchant\nAdministration.\n2.TheTatkalChargeshavebeenfixedasapercentageoffareattherateof10%ofbasicfarefor\nsecondclassand30%ofbasicfareforallotherclassessubjecttominimumandmaximumas\ngiveninthetablebelow.\nClassofTravelMinimumTatkalCharges(inRs.)MaximumTatkalCharges(inRs.)\nSecond(sitting) 10.00 15.00\nSleeper 90.00 175.00\nACChairCar 100.00 200.00\nAC3Tier 250.00 350.00\nAC2Tier 300.00 400.00\nExecutive 300.00 400.00\n*chargesarenotrefundable\n3.Theabovechargeswillbelevieduniformlybothinpeakperiod&non-peakperiods.\n4.Tatkalticketswillbeissuedforactualdistanceoftravel,insteadofend-to-end,subjecttothe\ndistancerestrictionapplicabletothetrain.ThesameTatkalberth/seatmaybebookedin\nmultiplelegstillpreparationofcharts.Atthetimeofpreparationofcharts,unutilizedportion\nmaybereleasedtotheGeneralRAC/Waitinglistpassengers.\n5.TatkalfacilityisalsoavailableinExecutiveClassofShatabadiExpresstrainsalso,by\nearmarking10%oftheaccommodationavailablei.e.5seatspercoach.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 54, + "text": "6.NoduplicateTatkalticketsshallbeissued.DuplicateTatkalticketsshallbeissuedonlyin\nexceptionalcasesonpaymentoffullfareincludingTatkalcharges.\na.Forthispurpose,aselfattestedphotocopyoftheproofofidentityofanyonepassengershall\nbeattachedtotherequisitionslip.\nb.Thedetailsoftheidentityproofshallbecapturedbythesystemandindicatedonthe\nreservedticketsaswellonthereservationchart.\n7.Itwillnotbemandatoryforthepassenger(s)togotothecountertobooktheTatkalticket,\nhowever,theproofwillhavetobesentintheaforementionedmanner.\n8.Duringthejourney,thepassenger,whoseidentitycardnumberhasbeenindicatedontheticket,\nwillhavetoproduceoriginalproofofidentityindicatedontheticket,failingwhichallthe\npassengersbookedontheticketshallbetreatedastravelingwithoutticketandcharged\naccordingly.Indicationwillcomeontheticketregardingcarryingthesameoriginalproofof\nidentityduringthejourney,asindicatedontheticket.\n9.Ifthepassengerwhoseidentitycardnumberisindicatedontheticketisnottraveling,allother\npassengersbookedonthatticket,iffoundtravelingintrain,willbetreatedastraveling\nwithoutticketandchargedaccordingly.\n10.Agents/RTSAs/Webserviceagents/WebagentsofIRCTCarerestrictedfromthebooking\nTatkalticketsbetween1000hoursand1200hours.Thisrestrictionshallbeenforcedthrough\nfrequentinspectionatthecounters.Theagentsbothwebserviceagentsandwebagentsshall\nalsoberestrictedfrombookingTatkalticketsontheinternetbetween1000hoursand1200\nhours.\n11.EvenforinternetbookingforTatkaltickets,thepassengershallentertheidentityprooftype\nandnumber,whichistobeusedfortravel.ThesedetailsshallbeprintedontheERS/indicated\nontheVRM/MRMaswellasinthereservationchart.\n12.ItwillbepossibletobookamaximumofonlyfourpassengersperPNRforTatkaltickets.\n13.ThewebservicesagentsofIRCTCwillbepermittedtobookonlyoneTatkalticketpertrainper\ndayontheinternet.\n14.ThefacilityofchangeofnameisnotpermittedonthebookingsmadeunderTatkalscheme.\n[Reference Railway Board Circular No.-\n33/2004,47/2005,48/2005,58/2005,78/2006,83/2006,60/2007,76/2007,83/2007,4/2008,26/2008,38/\n2008,40/2008,57/2008,9/2009,13/2009,27/2009,37/2009,5/2011,61/2011,62/2011,67/2011,71/2011,\n72/2011,32/2012,43/2012,67/2012,75/2012,21/2013]\n407.Inclusionofthenameofchildrenbelowtheageof5yearsintherequisitionform-\nAsperextantinstructionsthechildrenbelowtheageof5yearsnoticketsarerequired.Inthecaseof\ntrainaccident,itbecomesdifficulttoidentifyofchildrenbelowtheageof5yearswhoseparentshad\ndiedintheaccident,asnoparticularbeingavailablewithRailways.\nThefeasibilityofstoringthedetailsofthechildrenbelowtheageof5yearsinthesystemisbeing", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 55, + "text": "examined.Tillsuchtimethisprovisionismadeinthesystem,thefollowingmeasuresmaybeadopted\nbyzonalrailwaystostorethedataregardingthechildrenbelow5yearsaccompanyingthe\npassengers:-\n1.Thepassengersmaybeaskedtoindicatethename(s)ofthechild/childrenbelowtheageof5\nyears,whowillbeaccompanyingthemduringthejourney,intherequisitionformsubmittedatthe\ntimeofseekingreservation,thesenamewillnotbefedinthecomputerbutkeptasrecord.\n2.Thepassengersmayalsoberequestedtogivethename(s)ofthechild/childrenbelowtheage\nof5yearsaccompanyingtheminthetraintotheTrainConductorwhowillkeepanoteofthisin\ntheReservationChart.\nChapter-5\nRefundRules\nTheserefundrulesareuniformlyapplicabletotheticketsofalltrainsexcludingRajdhani\nexpressandShatabadiexpresstrainandalsoforcircularjourneytickets.\n501.Shorttitleandcommencement-\n1.Theserulesmaybecalledtherailwaypassengers(cancellationofticketsandrefundoffares)", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 56, + "text": "rules.1998.\n2.Theyshallcomeintoforcewitheffectfrom1stdayofOctober1998.\n502.Definitions-\nIntheserulesunlessthecontextotherwiserequires:\ni.‘Clerkage’meansachargeleviedfortheclericalworkrenderedintherefundoffares.\nii.‘Destinationstation’-meansthestationforwhichthetickethasbeenissued.\niii.“RACticket”meansaticketonwhichaseathasbeenreservedagainstrequisitionfora\nberthandaberthmaybesubsequentlyprovidedagainstcancellation,ifany.\niv.“Fare”includesbasicfaresupplementarychargeonsuperfasttrainsandreservationfee.\nv.“Reservedticket”meansjourneyticketsonwhichaberthorseathasbeenreserved:\nvi.“Reservationfee”meansthechargeinadditiontothefare,leviedbytherailway\nadministrationforthereservationofaberthorseat.\nvii.“Station”meansarailwaystationandincludesanyreservationofficeorbookingoffice,\ninthesamecity.\nviii.“Stationmaster”meansarailwayemployeebywhatevernamecalledhavingoverall\nchargeofarailwaystationandincludesanyotherrailwayemployeeauthorizedtogrant\nrefundoffareatastation.\nix.“Ticket”meansasinglejourneyticketoranyhalfofareturnticketandexcludesseason\nticket,Indrailpassticketandspecialticketforareservedcarriageoratourist\ncar/saloonoraspecialtrain.\n503.Stationmastertorefundfares:\n1.Subjecttotheotherprovisionoftheserules,everyrefundoffareonunusedunreserved\nticketshall,whensuchticketispresentedforrefundoffaretothestationmasterofticket\nissuingstation,begrantedbysuchstationmasterafterverifyingthegenuinenessofthe\nticketsfromtherecordofthestation.\n2.Subjecttotheotherprovisionoftheserules,everyrefundoffareonreservedtickets,RAC\nticketsandwait-listedticketsshall,whensuchticketsarepresentedforrefundoffareto\nthestationmasterofticketissuingstation,begrantedwithinthetimelimitsprescribedin", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 57, + "text": "theserules,bysuchstationmasterafterverifyingthegenuinenessoftheticketsthrough\ncomputerorfromtherecordofthestationprovidesthat:-\na)Incaseofticketswhichwereissuedfortravelfromastationotherthantheticket\nissuingstation,refundoffareshallbeadmissibleat:-\ni.Theticketissuingstation,iftheticketissurrenderedbeforethescheduled\ndepartureofthetrainfromthestationfromwheretheticketinvalidfor\ntravel;and\nii.Thejourneycommencingstation,iftheticketsissurrenderedwithinthetime\nlimitsprescribedintheserules,and\nb)Refundoffaremayalsobegrantedbythestationmasterofastationotherthanthe\nticketissuingstationandjourneycommencingstationsubjecttotheconditionsthat:\n-\ni.Theticketissurrenderedforrefundoffareduringworkinghoursofthe\nresonationofficeandbeforethepreparationofreservationchart,ofthe\nconcernedtrain,forthestationfromwheretheticketisvalid;and\nii.Thegenuinenessoftheticketanditsparticularsareverifiableattherefund\ngrantingstationthoughcomputerorfromrecordofthestation\niii.Iftheconditions(i)and(ii)abovearenotfulfilled,aticketdepositreceipt(TDR)\nwillissuedtothepassengersandrefundmaybegrantedbyCCM(Refund)of\nticketissuingrailwayonapplication.\n504.LevyofClerkageCharges-\nSubjecttotheotherprovisionsoftheserulesRs.15clerkagechargesperpassengerwillbe\nleviedforthecancellationofunreservedticketsandRs.20clerkagechargesperpassengerwillbe\nleviedforwaitinglistandRACtickets.\n505.RefundonUnusedUnreservedticket:\n(1)Subjecttotheprovisionoftheserules,ifaticketonwhichreservationofaseatorberthhasbeen\nmade,ispresentedforcancellation,refundoffareshallbemadeafterdeductingcancellationcharge\nfromthefareasfollows:\n(a)Ifaticketispresentedforcancellationmorethan24hoursbeforethescheduleddepartureofthe\ntraincancellationchargeshallbedeductedattheflatrateofRs.120/-forA.CFirstClass/Executive\nClass,Rs.100/-forA.C.2TierClass/FirstClass,Rs.90/-forA.C.3TierClass/A.CChairCar,Rs.60/-for", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 58, + "text": "SleeperclassandRs.30/-forSecondclass.\n(b)Iftheticketispresentedforcancellationwithin24hoursanduptofourhoursbeforethe\nscheduleddepartureofthetrain,cancellationchargesshallbe25%ofthefaresubjecttothemin.flat\nratementionedinclause(a).\n(c)Iftheticketispresentedforcancellationwithinfourhoursbeforethescheduleddepartureofthe\ntrainandupto:\n1.Threehours,whentheticketisforadestinationstationupto200KM.,\n2.Sixhours,whentheticketisforadestinationstationofmorethan200KMbutupto500KM.,\nand\n3.Twelvehours,whentheticketisforadestinationstationofmorethan500KM.,\nAftertheactualdepartureofthetrain,cancellationchargesshallbe50%ofthefaresubjecttothe\nmin.flatratementionedinclause(a).\nProvidedthatfornighttrainleavingbetween21:00hoursand06:00hours(actualdepartures),\nrefundsshallbeadmissibleatthestationwithinthetimelimitspecifiedaboveorwithinfourhours\naftertheopeningofreservationoffice,whicheverislater.\n(2)Norefundsshallbegrantedatthestationiftheticketissurrenderedforcancellationafterthe\nexpiryoftheperiodmentionedunderclause(c)ofsubrule(1).\nNote:(1)Inthecaseofticketsissuedfortravelfromsomeotherstationsrefundsshallbeadmissible\nattheticketissuingstationprovidedthattheticketissurrenderedbeforethescheduledepartureof\nthetrainfromthestationfromwheretheticketisvalid.\n(2)Onaparty/familyticketissuedformorethanoneperson,wheresomepersonshaveconfirmed\nreservationsandothersareonwaitinglist,fullrefundlessclerkagechargesisadmissiblefor\nconfirmedpassengersprovidedthattheentireticketissurrenderedforcancellationatthejourney\ncommencingstationwithinfourhoursbeforethescheduleddepartureofthetrainanduptothree\nhoursafteractualdepartureofthetrain.\n506.Refundonunusedreservedticket:\n(1A)Subjecttoprovisionsofsubrule(2),nocancellationchargesshallbepayableifawait-listedor\nRACticketispresentedforcancellationupto:\n(i)Threehours,whentheticketisforadestinationstationupto200KM.\n(ii)Sixhours,whentheticketisforadestinationstationofmorethan200KMbutupto500KM.,and\n(iii)Twelvehours,whentheticketisforadestinationstationofmorethan500KM.,\naftertheactualdepartureofthetrainexceptforadeductionofaclerkagechargeofRs.30/-per\npassenger.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 59, + "text": "Providedthatfornighttrainleavingbetween21:00hoursand06:00hours(actualdepartures),\nrefundsshallbeadmissibleatthestationwithinthetimelimitspecifiedaboveorwithinfourhoursof\nopeningofthereservationoffice,whicheverislater.\n(2A)WhereconfirmedreservationhasbeenprovidedtoRACorwait-listedticketholderatanytime\nuptothefinalpreparationofreservationchart,suchticketshallbetreatedasareservedticketand\ncancellationchargesshallbepayableinaccordancewithrulesmentionedabove.\nNote:\n1.Refundoffareonreserved,RACandwaitlistticketsisgrantedwhenticketsaresurrendered\nforrefundtothestationmasterofissuingstation.\n2.Refundwillbegrantedwithinthetimelimitsprescribedintherules.\n3.Stationmaster,afterverifyingthegenuinenessoftheticketsthroughcomputerorfrom\nrecordsatthestation,willrefundtheamountasapplicable.\n506.1.Refundatticketissuingandjourneycommencementstationissame:\n1.Whenticketsarepresentedforrefundoffaretostationmaster.\n2.Whenticketispresentedwithinthetimelimitsasperrules.\n3.Afterverifyinggenuinenessofthetickets.\n506.2.Journeycommencementstationisotherthanticketissuingstation.\n1.Refundwillbearrangediftheticketsaresurrenderedbeforedepartureofthetrain.\n506.3.Refundofticketatotherthanticketissuingstationandjourneycommencementstation:\n1.Whenthereservedticketissurrenderedduringworkinghoursandbeforepreparationof\nreservationcharts.\n2.Afterverifyingthegenuinenessoftheticket.\n507.Refundoffareundernormalcircumstances-\nS.N\no\nTypeofticketTimelimitforcancellation Cancellation\ncharges/refundable\namount\n1Unused\nunreservedticket\nWithin3hrsafteractualdepartureof\ntrain\nRs.10/-perpassenger.2Unused/unreserve\ndticketvalidfor\ntheday\nWithin3hrsafteractualdepartureof\nlasttrainofthedaytodestination\n3Unused/reserved\ntickets\n(A).Morethan24hrsinadvanceof\nthescheduleddepartureofthetrain.\nMinimumcancellation\nchargeof\nRs.120/-IAC/Executive", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 60, + "text": "class\nRs.100/-2AC/1stCL\nRs.90/-3AC/ACCC\nRs.60/-Sleeper\nRs.30/-IIClassSeat\n(B).Lessthan24hrsinadvanceand\nupto4hrsbeforethescheduled\ndepartureofthetrain.\n25%offaresubjecttothe\nminimumcancellation\nchargesasabove\n(C).Within4hrsbeforethescheduled\ndepartureofthetrainand.\nAfterdepartureoftrainforadistance\nkms\nUpto3hrs upto200\nUpto6hrs 201to500\nUpto12hrs above500\n50%offaresubjecttothe\nminimumcancellation\nchargesasabove\n4.UnusedRAC/wait\nlistticketUpto3hrs upto200\nUpto6hrs 201to500\nUpto12hrs above500\nRs.30/-IAC/Executiveclass\n2AC/1stCL,3AC/ACCC,SL\nRs.15/-IIClassSeatwillbe\nleviedasclerkagecharge\n5Unusedreserved\nticketsconfirmed\nforapartofthe\njourney\nTimelimitasapplicableforreserved,\nRAC,waitlistticketsasmentioned\naboveaccordingtothereservation\nstatusofthefirstlapofthejourney\nFirstlapofthejourneyisconfirmed\nFirstlapofjourneyisRAC/waitlist\n(a).Cancellationcharges\nwilldependontimeof\ncancellationanddistanceas\napplicabletoreservedticket\nforentirejourney\n(b).Rs.20/-perpassenger\nasclerkagewillbeleviedfor\ntheentirejourney\n6.Refundontickets\nwheresome\npassenger’sare\nconfirmedand\nothersareRAC/\nwaitlisted.\nTicketscancelledwithin4hrsbefore\nthescheduleddepartureofthetrain\nandupto3hrsaftertheactual\ndepartureofthetrain\nOnlyclerkagechargesofRs.\n20/-perheadwillbe\ndeductedonallconfirmed&\nRACorwaitlistpassengers\n7.Refundon\ncancellationof\njourneymodified\nticket\n(a).Onpreponed/postponedor\nchangeofclassticketswhere%on\noriginalfaresarenotcollectedas\nmodificationcharge.\n(b).Ifmodificationchargesare\ncollectedat25%or50%oforiginal\nfares,onlyoncancellationchargeon\nmodifiedjourneyticketiscollected\n(a)Twocancellationcharges\n,oneasondateof\npreponementor\npostponementanddateof\nrevisedjourney,theotheras\nondateofrevisedjourney\nanddateofcancellation\n(b).onlyonecancellation\nchargesiscollectedaonthe\ndayofactualcancellation\nNote:fornighttrainsleavingbetween21hrsto6hrs(actualdeparture)refundshallbe\nadmissibleatthestationwithinthetimelimitsspecifiedaboveorwithin4hrsaftertheopening\nfreservationoffice,whicheverisearlier\n508.RefundofFareunderAbnormalCircumstances-\nS.TypeofticketTimelimitforcancellation Cancellation", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 61, + "text": "No charges/refundableamount\n1Laterunningof\ntrainbymore\nthan3hrs\nAftertheactualdepartureofthe\ntrainatjourneycommencing\nstationupto3/6/12hrsof\ndistancesof200/500/above500\nkms\nFullfareisrefundedwithoutany\ndeduction.\n2Inabilityofthe\nrailwaysto\nprovide\naccommodation\ntoreserved\npassengers\nWithin3hrsaftertheactual\ndepartureofthetrainatthe\njourneystartingstation.\nFullfarerefundedwithoutany\ndeduction\n3FailureofAC\nequipment\nWithin20hrsofactualarrivalof\nthetrainatdestination\nclassRefundableamount\nIAC/\nExecutiv\neclass\nDifferenceoffare\nbetweenIAC/EC&FC\nM/E\n2AC/3A\nC\nDifferenceoffare\nbetween\n2AC/3AC&SLM/E\nACCCDifferenceoffare\nbetweenACCC&II\nCLASSM/E\n4.Travellingin\nlowerclassfor\nwantof\naccommodation\nWithin2daysofactualarrivalof\nthetrainatdestination.\nDifferenceoffarebetweenfare\npaidandthefareofclass\ntravelled\n5Changeoftrain\ntimingstoearlier\nhoursotherthan\nspecifiedinthe\ntimetable\nAftertheactualdepartureofthe\ntrainandwithin3hrsoftheold\ndepartureoftime.Availablefor7\ndaysonlyfromthedateofchange\noftime\nFullfarelessclerkagechargeof\nRs.20perpassenger.\n6.Missingof\nconnectionof\noutwardjourney\nduetolate\nrunningof\nconnectingtrain\nWithin3hrsofactualarrivalof\ntrainbywhichthepassengerhas\ntravelled.\nFullfareofuntraveledportion\nafterretainingthefareforthe\ntravelledportionwithoutCC.\n7.Dislocationof\ntrainservice\nenroute\nRefundwillbegrantedatthe\nstationwherethejourneyis\nterminated\n(i).Inabilityof\nRailwaysto\nmakealternate\narrangements\n(I).fullfarefortheentirebooked\njourneywithoutclerkage\n(II).Passenger\nnotwillingto\nmakeuseof\nalternative\narrangements\nprovided\n(ii).Fullfareforuntraveled\nportionafterretainingthefare\nfortravelledportionwithoutcc.\n(III).Bandh,", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 62, + "text": "Railrokoetc. (ii).Fullfareforuntraveled\nportionafterretainingthefare\nfortravelledportionwithoutcc.\n8Cancellationof\ntraindueto\naccidents,\nbreaches,floods\netc.\nWithin3daysofthescheduled\ndepartureofthetrain\nFullfarefortheentirebooked\njourneywithoutcc.\n9Death/Injurytoa\npassengerina\nrailwayaccident\nWithin3daysofthescheduled\ndepartureofthetrain\nFullfarefortheentirebooked\njourneywithoutcc.\n509.RefundonunusedwaitlistedorRACTickets:\n1.Subjecttoprovisionofsubrule(6)nocancellationchargeshallbepayableifaWLorRAC\nticketispresentedforcancellationexceptclerkagecharges.\nI.Upto3hours,whentheticketisforadestinationupto200kms,\nII.Upto6hours,whentheticketisforadestinationstationexceeding200kmsbutupto\n500kms,and\nIII.Upto12hours,whentheticketisforadestinationstationexceeding500kms\nAftertheactualdepartureoftrainexceptforadeductionofclerkagechargeofRs.20/-per\npassenger.\nProvidedthatthenighttrainsleaving21.00hoursand6.00hours(actualdeparture),refund\nshallbeadmissibleatthestationwithinthetimelimitspecifiedaboveorwithinfirst2hours\naftertheopeningofreservationoffice.\n2.WhereconfirmedreservationhadbeenprovidedtoRACorWLticketholderatanytimeupto\nthefinalpreparationofreservationcharts,suchticketshallbetreatedasreserved,and\ncancellationchargeshallbepayableinaccordancewithrule-6.\n3.a)Thisruleisapplicableonsinglejourneytickets.\nb)Incaseofticketissuedfortravelfromsomeotherstation,refundbeadmissibleatthe\nticketissuingstationprovidedthattheticketissurrenderedbeforethescheduleddeparture\noftrainfromthestationfromwheretheticketisvalid(forWLorRACtickets).\n510.CancellationofpartlyconfirmedandpartlyRAC/Waitlistedtickets-\nInsuchcases,cancellationchargeswillnotbeleviedandonlyclerkagechargeswillbe\ncollectedfromconfirmedpassengersalsoprovidedtheentireticketissurrenderedfor", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 63, + "text": "cancellationatjourneycommencingstationwithin4hrsbeforethescheduleddepartureofthe\ntrainandupto3hrsafteritsactualdeparture.\n511.Postponementorpreponementofjourneyonareserved,RACorwaitlistedticket-\n511.1.Postponementofjourney:\n(a)ConfirmedTickets:Postponementofjourneyonconfirmedticketsshallbeallowedinthe\nsameoranyhigherclass,byanysubsequenttrainonthesamedayoranysubsequentday,for\nsameoranylongerdestination,providedthat:\n(i)confirmedorRACorwaitinglistaccommodationisavailableinthetraininwhichfresh\nreservationisrequired;\n(ii)freshreservationfeefortheclassforwhichreservationisrequiredispaid,incaseoftickets\nsurrenderedduringworkinghoursandatleasttwentyfourhoursbeforethescheduled\ndepartureofthetraininwhichoriginallybooked;\n(iii)25%fareofalreadybookedticketispaidascancellationcharges,incaseoftickets\nsurrenderedduringworkinghoursandwithintwentyfourhoursandfourhoursbefore\nscheduleddepartureofthetraininwhichoriginallybooked;\n(iv)50%fareofalreadybookedticketispaidascancellationcharges,incaseofthetickets\nsurrenderedduringworkinghoursandwithinfourhoursbeforethescheduleddepartureand\nuptothemaximumtimelimitsmentionedinrule6(i)(c)ofRefundRulesafteractualdepartureof\nthetraininwhichoriginallybooked.\n(b)RACandWaitlistedTickets:PostponementofjourneyonRACandWaitlistedTicketsshallbe\nallowedinthesameorhigherclass,byanysubsequenttrainonthesameoranysubsequentday,\nforsameoranylongerdestination,providedthat-\n(i)confirmedorRACorwaitinglistaccommodationisavailableinthetraininwhichfresh\nreservationisrequired;\n(ii)ticketissurrenderedduringworkinghoursanduptothemaximumtimelimitsmentionedin\nrule6(i)(c)ofRefundRulesafteractualdepartureofthetraininwhichoriginallybooked;\n(iii)Clerkagechargeispaid.\n511.2.Preponementofjourney:Preponementofjourneyonconfirmed,RACandwaitlistedtickets\nshallbeallowedinthesameoranyhigherclass,byanyearliertrainonthesamedayorany\nearlierday,forsameoranylongerdestination,providedthat:-\n(a)confirmedorRACorwaitinglistaccommodationisavailableinthetraininwhichfresh\nreservationisrequired;\n(b)theticketissurrenderedduringtheworkinghoursofthereservationofficeandatleastsix\nhoursbeforethescheduleddepartureofthetraininwhichreservationisrequiredorbefore\npreparationofthereservationchart,whicheverislater;", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 64, + "text": "(c)freshreservationfeefortheclassforwhichreservationisrequiredispaid,incaseof\npreponementonconfirmedtickets;and\n(d)Clerkagechargeispaid,incaseofpreponementonRACandwaitlistedtickets;\nExplanation:-\nIncaseofdifferenceoffare,betweentheclassofatrainonwhichtheticketwasoriginally\nreservedandthesameclassofatrainonwhichthepreponementorpostponementis\nprovided,thechangeofreservationshallbemadesubjecttorefundorrecoveryofthe\ndifferenceasthecasemaybe.\nPreponementorpostponementofjourneyshallbeallowedonlyonce.\nThePostponementorPreponementofnormaltrainticketjourneyswillnotbeapplicable\nagainstTatkalQuotaevenonpaymentofTatkalcharges.\nIftheticket,onwhichjourneyhasbeenaltered,iscancelled,cancellationchargesshallbe\npayableasindicatedinRefundRules.\n512.ChangeofjourneyfromLowerclasstoHigherClass:\na.Changeofreservationisallowed,withoutlevyinganycancellationchargeonareservedticket\noflowerclassforhigherclassonthesametrainanddayorwhenreservedforaseatinaclass\nforreservationofaberthinthesameclassonthesametrainandday,providedthat:\ni.Accommodationisavailable,and\nii.Therequestforchangeismade-\n1.Eithertheworkinghoursofreservationofficeandupto6hoursbeforethe\nscheduleddepartureofthetrain,or\n2.Duringthecourseofjourneyinthetrain.\nb.Nochargeswillbecollectedifreservedticketischangedtohigherclassundertheupgradation\nscheme.\nNote:\n1.Freshreservationfeeshallberealizedwhentheticketispreponedorpostponedorchangeto\nhigherclassorchangefromseattoberth.InthecaseforticketslikeRajdhaniandShatabdi\nExpress,wherethefareisinclusiveofallcharges,freshreservationfeeasapplicableforthe\nparticularclassforwhichtheticketisissued,willbecollected.\n2.Thechangereferredtoundersub-rule(1)shallbeallowedonlyonce.\n3.Iftheticketonwhichthechangeofreservationhasbeenallowedundersub-rule(1)is\ncancelled,cancellationchargeshallbepayableasfollowsnamely:\na.Cancellationchargesaswouldhavebeendueiftheoriginalreservationhadbeen", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 65, + "text": "cancelledatthetimewhenthechangeofreservationallowed,and\nb.Cancellationchargedueinrespectofalteredreservationasifthisalteredreservationis\nfreshreservation.\nExplanation:regardingchangeofticketfromlowertohigherclassorfromseattoberth,notimelimit\nhasbeen\nprescribedbecausesuchrequestforchangecanbemadeevenatthelastmomentorin\ntrain.\n513.Noncommencementofjourneyduetolaterunningoftrains:\n1.Nocancellationchargeorclerkageshallbeleviedandfullfareshallberefundabletoall\npassengersholdingReserved,RAC,andWaitlistedtickets,ifthejourneyisnotundertakendue\ntolaterunningofthetrainbymorethan3hoursofthescheduleddepartureofthetrainfrom\nthejourneycommencingstationprovidedthattheticketissurrendereduptothemaximum\ntimelimitsprescribedinclause(c)ofsub-rule(1)ofrule6.Whichisgivenbelow:\nFullrefundwillbepermittedevenafterthedepartureoftrainintheeventoftrainrunning\nmorethan3hourslateandthatthetimelimitswillbeupto3hoursifthedistanceoftheticket\nisupto200Kms.,upto6hoursifthedistanceoftheticketis201-500Kms.andupto12hours\nafterthedepartureofthetrainifthedistanceoftheticketismorethan500Kms.\n2.Whereapassengerholdingaticketwithorwithoutreservation,missesconnectionatany\njunctionstationduetolaterunningofthetrainbywhichhehadtravelled,thefareforthe\nuntraveledportionshallberefundedafterretainingthefarefortravelledportionwithout\ncharginganycancellationchargeatsuchjunctionstationifhesurrenderstheticketforsuch\nrefundwithin3hoursofactualarrivalofthetrainbywhichhehastravelled.\n514.RefundduetoRailwaysinabilitytoprovidereservedaccommodation:\nUndertheserulespassengersholdingreservedticketsareentitledforfullrefund.\nProvidedthatsuchticketsaresurrenderedforrefundwithin3hoursfromactualdepartureof\ntrain.\nProvidedfurtherthatwhenthetrainiscancelledduetounforeseencircumstancesuchas\naccidents,breachesorflood,theticketissurrenderedwithin3daysexcludingthescheduled\ndateofthedepartureoftrain.\n515.Partiallyusedtickets:\n1.Exceptasprovideintheserules,norulesshallbegrantedatastationonaticketonwhichpart\nofthejourneyhasbeenundertaken.\n2.Whereaspassengerterminatesjourneyenroute,aticketdepositreceiptshallbeissuedtothe", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 66, + "text": "ticketholderbythestationmasterofthestationinlieuofsurrenderofticketandticketholder\nmayapplytochiefcommercialmanager(refund)oftheticketissuingrailwayenclosingthe\nticketdepositreceiptinoriginalforrefundoffare.Thefareforuntraveledportionshallbe\nrefundedafterretainingthefarefortravelledportion.\n516.Ticketdepositreceipt(TDR)\n1.Whenrefundcannotbegrantedatstation,TDRisissuedtothepassenger.\n2.AlltherailwaysforunusedandpartiallyusedticketswillissueonlyonestandardTDR.\n3.TDRisinformofamachinenumberedbookwiththreefoilsnamely,\na.Passengerb.CCMC.Record\n4.Passengerfoilcontainsguidelinesforpassengerandtheothertwofoilscontaininstructionsto\ntherailwaystaff.\n5.TicketcollectororstationmasterwillissueTDR.AtimportantstationsTDRbooksareavailable\natrefundcounters.\n6.TDRcanbeobtainedbypassengerupto30daysfromthescheduleddepartureofthetrain.\n7.TDRispreparedthroughcarbonprocess.TheTDRissuingstaffwillcanceltheticket&write\nTDRnumberontheticket,cancelledticketsmustnotbegiventopassenger,thepassengerfoil\nofTDRishandedovertothepassenger.\n8.TheCCMfoilofTDRalongwithcancelledticketwillbesenttoCCM(Refunds)within15\ndaysfromthedateofissuethroughaspecialmessenger.\n9.NoTDRshouldbedispatchedtoCCM`sofficewithoutfillinginthecolumns.\n10.TDRmustnotbeissuedwhenrefundisadmissibleatstation.\n11.OnthebackofpassengerfoilofTDR,anapplicationisprinted.Thepassengermustfillthe\napplicationandapplytoCCM(refunds)forrefundwithin90daysfromthescheduledjourney\ndate.\n12.Ontheapplicationthepartycanpreferthemodeofpaymentintheformofstationpayorder/\ncheque/moneyorder.\n13.Railwaysshoulddisposecaseswithin16days.However,thecaseissettledwithin3months\nfromthedateofreceiptoforiginalTDRfromtheparty.\n14.Ifrefundisnotadmissiblethereasonsmustbeconveyedtothepassenger.\n517.Discontinuationofjourneyduetodislocationoftrainservice:\n1.Whenatrainjourneyisdislocatedenrouteduetounforeseenevents,suchasaccidents,\nbreachesandfloods,fullfarefortheentirebookedjourneywithoutanydeductionforthe\ntravelledportionandwithoutlevyofcancellationchargeshallberefundedatthestationat\nwhichjourneyisterminatedunderthefollowingcircumstance:-\na)Wheretherailwayisunabletocarrythepassengertothedestinationstationwithina", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 67, + "text": "reasonabletimebyarrangingtransshipmentordiversionorotherwise;or\nb)Whenthepassengerisinvolvedinrailwayaccidentand/orinjuredintheaccidentanddoes\nnotcontinuehisjourney;or\nc)Inthecaseofdeathorinjurytoapassengerinarailwayaccident,theKithandkinofthe\npassengerhavetoterminatetheirjourney.\n2.Wheretherailwayadministrationofferstocarrythepassengertohisdestinationstationbyany\ndivertedrouteorbyarrangingtransshipmentorotherwiseandthepassengerisnotwilltoavailof\nsuchalternativearrangement,farefortheuntraveledportionofthejourneyshallberefundedafter\nretainingthefarefortravelledportionwithoutcharginganycancellationchargesatthestation\nwherethejourneyhasbeenterminated.\n3.Wherethetrainjourneyisdiscontinuedenrouteduetobandhs,agitationsorRailroko,farefor\ntheuntraveledportiononlyshallberefundedafterretainingthefarefortravelledportionwithout\nthelevyofanycancellationcharges.\n4.Ifthetrainswhichhaveseparateallinclusivefarestructureonpointtopointbasisare\nterminatedatanonscheduledstoppageofthetrainandthepassengerisnotwillingtoavailofthe\nalternativearrangementbyrailwayadministrationtocarrythepassengertohisdestinationstation,\nfarefortheuntraveledportionshallberefundable.Insuchcases,fareforthedistancetravelledwill\nberetainedbasedontheperkilometerfareofticketandbalanceamountshallberefundableasthe\nfareforuntraveledportionofjourney.\n518.FailureofAirConditioningequipment:\n1.WheretheAChasnotworkedtheportionofjourney,refundontheticketsissuedforAC\ncoachesshallbegrantedforsuchportiononthefollowingbasis-\ni.IftheticketisforAC1stclass,thedifferencebetweentheAC1stclassfareand1stclass\nM/Efare.\nii.IftheticketisforAC2nd/ACSleeperclass,thedifferencebetweentheAC2nd/ACSleeper\nclassfareand2ndclasssleeperM/Efare.\niii.IftheticketisforACChairCar,thedifferencebetweentheACChariCarfareand2nd\nclassM/Efare.\n2.Therefundofdifferenceoffaregrantedundersubrule(1)shallbegrantedatdestination\nstationontheproductionofticketalongwithacertificatefromconductororguardorthe\ntravellingticketexaminerofthetraingivingparticularsofticketnumber,numberofthecoach\nandstationsbetweenwhichAChadnotworkedandispresentedwithin20hoursofthearrival\nofthetrain\n519.Whenthepassengersaremadetotravelinalowerclassforwantofaccommodation:\n1.Iftheticketholderofahigherclassismadetotravelinalowerclassforwantof", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 68, + "text": "accommodationintheclassforwhichtheticketisissued,refundofthedifferencebetweenthe\nfarepaidandthefarepayablefortheclassinwhichitisactuallyusedshallbegrantedat\ndestinationstationorattheoriginatingstation,asthecasemaybe.\n2.Providedthatrefundshallbegrantedatdestinationstationonlyonproductionofacertificate\nfromtheconductorortheguardorthetravellingticketexaminerofthetraincertifyingthe\nholderofthetickethadtotravelinalowerclassforthewantofaccommodationintheclass\nforwhichitwasissuedandticketispresentedwith20hoursofthearrivalofthetrainatthe\ndestinationstations.\n520.Refundonlost/misplacedtickets:\n1.Norefundispermissibleagainstlost/misplacedtickets.\n2.Howeverpassengerwillbeallowedtotravelonthereservationalreadymadeonconfirmed\noneorRAC\n3.Ifthelossofconfirmed/RACticketisreportedbeforethepreparationofthereservationchart,\nduplicateticketwillbeissuedonthecollectionoftheclerkagechargeperpassenger.\n4.Ifthelossofconfirmed/RACticketisreportedafterthepreparationofthereservationchart,\nduplicateticketwillbeissuedonthecollectionofthe50%ofthefare.\n5.NoduplicateticketwillbeissuedafterthepreparationofreservationchartincaseofRAC\nticket.\n6.Lossofticketsbereportedtorailwaysimmediatelytopreventfraudulentrefundsonlost\ntickets.\n521.WaitListedPassengersonconcessionandPrivilegeTicketOrder(PTO):\nWhenanypersonhadpurchasedaticketonanyconcessionalorderorprivilegeticketorder,\nandiswaitlistedforreservationinanytrainheshallbeentitledtoavailofthesameticketfor\nreservationinanyothertrainonsamedateoranyotherdatewithoutlosingthebenefitof\nconcessionalfare.\n522.Unusedportionofreturnticket:\n1.Norefundshallbegrantedonunusedportionoftheconcessionalreturntickets.\n2.Whenareturnticketisissuedwithoutanyconcessionitshallbetreatedliketwosinglejourney\nticketsandrefundshallbegrantedaccordingly.\n523.Refundonticketsonwhichluggageisbooked:\nRefundoffareonunusedticketsonwhichluggageisbookedandjourneyisnotundertaken,\nthanluggageticketwillbecancelledandfreightwillberefundedafterrecoveryofwarfage\nchargesifanyanddeductionofcancellationchargesofRs.10/-perluggageticket.Journey\nticketshallbeendorsedtotheeffect.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 69, + "text": "Onproductionofjourneyticketthefarewillberefunded,ifbearingtheendorsementafter\ndeductingthecancellationchargesasperrules.\n524.Refundonduplicateticket:\nRefundisnotgrantedwhentheduplicateticketisissuedbeforepreparationofchart\nWhenlostormisplacedticketistracedafterissueofduplicateticketandpresentedbefore\ndepartureoftrain,refundonduplicateticketisallowedafterdeducting5%offaresubjecttoa\nminimumofRs.25/-.\nIncasejourneyisalsonotundertakenthecancellationchargesonoriginalticketwillbe\ndeductedasperrules.\nIfpassengerpaysexcesschargeontrainonaccountoflostreserved/RACticket,50%offare\nwillberefundedonapplicationtoCCM,ifnobodyhastakenrefundontheoriginalticket.\nThechargescollectedtowardsduplicateticketshallnotberefundedatdestinationstation.\n525.Refundtothepersonwhodidnottravelonacombinedticket\nWhenitisknownbeforecommencementofjourneythatlessnumberofpersonswillbe\ntravellingonagroupticket,theoriginalticketshallbecollectedatthestationandafree\nexcessfareticketisissuedfortheremainingpassengers.Refundforthepersonsnottravelling\nshallbegrantedatthestationitselfafterdeductingtheusualcancellationcharges.\nIncaseofUTS/SPTMticketsthecancellationchargesshallbeleviedonthepassengersnot\ntravellingandfreshticketshallbeissuedforthepassengersnottravelling.\nIncaseofpassengercouldnotclaimrefundbeforethecommencementofjourneyand\napproachtheTTE/CORofthetrain,TTE/CORshallissuetheguardcertificatetothepassenger\nforpersonsnottravellingsoastoenablehimtoclaimrefundfromCCM(refunds)office.In\nadditiontheywillalsomakenecessaryendorsementinthisregardontheticketaswellinthe\nreservationchartexceptincaseofE-tkt.\nNote:Refundcanbeclaimedupto30daysatdestinationitselfundercomputerizedcoaching\nrefundsscheme,ifPRScountersareavailable.\n526.Refundonticketsuptothevalueofclerkagecharges:\nInsuchcasesnorefundwillbeadmissibleoncancellationorsurrenderingofsuchtickets.\n527.RefundonpartiallyusedticketsbyRajdhani/Shatabaditrains:\nSincethefareforRajdhani/Shatabaditrainsisonpointtopointbasis,breakjourneyontickets\nforthesetrainsisnotpermittedhencenorefundisadmissible.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 70, + "text": "528.Refundonmissingtrainduetochangeintraintimings:\nAttimesduetochangeintimetable(scheduledormid-termdeparturetimeofcertaintrains\nareadvanced,insuchcasesifthepassengermisstheconcernedtrainforwhichreservation\nhasbeenmademaybegrantedfullrefundprovidedtherefundisclaimedafterthedeparture\nofthetrainaspertheoldtimings.Clerkagechargesiscollected,thisfacilitywillbeavailable\nforaperiodofsevendaysfromwhichthetraintimingshasbeenchanged.\n529.RefundonTatkalticket:\nNorefundwillbegrantedoncancellationofconfirmedTatkaltickets/duplicateTatkalticketexcept\nincaseofcircumstancesmentionedinPara2ofinstructionscontainedinCommercialCircularno.53\nof2006issuedvideletterno.2006/TGII/20/P/Tatkal,dated30.06.2006.\n(1)FullrefundoffareandTatkalChargeswillbegrantedontheticketsbookedunderthis\nschemeinthefollowingcircumstances:\nIfthetrainisdelayedbymorethan3hoursatthejourneyoriginatingpointofpassenger\nandnottheboardingpointifthepassenger'sjourneyoriginatingpointandboarding\npointaredifferent.\nIfthetrainistorunondivertedrouteandthepassengerisnotwillingtotravel;\nboardingstationorthedestinationstationorboththestationsarenotonthediverted\nroute\nIncaseofnonattachmentofcoachinwhichTatkalaccommodationhasbeenearmarked\nandthepassengerhasnotbeenprovidedaccommodationinthesameclass.\nIfthepartyhasbeenaccommodatedinlowerclassanddoesnotwanttotravel.Incase\nthepartytravelsinlowerclass,thepassengerwillbegivenrefundofdifferenceoffare\nandalsothedifferenceofTatkalchargesifany.\nThebookingunderTatkalschemewillbedoneonlyfromtheoriginatingtoterminating\npointofthetrainwithboardingfacilityfromintermediatestation.Howeverzonal\nrailwayshavebeengiventhediscretionsofimposingrestrictionsonTatkalbooking\nregardingdefiningtrainsasendtoendorkeepingitfreeorimposingdistance\nrestrictionetc.Keepinginviewtheoverallutilizationoftheaccommodationsavailable\ninthetrain  \n3.  Norefundwill,however,bepermissibleonthereservationsmadeunderTatkalschemein\ncasethecoach,inwhichaccommodationunderTatkalschemehasbeenearmarked,isnot\nattachedandtheaccommodationhasbeenprovidedtotheTatkalpassengersinthenormal\ntrainservicesinthesameclass.\n4.Tatkalwaitlistedtickets(whichwerenotconfirmed)shallbegrantedrefundonparwith\nthejournalwaitlisttickets.\n530.Refundinothercircumstances:\nForrefundoffareundercircumstancesotherthanthosespecifiedaboveorwhererefundisnot\nadmissibleornotgrantedatthestationonaccountofexpiryoftimelimitsorotherwise,a", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 71, + "text": "TicketDepositReceiptisissuedtothepassengerinlieuofthesurrenderedticketatthestation\nwheretheticketissurrendered.ThepassengercanclaimrefundinCCM`soffice.\n531.Roundingoffruleforrefundoffares:\n1.Thecancellationchargeonthepassengerticketwillberoundedofftonearestrupeei.e.\nfractionofarupeebelow50paisewillbedroppedoffand50paiseormorewillberoundedoff\ntonexthigherrupee.\n2.Thisroundingoffruleforrefundwillbeapplicableuniformlyforticketsofallclassesandtrains.\n532.ComputerizedCoachingRefundScheme(CCRS)-\n532.1.ExceptionalDataReport(EDR):\nPurpose:CCRSisintroducedtosimplifytheprocedureofrefundoffaresonreservedticketson\nnormal\ncircumstancesandbeyondtheexistingtimelimit.\nHow:ByupdatingthechartpositioninPRStograntrefundacrossthecounterevenbeyondtime\nlimit\nanywhereinthecountry.\nUPDATINGOFCHART:TicketcheckingstaffhastoprepareExceptionalDataReport(EDR)after\nchecking\nthecoachonthefollowingcases.\n1.Passengernotturnedup.\n2.Forcedtotravelinlowerclassholdinghigherclassticket.\n3.FailureofACequipmentinthecoaches.\n4.Lessnumberofpassengerstravelledonagroupticket.\n5.Discontinuationofjourneyduetodislocationoftrainservices.\n6.Accommodationcouldnotbeprovided.\n7.Cancellationoftrains.\n532.2.DateEntrypoint(DEP):Dataentrypointsarethosestationswhereexceptionaldatareportis\nfedintothePRS.Thesestationsarenominatedkeepinginviewthefollowingconditions.\na.ChangeoverstationsofTTE`s.\nb.AvailabilityofPRS.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 72, + "text": "532.3WhenandhowRefundisadmissible-\nToapersonwhoisbookedontheconcernedticket.Suchpersonmustcomepersonallytoclaim\nrefundandproducephotocopyofanydocumentprovinghisidentity.\n1.Photocopiestobeverifiedwiththeoriginalbytheofficialgrantingrefund.\n2.AtallPRScountersduringworkinghrs,upto30daysfromthescheduleddeparturetimeofthe\ntrainfromitsoriginatingstation.\n3.Normalcancellationchargeswillbeleviedasperrules.\n532.4Refundshallnotbegranted-WhenthePRSisnotupdatedwithEDR.\n1.Onwaitinglisttickets.\n2.Wherecashrefundisnotadmissibleatthestationacrossthecounter.\n3.Toanypersonwhoisnotbookedontheconcernedticket.\n532.5.InstructionforTicketCheckingStaff/Supervisors/E&RCs-\n1.EDRispreparedintriplicate,foreachcoachseparately.ItwillberesponsibilityofTSorSenior\nmostTTEtoensurethatthesereportsarepreparedbytheTTEsoftheirrespectivecoaches.Ifa\ncoachisnotchecked,theseniormostTTEwillcertifythisfactontheEDRoftheparticular\ncoachgivingreasonsfornotchecking.\n2.ItmaybeensuredthatEDRformsinsufficientquantityaresuppliedtoTTEstoavoidusageof\nnon-standardformats.TheEDRshouldbepreparedintriplicate.\na.TheoriginalEDRshouldbehandedovertotherefundSupervisor/ShiftSupervisorat\nthenominatedpointsandclearacknowledgementshouldbeobtainedoncarboncopy\nofeachofthesereportsfromthesupervisor.ItwillberesponsibilityofSeniormostTTE\ntoensurethatallstaffhandedovertheircopyofEDRincludingthosewhicharenot\nchecked.\nb.Onecarboncopywillbeattachedtotheoriginalchartandtheamendedchartand\nhandedovertotheoutgoingTTE.\nc.OnecarboncopyoftheEDRsalongwiththecopyoftheamendedchartshouldbe\npreservedasperexistingpractice.\n3.EDRshouldbehandedoverwithinonehourafterarrivaloftrainotherwisethematteris\nreportedtohigherauthorities.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 73, + "text": "Chapter-6\nLuggageTraffic\n601.Definitions:-\n1.Luggagemeansthegoodsofapassengereithercarriedbyhiminhischargeorentrustedtoa\nrailwayadministrationforcarriage.[IRCMvol-1chapter-8].\n2.Un-bookedorpartiallybookedluggage:Luggagecarriedinexcessoffreeallowancewithout\nbookingiscalled`un-bookedluggage’andluggagecarriedinexcessofactuallybookediscalled\npartiallybookedluggage.\n3.Freeallowance:Thisisthequantityofluggageapassengercancarrywithhiminthepassenger\ncompartmentwithoutpayinganycharges.Freeallowanceisgrantedaspertheclassoftravel.\n4.Marginalallowance:Thisisthequantityofluggagethatisusedtodeterminetheextentof\npenaltytobeimposedincaseofun-bookedorpartiallybookedluggage.Marginalallowanceis\nnotgrantedbuttakenintoconsideration.\n602.Articlesnotacceptedasluggage-\n1.Offensivearticles–exception:Wetskinofwildanimalinairtightbox.\n2.Explosiveanddangerousgoods,exceptsafetycinemafilm,safetycartridges,andsmalloxygen\ngascylinderwithpatientin1stclassaccompaniedbyamedicalattendantandholdingdoctor’s\ncertificatethatthecarriageofoxygencylinderisnecessary.Usualfreeallowancewillbe\ngranted.\n3.Oilgrease,ghee,paintsetc.whichmightbecontactbreakage,orleakagedamageotherarticles,\nexception20kggheeperpassengerisallowed.\n4.Allvarietiesofdrygrass,leavesandwastepaper.\n5.Deadpoultryandgame.\nNote:\n1.Bulkyarticlesareallowedasluggagebutnofreeallowanceisgranted.Thesearechargedon\nweightorbymeasurementwhicheverisgreater.\n2.DryfishnotpermittedonC.Rly.,passengerdetectedcarryingdryfishandarticlesmentioned\nabovevideitem(1)to(5)areliableforprosecution.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 74, + "text": "603.LuggagecarriedbyAC1st,Sleeperclassand2ndclasspassengers-\nPassengerarerequestedtotakeintoacarriageonlysuchsmallarticlesofpersonalluggage\nasarerequiredfortheirownuseonthejourneyandcanbeplacedinthecarriagewithout\ninconveniencingotherpassengerorreducingavailableaccommodationinthecarriagefor\nsitting/sleepingfreemovement.\nTrunks,suitcases,boxesorarticlesofluggagewhichinoutsidemeasurementexceedanyone\nofthefollowingdimensionshouldbecarriedinbrakevanandnotinpassengercompartment\n100cms(length)x60cms(breadth)x25cms(height)\nIfsucharticlesarecarriedwiththepassengerinthecompartmenttheywillbecharged\nseparatelyasluggageontheirfullchargeableweightwithoutgrantinganyfreeallowance.\nSuchpackagesmaybetransferredtoBrakeVanforonwardjourney.Freeallowancewillbe\nallowedonlyforthedistancethesepackagesarecarriedinBrakeVans.Forthedistancethese\npackagesarecarriedinpassengercompartment,nofreeallowanceisgrantedandfreightdueonfull\nchargeableweightshouldberecovered.\nFreeallowancemaybegrantedonMachineryparts,Fridgeorotherarticlescarriedasluggage.\n604.TheTableoffreeallowanceandmarginalallowancefordifferentclass:\nClass Free\nallowance\nMarginal\nallowance\nMaximumallowance\nIAC 70 15 150\n2AC 50 10 100\nFirstclass50 10 100\n3AC 40 Nil 40\nACCC 40 Nil 40\nSleeper40 10 80\nIIclass 35 10 70\nTickets\nI-Season15 5 -\nII-Season10 5 -\nMVST-Outward60 - -\nMVST-ReturnEmpties- -", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 75, + "text": "CheckSoldier\nTicket\n40 10 -\nSoliderTicket40 10 -\nPasses\n1stClass‘A`\nPass\n140 15\n1stclass70 10\n2ndClass‘A`&\n2ndClasspass\n50 10\nNote:-IncaseofAC3rdandACChairCarluggageover40Kgs.perpassengershouldbebookedand\ncarriedinBrakeVan.\n605.Maximumsizeoftrunks/suitcase/boxesetc.thatcanbecarriedinAC3Tier\n50cms(length)x45cms(breadth)x22.5cms(height)\n606.Articlesallowedfree(exemptedfromweighment)are-\nClass Articles\nAC1st,1stand\nAC2Tier\nTiffinbaskets,smalliceboxes,smallhandbags,orattaché\ncases(notsuitcase),walkingsticksandumbrellas.\nAC3Tier,ACChair\nCar,SleeperClass\nand2ndClass\nWalkingsticks,umbrellasandsmallarticlesoffoodrequired\nduringjourney.\n607.PassengerdetectedcarryingUn-bookedluggage-\nIftotalweightoftheun-bookedluggageexceedsthefreeallowancebymorethanthe\nmarginallimitthenfreeallowancewillbegrantedandremainingweightwillbechargedat6times\nluggageratefortheentiredistancesubjecttominimumRs.50/-.\nAndiftotalweightoftheun-bookedluggageexceedsthefreeallowancebutdoesnotexceeds\nthelimitofmarginalallowancethefreeallowancewillbegrantedandremainingweightwillbe\nchargedatsingleluggageratefortheentiredistancesubjecttominimumRs.30/-.\n608.Passengerdetectedcarryingpartiallybookedluggage:-\nIftheportionofpartiallybookedwhichisnotpaidforisfoundexceedsthefreeallowancebymore\nthanthemarginallimitthenitwillchargedfortheexceedweightexceedingfreeallowanceat6\ntimesluggageratesubjecttominimumRs.50/-.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 76, + "text": "Andifitfoundexceedingfreeallowancebutdoesnotexceedsthelimitofmarginalallowancethen\ntheexcessweightwillbechargedatsingleluggageratesubjecttominimumRs.30/-.\n609.Passengerdetectedcarryingpartiallybookedluggageexceedingmaximumpermissiblelimit:-\nExcessweightwillbechargedat6timesluggageratesubjecttominimumofRs.50/-.\nNote:marginalallowanceisnotapplicableincaseofpartiallybookedluggageexceedingmaximum\npermissiblelimit.\n610.PassengerholdingExtratickets:-\nFreeallowanceisgivenonactualnumberofpassengerstravelling.Passengersdetected\ncarryingextraticketsshouldbeallowedfreeallowanceonlyontheactualnumberofpassengers\ntravelling.Extraticketsshouldbecancelledandexcessweightshouldbechargedat6timesluggage\nratesubjecttoaminimumofRs.50/-.\nNote:Thisruleisalsoapplicableforpassholdersandmilitaryticketholders.\n611.Passengerfoundtravellingbeyondauthorizeddistancewithluggage:-\n1.Bookedluggage-Chargeswillbeleviedfortheportionoverriddenseparately,itwillbetreated\nasun-bookedluggageandchargedaccordingly.\n2.Un-bookedluggage-Iftheluggagewasnotbookedatthestartingstation,chargesshouldbe\nrecoveredfromstartingstationtothestationtowhichpassengeroverridesaspertherulesin\nforceforchargingun-bookedluggage.\n612.Passengerunableorrefusingtopaytheduechargeforcarryingun-bookedorpartiallybooked\nluggageenroute:-\nwhenapassengerisdetectedenroutewithun-bookedorpartiallybookedluggageandhe\nrefusesorunabletopaytheduechargesondemandthantheentireluggageafteritproperlypacked\nandfastenedmustbeshiftedtothebrakevanunder“To-PayparcelwayBill”attheneareststation\nwherethereistimetodoso.\nThechargeswillbeshownas“Topay”betweenfromandtostationofticketheldbypassenger.The\n“ToPay”PWBwillbehandedovertopassengerandwillbeadvisedtotakedeliveryonpaymentofdue\ncharges.\n613.Passengerunableorrefusingtopaytheduechargeforcarryingun-bookedorpartiallybooked\nluggagedestination:-\nWhenapassengerisdetectedatdestinationwithun-bookedorpartiallybookedluggageand\nherefusesorunabletopaytheduechargesondemandthantheentireluggageshouldbedetained", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 77, + "text": "anddepositedincloakroom.Aclockroomticketshowingthechargeswillbehandedovertothe\npassengerwhowillbeadvisedtotakedeliveryafterpaymentofluggageandcloakroomcharges.\n614.Carriageof“musicalinstrument”,“TVset”and“Childtricycle”asluggage:-\n1.OneMusicalinstrument,OneTVsetandoneTricyclechildrenmaybeallowedaspersonal\nluggage(Notfree)andusualfreeallowancewillbegrantedonthearticles.\n2.Theweightof1stmusicalinstrumentistobedeterminedonactualweight,theweightofTVis\ntobedeterminedonactualweightorweightbymeasurementwhicheverishigher.Theweight\noftricycleisfixedas20kgpertricycle.\n3.Musicalinstrumentinexcessofonecarriedbypassenger,allwillbechargedas6times\nluggageratesubjecttominimumofRs.50/-.\n4.TVinexcessofonecarriedbypassenger,allwillbechargedas6timesthescale`L`luggage\nratesubjecttominimumofRs.50/-.\n5.Childrentricycleinexcessofonecarriedbypassenger,allwillbechargedas6timesthescale\n`L`luggageratesubjecttominimumofRs.50/-.\n615.Charpoynotinpieces:-\nNotpermittedinpassengercompartment.Ifdetectedun-bookeditwillbecharged,without\ngrantingfreeallowanceat6timestheGPSratefor40kguptopointofdetectionandshouldbe\nremovedtobrakevanandchargedatGPSratefor40kgsubjecttominimumofRs.50/-.\n616.Conveyanceofbicycles,tricycles,perambulators,scootersandmotorcyclesetc.asluggage:-\nNofreeallowanceisgivenonthesearticles\nThesearticlesmustbebookedinbrakevanandarenotallowedtobecarriedinpassenger\ncarriages.\nIncasetheyarefoundun-bookedwithpassengerinacompartmentoratdestinationstation,\nthesamewouldbechargedatsixtimesthescale`L`fortheentiredistancesubjecttoa\nminimumofRs.50/-perarticle.\nOnlyonescooter/motorcycle/mopedcanbebookedasluggageonaticket.\nBicycles,tricyclesetcwhentransportedinpieceseithertiedtogetherorseparatedwillbe\nchargedonactualweightsubjecttominimumweightmentionedabove.\nNote:\nTri-cyclesbelongingtodisabledpersonsshouldbechargedasluggageat40Kgspertri-cycle,\nprovidedthesearecarriedinbrakevanofthesametrainbywhichtheownersaretravelling.\n617.Chargeswillbecollectedonactualweightorfollowingprescribedweightwhicheverishigher-", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 78, + "text": "Typeofarticles Chargeableweight(inkilograms)\nAutoRickshaw 600\nBicycles 40\nBicyclecrates,empty 20\nBicyclesidecars 40\nChildrenbicycle 20\nChildrenscooters 20\nChildrenPedalvehicles(exceptotherwise\nhereinprovide)\n20\nChildrenPushvehicles(exceptotherwise\nprovided)\n20\nChildrenpushchairs 40\nChildrenpushchairscollapsible 20\nChildrenscooters 20\nChildrentricycle 20\nChairsinvalid 150\nCyclelorries 150\nCycletongas 150\nCycletrailingcars 150\nCycletrailingvans 150\nGo-carts 20\nMotorcycles&Mopeds 100(upto60cc)\nMotorcycles&scooters 200(above60ccbelow350cc)\nMotorcycles 250(350ccandabove)\nMotorcycleswithsidecarattached\n(foreachmotorcyclewithsidecar\nattached)\n500\nMotorcyclessidecar 150\nMotorlawnmovers 150\nMotorscootersonthreewheel 450\nMotortricycleswithrecepatclesc300\nMotortricycles 300\nPerambulators 75\nPerambulatorscollapsible 20\nRickshaws 150\nSidecarofmotorcycles\nThreewheelerdeliveryvans 900\nTricycles 100\nNote:-Tricyclesbelongingtodisabledpersonsshouldbechargedasluggageat40kgspertricycle,\nprovidedthesearecarriedinthebrakevanofthesametrainbywhichtheowner(disablepersons)are\ntravelling.\n618.Grantoffreeallowanceonmerchandiseandothergoodscarriedasluggage:-\nItisclarifiedfortheguidanceofstaffthatfreeallowanceshouldbegrantedonallarticles\nnormallycarriedasluggagewhetherinpassengercompartmentsorinBrakevan(exceptthearticles", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 79, + "text": "notallowedtobecarriedorbookedasluggageandarticles/trunks/suitcases/boxesexceeding\nprescribeddimension)\nAccordingfreeallowanceshouldbegivenonarticlesnormallyasluggagesuchasmachinery\nparts,shoes,wares,parcelsandofficedocumentcarriedbypassengers/couriers,sewingmachines,\ntypewriters,toysportablecradles,airconditioners,foldingchairs,pottedplants,manufacturedpiece\ngoods.\nChapter-7\nBookingandChargingofLiveStock\n701.BookingandchargingofDogs:-\nClassMinimumweight\nforcharge\nMinimum\nChargeif\nbooked\nIfdetectedun-\nbookedchargesfor\nentirejourney\nMinimumcharge\nincaseofun-\nbooked\n1.Brake\nvan\n2.1stAC\n3.AC\nsleeper,\nChair\ncar,\nSecond\nclass\n30kg.\n60kg.\nNotallowed\nRs.30/-\nRs.30/-\n--------------\n--------------\n6timesforscale‘L’\nfor60kgs.\n6timesforscale‘L’\nfor30kgs.and\nremovaltobrake\nvan\n-----------\nRs.50/-\nRs.50/-", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 80, + "text": "Note:DogwillbepermittedtotravelwithpassengeronlyinAC1stcompartmentprovidedthatthe\nwholecompartment(4berths)orcoupe(2berths)isexclusivelybookedbythepassengerinallother\ncasesdogswillbebooked&carriedinSLRindogboxes.\n702.BookingandchargingofSheepgoat,Pigsandcalves(underheight0.76Mts.):-\nClass Minimum\nweight/rate\ncharge\nIfdetectedun-booked\nchargesuptopointof\ndetection\nChargesfor\nonwardjourney\n1.Brakevan\n2. In\ncompartment\n40kg.per\nanimalatscale\n‘L’rate\nminimum\nRs.30/-\nNotallowed\n6timesforscale‘L’for\n40kgs.peranimal\nminimumRs.50/-\nAscaleratefor40\nkgsperanimal\nafterremovalto\nbrakevan\n703.BookingandchargingofSmallanimalsandanimals(Puppies,Cats,Mittens,Mongoose,Monkey,\nRabbits,andGuineapigsetc.otherthanpoultry):-\n1.InBrakevan\nClass Minimum\nweight/rate\ncharge\nIfdetectedun-booked\nchargesuptopointof\ndetection\nChargesfor\nonwardjourney\n1.Incage\nBaskets\n2.Whenloose\nAtGPSrateon\nactual\nchargeable\nweight\nNotallowed\n----------\n----------------\n---------------\n------------\n2.InCompartment:", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 81, + "text": "Class Minimumweight\n/ratecharge\nIfdetectedun-\nbookedcharges\nuptopointof\ndetection\nChargesfor\nonwardjourney\n1.Incages/Baskets\n(exceptAC1st)\n20kgsper\nbird/animalAt\nscale‘L’rate\nminimumRs.30/-\nperconsignment.\n6timesforscale‘L’\nfor20kgs.per\nbird/animal\n2timesforscale\n‘L’for20kgs.per\nbird/animal\nminimumRs.50/-\n2.Whenloose40kgs.per\nbird/animalAt\nscale‘L’rate\nminimumRs.30/-\n6timesforscale‘L’\nfor40kgs.per\nbird/animal\n2timesforscale\n‘L’for40kgs.per\nbird/animal\nminimumRs.50/-\n3.InReservedcarriages:\nClass Minimumweight\n/ratecharge\nIfdetectedun-\nbookedchargesupto\npointofdetection\nChargesfor\nonwardjourney\n1.Incages/Baskets\n(exceptAC1st)\nAtscale‘GPS’rate\nminimumRs.30/-\n6timesforscale\n‘GPS’\nAtscale‘GPS’\nrateminimum\nRs.50/-\n2.WhenlooseAtscale‘L’rate\nfor30kgsper\nbird/animal\nminimumRs.30/-\n6timesforscale‘L’\nfor30kgs.per\nbird/animal\nAtscale‘L’for30\nkgs.per\nbird/animal\nminimumRs.50/-", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 82, + "text": "704.Bookingandchargingofpoultry:\nClass Minimum\nweight/rate\ncharge\nIfdetectedun-\nbookedcharges\nuptopointof\ndetection\nChargesfor\nonwardjourney\nInBrakevan\na.Inbasket\nb.Whenloose\n40kgsper\nbasketatscale\nGPSrate\nNotbooked\n6timesforscale\n‘GPS’for20kgs.per\npoultryminimum\nRs.50/-\n6timesforscale‘L’\nfor40kgs.per\npoultryminimum\nRs.50/-\n40kgsperbasket\natscaleGPSrate\nafterremovalto\nbrakevan\n40kgsperbasket\natscaleLrate\nafterremovalto\nbrakevanin\nbasket\nInCompartment\na.Inbasket\nb.WhenlooseNotbooked-----------------------------\n705.BookingandchargingofSnakes:\nClass Minimum\nweight/rate\ncharge\nIfdetectedun-\nbookedcharges\nuptopointof\ndetection\nChargesfor\nonwardjourney", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 83, + "text": "InBrakevan\na.Inbasket\nb.Whenloose\nAtscaleGPS\nrateonactual\nweight.\nNotbooked\n--------------------------------\nInCompartment\na.Inbasket\nb.WhenlooseNotbookedPersonwillbeprosecutedundersection\n60(3)ofIRAinwhichhecanbefinedup\ntoRs.150/-", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 84, + "text": "Chapter-8\nRailwayPassesandAuthorities\n“Pass”meansanauthoritygivenbyMinistryofRailwaysoranyRailwayAdministrationtoaperson,\nauthorizinghimtotravelbyrailgratuitously.\nPASSES\nMetalToken Cheque Card Authority\n1.Gold 1.Privilegepass1.DCP 1.Specialdutypass\n2.Silver2.Complimentarypost\nretirementpass\n2.FRC 2.Relieving\n3.Bronze3.Dutypass 3.Provisioncard\npass\n3.Medical\n4.RMS 4.Medicalpass4.Schoolcardpass4.FreeTravelling\nauthority5.Schoolpass\n6.Widowpass\n801.MetalToken:Theseareofgold,silverandbronze,andareissuedtogazettedofficerswhenon\nduty.\n(a)Goldtoken/pass:Holderswhenonduty,areentitledtotravelinAC1stclasswiththeirfamily\n(maximum2berthsinAC1stand4berthsinACsleeperclass/Executiveclass)overtheIndian\nGovernmentRailways", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 85, + "text": "(b)Silvertoken/pass:Holdersareentitledtothesameprivilegesasgoldpassholdersexceptthatthe\nofficerhimselfonlyisentitledtoAC1stclasswhilehisfamilyisallowedtotravelinACSleeper/first\nclass.AC1stclassforthefamilycanalsobeobtainedonpaymentof1/3rdofthedifferencebetween\ntheair-conditionedclassandACSleeperclassfares.\n(c)Bronzetoken/pass:Holders,whenonduty,areentitledalonetoAC1stclass(gradepay7600-8700)\nandfirstclass/ACSleeperclass(gradepay4800-7600)travelwiththeirfamiliesoverthezonal\nrailway/jurisdictiononly(exceptinthecaseofbronzepassesissuedbytheRailwayBoardwhichare\navailableoveralltheIndianGovernmentRailways.TravelinAC1stclasswithfamilyisallowedon\npaymentof1/3rdofthedifferencebetweentheair-conditionedclassandACSleeperclassfares.\n801.1CommonfacilitiesforRailwayofficertravellingonmetaltoken:\n1.Upto4berthscanbereservedintrainservice.\n2.Scooter/MotorcanbebookedfreeinBrakevan.\n3.Cantravelonengineprovidedtokenissuitablyendorsed.\n4.Oneattendantfreein2ndclass.\n5.140kgs.ofluggageforeachadultand70kgs.foreachchildofover5yearsandunder12years,\nand50kgs.foreachattendantareallowedfree.\n802.RMSTokens\nPostalStaffworkinginRailwayMailServicecoachesaregivenRMStokenswhileondutybytrain.\nThenamesofthepostalstaffdetailedtoworkinRMScoachesontrainsarefurnishedintheDuty\nRosteravailablewiththeHeadSorter.TheyshouldonlytravelinRMScoachesinconnectionwith\nsortingoflettersandtoreceivemailbagsaten-routestationsetc.\nStaffwhosenamesappearinthedutyrosterbutnotinpossessionofmetaltokensneednotbe\nchargedbutstatementshouldbeobtainedwitnessedbytheHeadSorter.\nStafffoundtravellingwithRMStokensandtheirnamesdonotfigureinthedutyrostershouldbe\ntreatedtravellingwithoutticketinfirstclassandchargedaccordinglyandaspecialreporttobe\nsubmittedtoSr.DCM.\n803.Metaltokenissuedtoworkshopstaff\nMetaltokenareissuedtocertainworkers/employeesattachedtoMechanicalWorkShops,Storesand\nElectricalDepartmentstotravelbyrailinworkmenspecialsorinsecondclassbypassengertrains\nbetweenthestations(whichareengraved)furnishedintheMetalTokens.\nBreakjourneyisnotpermittedonthesetokens.\nExceptaTiffincarrierandasmallrug,noluggageispermitted.\nAnypersondetectedtravellingwithouttokeninworkmenspecial,willbetreatedtravellingwithout", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 86, + "text": "ticketinFirstClassandcharged.\n804.Privilegepass:\nRailwayemployeesareissuedfreeprivilegepasses,familymembercanbeincluded,\ndependentrelativescanalsobeincludedinaprivilegepass,butnotmore2dependentcanbe\nincludedinprivilegepass,whendependentisincludedinprivilegepasstotalnumberofpersonsin\nsuchpassshouldnotexceed5.\nPrivilegepasscanbeissuedfromanystationtoanystationonIndianrailwaysbyanyoneofthe\nfollowingroutes:\n1.Shortroute;or\n2.Alongroutewhichiswithin15%ascomparedtothedistancebyshortroute;or\n3.Aquickroute;or\n4.Alongerrouteprovideddirectedtrain/throughcoachesareavailable.\nSingleandreturnjourneypassarevalidfor5monthsfromthedateofissue.Passholdercanbreak\njourneyatstationmentionedonthepass. [RBE-\n41/2012]\nWhilemakingbreakjourneynecessaryendorsementshouldbegivenonthepassinthespace\nprovided.Whileapplyingforpassanynumberofbreakjourneystationscanbementioned.\nScooter/Motorcycle/MopedcanbebookedinBrakevan,usualfreeallowancewillbegrantedand\nthereisnoneedofaspecificendorsementonthepassforthispurpose.\nUpto5yearsofserviceclassIIIandclassIVemployeesareissuedonesetpass&4setsofPTOperyear.\nOncompletionof5years’service3setspassesand4setsofPTOsareissuedperyear.\nGazettedofficerareissued1stAwhitepasses,6setsofpasses&4setsofPTOsperyear,if1st‘A’white\npassholderdesirestotravelinAC1stthen1/3rddifferencebetweenAC1stfare&ACsleeperfares,will\nbecollected.\nSr.\nNo.\nCategory TypeofPrivilegePass&Privilege\nTicketOrder\nTypeofDutyPass\n1Group‘A’&Group‘B’(Gazetted)1stclass‘A’pass 1stclass‘A’pass\n2NonGazettedEmployees:-\ni.InGradepayRs.4200/-and\nabove\nii.InGradepayRs.2800/-\niii.IntheGradepayRs.1900/-\nandabovebutbelowGrade\npayRs.2800/-.\n1stclasspass\n2ndclass‘A’pass*\n2ndclass‘A’pass*inayear,\nremainingpassesandPTOsof\nsecond/Sleeperclass.\n1stclasspass\n2ndclass‘A’pass\n*\n2ndclass‘A’pass\n*", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 87, + "text": "iv.EmployeesinGradepay\nRs.1800/-\n2ndclass‘A’pass*inayear,\nremainingpassesandPTOsof\nsecond/Sleeperclass. 2ndclass‘A’pass\n*\n*Note:Intermsoftheextantinstructions,theholderof2ndClass'A'passshallbeentitledtotravel\nbyAC-3tierclassintrainsotherthanRajdhani/Shatabadi/DurontoExp.trains.2ndClassA'Passisof\nyellowcolour.\nAttendant:\n804.1.“Attendant”meansfulltimepaidservantofRailwayemployeeemployedinpersonalservice\nandshouldnotberelativeofrailwayemployee,relativeemployedasservantcannotbecarriedas\nattendantinrailwaypass.\nOneattendantcanbecarriedfreein2ndclassbyholderof1stAwhitepassand1stgreenpass.\nSeniorcitizencomplimentarypassholderisentitledtotakeonecompanionin2ndsleeperprovided\nthepassholdertravelsalongwiththecompanionin2ndclass.\nAttendantcantravelinsleeperclasswithoutpaymentofdifferencebetween2ndandsleeperclass\nfares.\nAttendantcannottravelin1stclassevenonpaymentofdifferenceoffares.\n805.Postretirementcomplimentarypass:\nRetiredrailwayemployeesareissuedthesepasses,familymemberscanalsobeincluded.Classof\npasswillbesameforwhichtheemployeesareentitledatthetimeofretirement.\nDependentsarenotincluded.\n806.Schoolpass:\nThesepassesareissuedtoSon/Stepson/Adoptedson,dependentbrothersandsistersofRailway\nemployeewhentheyarestudyinginschoolcollegesituatedoutofemployeesheadquartersand\nwheneitherparentsisresidingpermanently/temporarilyawayemployeesheadquarter.Thispass\nwillbeissuedfortheclassofwhichanemployeeiseligible.Thisfacilitywillbeavailableforthe\nstudentuptoageof21yearshoweverthisagerestrictionwillnotapplythempursuinghigher\neducation.\n807.Dutypass:\nThesechequepassesareissuedtoRailwayemployeestoenablethemtotravelfordischargingtheir\ndutiesatsomeotherstation/placesituatedoursidetheirheadquarter.\n808.Medicalpass:\nWhenaRailwayemployee,hisfamilymembersordependentsarereferfromoneRailwayhospitalto\nanotherfortreatment,consultationetc.Normallythesepassesareissuedforeligibleclass,butmay", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 88, + "text": "beissuedforhigherclassattheentirediscretionofthemedicaldoctor.\n809.Widow:\nHalfthenumberofpasses,whichanemployeewasgettingonretirementwillbeadmissibletoa\nwidowofRailwayemployee.Incaseofdeathofrailwayemployeeduringservice,thedateofdeath\nwillbeconsideredasdateofretirement.Onesetofpasseveryalternateyearwillbeadmissiblein\ncaseofclassIVemployee.Thisfacilityisextendedtorailwayemployeeswhowereonrollon12.3.87\nandoptedforitandtoallothersappointedafterwords.\n810.CardPass:\n810.1.DutyCardpass:\nIssuedbynamedesignation&employeesphotograph,holdershouldsignonDCPinthespace\nprovidedHoldercantravelfromanystationtoanystationwithinthesection/Jurisdictionmentioned\ninDCP.\nHoldersarerequiredtoindicatethedetailsofthejourneyfailingwhichtheywouldbetreatedas\ntravellingwithoutticket.\n810.2.FreeResidentialcardpass:IsissuedtoRailwayemployeeswhoarerequiredtotraveldaily\nbetweenplacesofresidencetoplaceofduty,providedsuitabletrainservicesavailable.FRCPwillbe\nofsameclassforwhichemployeeisentitled.FRCPwillbesubjecttotherestrictionasapplicableto\ntheseasonticketofsameclass.\n1stFRCPholdercan`ttravelinACSleeper/Sleeper,failingwhichtheywillbechargedwithoutticket.\n2ndFRCPholdercan`ttravelinsleeperclass,failingwhichtheywillbechargedwithoutticket.\n1stFRCPholdercantravelin1stor2ndclass,asentitled2ndFRCPholdercantravelin2ndclassonly.\n810.3.Provisionofcardpass:\nOnly2ndclasspasswillbeissuedfromaroadsidestationtoaspecificstation.Railwayemployeeor\nfamilymemberorrelativeorevenoutsidercantravel,butwhenanoutsiderhadbeendeputedby\nrailwayemployeetobringprovisiongoods,outsidershouldbehandedoveraseparateauthorityletter\nMEMObytheSM,Thathehasbeenallowedtotravelforbringingprovision.Ontheprovisioncardpass\n120kgs.Provisionarticlescanbecarriedinreturnjourney.Breakjourneyisnotallowedinthispass.\nSMsshouldkeepaproperrecordregardingissueofthesecardpasses.\nAnemployeecanbeissuedthispassonlytwiceamonth.\n810.4.Schoolcardpass:\nSchoolcardpasswillbesubjecttotherestrictionasapplicabletoseasonticketofsameclass.\n1stschoolcardpassholdercantravelin1stor2ndclassbutcan`ttravelinACSleeper/Sleeper,failing\nwhichtheywillbechargedwithoutticket.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 89, + "text": "2ndclasscardpassholdercan`ttravelinsleeperclass,failingwhichtheywillbechargedwithout\nticket,theycantravelonlyin2ndclass.\n811.Travellingauthority:\nDifferenttypesoftravellingauthoritiesareissuedtorailwayemployeestravellingonduty,reliving\nduty,forattendingrailwayhospital.\nTravellingauthoritymustbeissuedonaproperprintednumberedstandardproforma.\nManuscriptauthorityissuedonanon-standardproformawillbetreatedasinvalid&holderwillbe\ntreatedastravellingwithoutticket&chargedaccordingly,mattershouldbereported.\n812.Passes&PTOsissuedGovt.RailwayPolice:\nThefacilityofprivilegepassesandPTOsisalsoadmissibletoGovernmentRailwayPolicepersonnel.\nTheclassofpassesandPTOsadmissibletothemisdeterminedbythepaylimitasapplicableto\nRailwaystaff.\nGRPpersonnelnoteligibleforAirConditionedtravelwithoutpaymentofdifferenceoffaresbetween\nFirstACandtheclassofpassheld.\n813.Emergentpolicepass:\nEmergentPolicepassesareissuedtoGovernmentRailwayPolicepersonneloverthehomelineon\nreceiptofarequisitionsignedbyanofficernotbelowtherankofaHeadConstablewhentravellingon\ndutyconnectedwithrailwayorstate.\nThesepassesaremachinenumbered,printedinfourcounterfoilsandsuppliedinbooks.\nThefirstfoilistheStationRecord,secondfoilisAccounts,whichservesthepurposeofarequisition,\nthethirdisFreeTicketandthefourthoneisthereceipttobegrantedtotheholderbytheticket\ncheckingstaffatdestination.\nThesepassesarealsogivenforwitnessesandcomplainantstogiveevidenceinPoliceStationorata\nplaceofinvestigationtoidentifycriminal’spropertyetc.inbona-fiderailwaycases,andwhenpersons\naresummonedtogiveevidencebeforetheInvestigatingofficer.\nThesepassesarealsoissuedtopoliceoverotherrailwaysincaseofemergencytofollowupcriminals\ninconnectionwithrailways,whenescortingprisonersandtoreturnfromsuchduty.\nThesepassesareallowedbyalltrainsbutnobreakjourneyisallowedenroute.\nWhenaPoliceofficer,havingapassfromastationtoanotherstationonanotherrailway,wishesto\ncontinuejourneyinconnectionwithhisofficialduties,beissuedthispassonfurnishingarequisition\nforonwardjourneyonlydulyfurnishingthedetailsofpassheld.\n814.Emergentpassenger`spass:", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 90, + "text": "Whenpersonsaccusedofoffencesundersections137and138oftheRailwaysActaretobeconveyed\nbyrailtoattendcourtorpolicestation,EmergentPassenger’sPassshouldbeissuedfortheaccused\nandtherailwaystaffescortingthemfortravelinsecondclassonly.Incaseofticketlesspassengers\nhandedovertotheStationMasterbySeniorTicketExaminer’smemoshouldbequoted.\n815.IdentitycardcumRailwaypasses(ICCRP):\nIdentityCardcumRailwayPassisissuedtoMembersofParliamentofLokSabhaandRajyaSabha.\nICCRPissuedtoMPsofLokSabhaisingreencolourandthatofRajyaSabhaispurple.\nFreetravelinFirstACorExecutiveClasswithspousefromanystationtoanystationoverIndian\nRailwaysinanytrainincludingRajdhani/Shatabadi/DurantoExpress.\nAcompanionaccompanyingtheMPallowedtotravelinAC2tier.\nAMember,havingnospouse,hasbeenallowedtotakeonepersoninplaceofspouseinFirst\nAC/ExecutiveClassinrailjourneyinadditiontocompanionallowedinAC2tier.\nTheSpouseoftheMemberisprovidedseparatepasswhichentitlestotravelinFirstAC/Executive\nClassinanytrainfromusualplaceofresidenceoftheMembertoDelhiandbackonceduringasession,\nandtwiceinbudgetsessionofParliamentandinnocasesuchjourneysareallowedmorethaneight\ntimesinayear.\nAMember,whoisblindorphysicallychallenged,shallbeallowedtotakeanattendantwithinhimin\nthesameclassinlieuofcompanioninadditiontotheSpousealreadyallowedinFirstAC/Executive\nclass.\nMPsshouldfilltheprescribedjourneyformsandhandovertotheticketexamineratdestination.\nMachinenumberedjourneyformconsistsof3foils,Record,AccountandMember’sfoil,aresuppliedin\ntheformofbooks.StaffshouldfillthejourneyformsandobtainsignatureoftheMP.\nMember’sfoilhastobehandedovertotheTicketExamineratthedestination.\nAllchargesaredebitedtoParliamentSecretariat.\n816.ComplimentarypasstoFreedomFighters:\nComplementarypassesareissuedtoFreedomFightersavailableoverallIndianRailwaysbyMinistry\nofRailways.\nThesepasseswillhavethephotoofthefreedomfighter,dulyattestedbytheissuingauthoritywith\nsealanddistinguishingnumber.\nTheholderofthispassmustfillupcolumnsintheAnnexurebeforecommencementofjourney.\nTheholderofthispassisentitledtotravelinAC2tieralongwithacompanioninthesameclassbyall", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 91, + "text": "trainswithoutpaymentofanychargeslikereservation,supplementarycharge,Developmentcharge\netc.HoweverinRajdhani/ShatabadiexpressestheyarepermittedtotravelinAC3tieror2ndclass\nACchaircarrespectively.\nWhileseekingreservation,freedomfightershavetofurnishthenameofthecompanionwhowill\naccompanyhimandthesamepersonhastoaccompanyfreedomfighterwhiletravelling.\nThecompanionaloneisnotpermittedtotravel.\nFreeAllowanceofluggagepermissibleis70Kgs.\nFreemedicalcheckupbyRailwayDoctorsduringthejourney.\n817.Suburbanticketstorailwayemployees:\nTheseareissuedtorailwayemployees,whoarenotprovidedwithrailwayquarters,fromthestation\nservingthestationandtheplaceofworkandvalidforonemonth.\nThedurationofjourneyshouldnotexceedtwoandhalfhoursineachdirection.\nSixsinglejourneyfaresoronefourthofMSTfares,whicheverisless,willbecharged.\nTheseareissuedbyincharge,whoisempoweredtoissuefreepasses,fortheclassoftravelaccording\ntoeligibilityofprivilegepasses.\nNofreeallowanceofluggageisallowedexceptasmallhandbagorarug.\nSuchticketsarenotallowedbyMailorfortravellinginhigherclassorbyotherthanthebookedroute\nonpaymentofdifferenceinfares.Ifdetectedtravellingirregularly,theholderwillbetreatedas\ntravellingwithoutticket.\n818.Powertoissue/signpassesandPTOs:\nSeniorSubordinatesingradeRs.5000-8000(RSRP)andaboveandwhoareholdingindependent\nchargeofoffice/establishmentmayissue/signpassesandPTOstothestaffworkingunderthem.\n819.Penaltyfornon-fillingofdateonpass:\nHoldersofIIClassandIClasspasseswhiletravellingonDuty/Privilegepassesarerequiredto\nindicatedateininkbeforecommencementofjourney.Incontraventionofthisruleifanystaff\nmemberweretobedetected,afineofRs.10/-forSecondClassandRs.25/-incaseofIclasspasswill\nbeimposedandthesameisrecoveredincashandanexcessfareticketisissued,dulyendorsingthe\nfactonthepass.\nRailwayemployeestravellingondutycardpassesandrequiredtoindicatethejourneydetailsinthe\nAnnexure,failingwhichtheywillbetreatedtravellingwithoutvalidauthority.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 92, + "text": "Chapter-9\nConcessionRules\n901.GeneralRules:\n1.CoachingtariffPart-I,volume-II,itcontainsthedetailsofvariousconcessionsallowedto\npassengersbyRailways.\n2.AllconcessionsareallowedonbasicfareofMail/Expresstrains.\n3.Noconcessionisallowedinrespectofotherchargeslikereservationcharge,development\ncharge,supplementarychargeetc.\n4.Nopersonisallowedmorethanoneconcessionatatime.\n5.Thechargingofminimumfareisnotapplicabletotheticketsissuedonconcessions.\n6.ConcessionsarenotallowedbyRajdhani/Shatabditrainsexceptforseniorcitizensandpress\ncorrespondents(30%concessionisallowed).", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 93, + "text": "7.Concessionsareexchangedonlyacrossthecounter.Personstravellingwithoutexchangingthe\nconcessionorder/formaretreatedastravellingwithoutticketanddealtaccordingly.\n8.Insomeconcessionswhereescortsareallowed,theescortsarealsogiventhesameelementof\nconcession.\n9.Concessionisnotallowedwhenthecostofjourneyisbornebythegovernment.However,\nstudentsattendingtournamentsconductedbyrecognizedschoolsanduniversitiesare\nexempted.\n10.Thedistancerestrictionapplicableforatrainwillalsoapplytoconcessionaltickets.\n11.Extensionofjourneyonconcessionticketsisgrantedoncollectionoffullfarefortheportionto\nbeextended.\n12.Whenreturnjourneyconcessionisgranted,theoutwardandthereturnjourneymustbe\nperformedbythesameroute.\n13.Whenreturnjourneyconcessionisgranted,partialcancellationisnotallowed.\n14.Concessionsareallowednormallybydirectandshortestroute.\n15.Allconcessionswillbeexchangedatbothendofjourney.(Originatingstationordestination\nstation).\n16.Theconcessionholdermusttravelbythebookedrouteonly.Ifhewantstotravelbyanyother\nroute,hemustpurchaseafreshticket.\n17.Breakjourneyisnotpermittedwhenconcessionsareissuedforaspecificpurpose.\n18.Atthetimeofexchangingconcessionthevalidityperiodofthecertificateorordershouldbe\nchecked.\n19.Original/copyofthecertificateorordershouldbesubmittedatbookingoffice,whiletravelling,\ncopy/originalcertificateshouldbecarried.\n20.Theconcessionorderissuedbyauthorizedrailwayofficialanditisvalidfor3months.\n21.Incaseofgroupconcessionsallmusttravelbythesametrainbutnotnecessarilyinthesame\ncoach.\n22.Refundisnotgrantedonpartiallyusedconcessionaltickets.\n902.ConcessionsataGlance:\nTypeof\nconcession\n%classConcession\ncertificate\nissuedby\nValidityOrigina\nlor\nXerox\npurposeRemarks\n1Sr.Citizen\n(MALE)\n(FEMALE)\n30\n50\nAll\nAll\n-\n-\n-\n-\n-\n-\nAnywher\neto\nAnywher\n60yrs(M)&58(F)and\nabove(2).Ageprooftobe\nshownondemandinthe", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 94, + "text": "e train\n2WarWidows,\nWidowsof\nIPKF,Widows\nof“Operation\nVijay1999”in\nKargil\n75SL,IIIdentitycard\nissuedby\nsainikBoard\nLife\nlong\nXeroxAnywher\neto\nAnywher\ne\nXeroxcopyofIDcardtobe\nproducedatthetimeof\nbooking\n3Widowsof\nPolicemen\nKilledin\nactionagainst\ntheterrorists\nand\nextremists.\n75SL,IIIdentitycard\nissuedby\nCONCERNED\nSupdtt.of\nPoliceorDy.\nCommissioner\nLife\nlong\nXeroxAnywher\neto\nAnywher\ne\nXeroxcopyofIDcardtobe\nproducedatthetimeof\nbooking\n4PMShram\nAward\n75SL,IIIdentitycard\nissuedby\nMinistryof\nLabour\nLife\nlong\nXeroxAnywher\neto\nAnywher\ne\nXeroxcopyofIDcardtobe\nproducedatthetimeof\nbooking\n5Sports\nPersons\n75\n50\nSL,II\nICL\nSecretaryof\nsports\nfederation\nOnceOrigina\nl\nSpecificOnconcessionorder\nissuedbyDRM\nState/NationalLevel\nChampionship\n6Sports\nPersons\n75I,SL,IISecretaryof\nsports\nfederation\nOnceOrigina\nl\nSpecificOnconcessionorder\nissuedbyDRM\nInternational/National\nChampionship\n7Professional\nentertainmen\ntgroup\n75\n50\nSL,II\nICL\nSangeet\nNatak\nAcademy\nOnceOrigina\nl\nSpecificOnconcessionorder\nissuedbyDRM\nState/CentralGovt.\napprovedprogramsfor\nmorethan300kms.\n8Professional\nCircusParties\n75\n50\nSL,II\nICL\nMinistryof\nsports/\nHuman\nResource\nDept.\nOnceOrigina\nl\nSpecificOnconcessionorder\nissuedbyDRMfor\nminimumdistancefor\ncharge160kms\n9Teachers,\nRecipientof\nNational\nAward\n50SL,IIDEOLife\nLong\nXeroxAnywher\neto\nAnywher\ne\n-\n10Parent\naccompanying\nChildhonored\nwithbravery\nAward\n50SL,II\nfor\neither\nofthe\nparen\nt\nIndiancouncil\nforChild\nWelfare\n-XeroxAnywher\neto\nAnywher\ne\nChildisissuedwith\ncomplimentarypassby\nDRM.Agelimitis18yrs.\n11Membersof\nSt.John\nAmbulance\nBrigade\n25SL,IISecretary/\nAsst,\nCommissioner\nOnceOrigina\nl\nSpecificForreliefworkorTraining\nbeyond300kms.\n12Teachers25SL,IIHM/Principal\n/DEO\nOnceOrigina\nl\nSpecificEducationalTourbeyond\n300kms.\n13Kissans/\nIndustrial\nWorkers\n25SL,IIDist.\nMagistrate\nOnceOrigina\nl\nSpecificIngroupsof20ormoreon\nconcessionorderbyDRM.\n14Unemployed\nyouth\n50\n100\nSL\nII\nCopyofCll\nLetterand\nApplication\nOnceOrigina\nl\nSpecificToappearforInterviews\nofState/Central/PSU\n15Allopathy\nDoctor\n10AllRegistration\ncertificate\nissuedby\nLifeXeroxAnywher\neto\nAnywher\nUndertakingisgivenby\nDoctortorenderMedical\nAssistancetotheneedy", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 95, + "text": "IndianMedical\nCounciland\nundertaking\nepassengersduringjourney\n16MilkVendors50IIDist.\nMagistrate\n3\nMonths\nOrigina\nl\nSpecificToattendtrainingat\nnationallevelinstitute,in\ngroupsof20ormore.\n17GirlsofRural\nAreas\n75IIHeadMaster1\nmonth\nOrigina\nl\nSpecificToattendNationalLevel\nEntranceExamsfor\nMedical/Engineeringetc.\n18Studentsof\nRuralAreas\n75IIHeadMaster3\nMonths\nOrigina\nl\nSpecificOnStudyToursoncea\nyear,ingroupof20or\nmore.\n903.Childrenandstudentsconcessions-\nTypeofconcession%classConcessio\nn\ncertificate\nissuedby\nOrigi\nnal\nor\nXero\nx\nRemarks\n1Childrenof5yrsandabove\nbutlessthan12yrs.\n(childrenbelow5yrsare\nnotchargedanyfare)\nhalf\nof\nadult\nfare\nallNone-\n2Bonafidestudents(General)50SL,IIHeadof\nInstitution\nOrigi\nnal\n(1).Specific(2).Vacation(3).To\nappearinexamination(4).Free\nMSTBoys-Xclass,girls-XII(5).\n50%0ffarefornormalstudentsup\nto25yrsinseasonticket(6).For\nSC/STstudent(upto27yrs)–50%\nofnormalstudentfareinseason\ntickets.\n3Educationaltours\n(minimum-10)\n50SL,IIHeadof\nInstitution\nOrigi\nnal\n1Escortforevery4girlsofanyage\nand4boysbelow12yrs,1escort\nfor10boysofage12yrsand\nabove,1escortfor5PHstudents,\nSC/STStudents50%ofnormal\nstudentfare.\n4CadetsofMarine\nEngineering\n50SL,IICaptain/\ncourse\ndirector\norigi\nnal\nBetweenhomeandplaceof\ntraining\n5Foreignstudentsupto25\nyrs(Researchscholars-35\nyrs)\n50SL,IIHeadof\nInstitution\nOrigi\nnal\nOnconcessionorderfromDRMfor\ncamps/seminars\n6Students(appearingfor\nexamasprivatecandidate)\n50SL,IIHeadof\nInstitution\nOrigi\nnal\nOnconcessionorderfromDRMfor\nUniversityexamination.\n7Articledclerks50SL,IIChartered\nAccountan\nt\norigi\nnal\nOnconcessionorderfromDRM,\nbetweenplaceofstudyand\nexam/Trainingcentre.\n8Researchscholars–35yrs50SL,IIDirectorof\ninstitution\norigi\nnal\nOnconcessionorderfromDRMfor\nResearchwork\n9Students/Nonstudent\nYouthingroupsof5ormore\n25SL,IIConcerned\norganizati\non\norigi\nnal\nOnconcessionorderfromDRMfor\nWorkcamps/Voluntaryservice.\n10Students/ArtistsofNational\nschoolofdancing\n75\n25\nSL,II\nICL\nNational\nSchoolof\nDrama\norigi\nnal\nOnconcessionorderfromDRMfor\nprogramssponsoredbyState\n/Centralgovt.\n11TraineeNurse/Midwife25SL,IIHeadof\nInstitution\norigi\nnal\nOnconcessionorderfromDRM,\nbetweenplaceofstudyandhome", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 96, + "text": "townonleave.\n904.MedicalGrounds:\nTypeof\nconcessio\nn\n%classAttendantConces\nsion\ncertific\nate\nissued\nby\nValidityOrigina\nlor\nXerox\npurposeRemarks\n1Orthopedi\ncally\nHandicapp\ned/\nParaplegic\n50\n75\nIAC,2A\nC\nOther\nclasse\ns\nCompulsoryGovt.\nDoctor\nUpto\n25yrs-\n5yrs\n25-30-\n10yrs\nAbove35\n-Life\nXeroxAnywher\neto\nanywher\ne\n50%concessioninI\n&IIclassSeason\ntickets\n2Mentally\nRetarded\n50\n75\nIAC,2A\nC\nOther\nclasse\ns\nCompulsoryGovt.\nDoctor\n5yrsXeroxAnywher\neto\nanywher\ne\n50%concessioninI\n&IIclassSeason\ntickets\n3Blind50\n75\nIAC,2A\nC\nOther\nclasse\ns\nOptionalGovt.\nDoctor\n5yrsXeroxAnywher\neto\nanywher\ne\n50%concessioninI\n&IIclassSeason\ntickets\n4Deaf\n&Dumb\n50I,SL,IIOptionalGovt.\nDoctor\n5yrsXeroxAnywher\neto\nanywher\ne\n50%concessioninI\n&IIclassSeason\ntickets\n5Heart\npatient\n50\n75\nIAC,2A\nC\nOther\nclass\nOptionalRecogn\nized\nHospita\nl\n3monthsOrigina\nl\nSpecificForAdmission/\nDischargeto/from\nhospital(Heart\nSurgery).\n6Kidney\nPatient\n50\n75\nIAC,2A\nC\nOther\nclass\nOptionalRecogn\nized\nHospita\nl\n3monthsOrigina\nl\nSpecificForAdmission/\nDischargeto/from\nhospital(Kidney\nTransplantation).\n7Cancer50\n75\nIAC,2A\nC\nOther\nclass\nOptionalRecogn\nized\nHospita\nl\n1yearOrigina\nl\nSpecificForAdmission/\nDischargeto/from\nhospital.\n8Thalassemi\naMajor50\n75\nIAC,2A\nC\nOther\nclass\nOptionalRecogn\nized\nHospita\nl\n3monthsOrigina\nl\nSpecificForAdmission/\nDischargeto/from\nhospital.\n9TB\n/Lupasval\ngaris\n75I,SL,IIOptionalGovt.\nDoctor\n/TB\nHospita\nl\n3monthsOrigina\nl\nSpecificForAdmission/\nDischargeto/from\nhospital.\n10Non-\nInfectious\nLeprosy\n75I,SL,IINot\nPermitted\nRecogn\nized\nHospita\nl\n3monthsOrigina\nl\nSpecificForAdmission/\nDischargeto/from\nhospital.\n11Hemophili75I,SL,IINotRecogn3monthsOriginaSpecificForAdmission/", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 97, + "text": "905.StudentConcession:\n1.StudentsofSchool/Collegeofallkindsrecognizedbydepartmentofstateandcentral\ngovernmentareeligible.\n2.Concessionispermittedonproductionofcertificatefromtheheadoftheinstitution.Itisa\nmachinenumberedbook,suppliedbyDRMatacostprice.\n3.Eachconcessioncertificateconsistsofthreecounterfoils:Record(forschool),concession\norder(retainedatstation)&studentfoil.\n4.Itiswrittenininkfillinginentireparticularlikefromandtostation,nameofthestudent,age,\nsex,vacationperiod,dateofissueetc.andsignedbyHeadmasterwithdesignationstampand\nofficeseal.\n5.Theconcessioncanbeexchangedtwomonthsinadvancesubjecttotheconditionthatthe\nreservationissoughtforthejourneystartingnotmorethanonedaybeforethe\ncommencementofvacationandnotmorethanonedayafterthevacationperiodisover.\n6.Theticketshouldbepurchasedwithin14daysofthedateofissueoftheconcessionorderfor\noutwardjourneyandtwomonthsforreturnjourney.\n7.Studentsbelow12yrsareeligiblefor50%ofIIclass/SleeperclassMail/Expchildfare.\n8.(a).SC/STstudentsarechargedat50%ofthenormalconcessionalfareadmissibleforgeneral\nstudents.(b).AnattestedcopyofSC/STcertificateissuedbythestategovt.issubmitted.(c).It\nisallowedevenifcertifiedonthestudentconcessioncertificatebyheadoftheinstitution.\n9.Concessionisnotadmissibleinreservedcarriage,studentsattendinganexaminationforthe\npurposeofobtainingemploymentandstudentswhoareunderfulltimeemployment.\n10.Breakjourneyisnotpermitted.Refundsareallowedonoutwardjourney,Norefundsonreturn\njourney.\n906.SeniorCitizenConcession:\n1.ThisconcessionisissuedtoMaleaged60yearsandFemalepersonsaged58yearsandabove.\na Permittedized\nHospita\nl\nl Dischargeto/from\nhospital.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 98, + "text": "2.Theelementofconcessionis-\nI.40%formalepersons.\nII.50%forfemalepersons.\n3.ThisconcessionisallowedinallclassesandbyalltrainsincludingRajdhani/Shatabditrains.\n4.Proofofageisnotrequiredatthetimeofpurchasingticket.Howeverwhiletravellingthey\nmustcarryproofofagesuchasidentitycard,PANcardetc.\n5.Ifpassengerisnotcarryingtheageproof,TTEwillcollectdifferenceoffareonlywithout\npenalty.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 99, + "text": "Chapter-10\nMilitaryWarrants/Certificates/Concessions\n1001.Militarypersonalfoundtravellingonexchangedwarrants:-\nMilitarypersonneldetectedtravellingonun-exchangedwarrantformsIAFT1707andIAFT1752will\nbedealtwithasunder-\n1.Whendetectedatdestination:-thefaredueplusexcesschargewillbecollectedincash,the\nwarrantwillalsobecollected,markedcancelledandsenttotheTrafficAccountsofficealong\nwiththerelevantexcessfarereturn(Com/R-19.Rev).\n2.Whendetectedenroute:-thefareplusexcesschargewillberecoveredincashuptothepoint\nofdetectionandanexcessfareticketgranted.Asecondexcessfareticketforremaining\nportionofthejourney,willbeissuedfreeofchargeandwarrantcollected;ifwarrantis\navailableforthereturnjourney,separateexcessfareticketwillbeissuedfreeofchargefor\nreturnjourney,thedateofavailabilityasshownonthewarrantbeingendorsedontheexcess\nfareticket;inthefreeexcessfaretickets,particularsofthewarrantandofthepaidexcessfare\nticketsissuedshouldbeenteredonthewarrant.Thewarrantsshouldbescrutinizedtoseethat\ntheyarecomplete.\n1002.Militarypersonneltravellingwithun-exchangedwarrantonguardscertificate:-\nWhenmilitarypersonnelareunabletogettheirwarrantsun-exchangedforticketsatthestarting\nstationandadvisetheGuardortheconductoroftrainoranyotherstaffauthorizedinthisbehalf\nbeforeundertakingthejourney,thelattershouldissueacertificatethatthepassengershavebeen\npermittedtotravelonconditionthattheysubsequentlygetthewarrantsexchangedfortheexcess\nfareticketsatthenextstoppingstationwhenthereisthereistimeorevenearlieriftheycancontact\ntheticketcheckingstaff.Insuchcases,thewarrantswillbecollectedandfreeexcessfaretickets\ncoveringthejourneyfromthestartingstationstodestinationstationshowninthewarrantswillbe\ngiventothem.Theparticularsofthewarrantshouldbeenteredintheexcessfareticketandsimilarly\ntheparticularsoftheexcessfareticketissuedshouldbeshownonthewarrant.\n1003.Disposalofun-exchangedwarrantscollectedbyticketcheckingstaff:-\nTheun-exchangedwarrantscollectedbythecheckingstaffvideparamentionedabovewillbemade\novertotheBookingClerkalongwiththecashearningandacknowledgementwhichwillbeobtained\nonthebackoftherecordfoilofrelevantexcessfaretickets.Fullparticularsofthewarranttogether\nwiththestationnameatwhichitwasmadeovertothebookingofficewillbeenteredintheremarks\ncolumnoftheexcessfarereturn.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 100, + "text": "1004.Militarypersonneltravellingwithun-exchangedcertificateonguard`scertificate:-Free\nexcessfarereceiptwillbeissuedfortheentirejourney.Insuchcasesthemilitarycertificateswillbe\ncollectedandexcessfarereceiptcoveringthejourneyfromstartingstationtodestinationstation\nshowninthecertificatewillbegiventothem.Theparticularsofcertificateshouldbeenteredin\nexcessfarereceiptandsimilarlytheparticularsoftheexcessfarereceiptissuedshouldbeshownon\nthecertificate.\n1005.Militarypersonneltravellingwithun-exchangedconcessionformIAFT1720A,IAFT1728or\nIAFT1736withguard`scertificate:-\nWhenmilitarypersonnelarefoundtravellingwithun-exchangedIAFT1720A,IAFT1728orIAFT1736\nbutholdingcertificatefromtheGuardorotherauthorizedrailwayservant,theyshouldbecharged\ntheconcessionalfaredueonconcessionformfromstartingstationtodestinationstationwithoutany\nexcesscharge.\nNote:Guardcertificateisnotissuedonconcessionformno.IAFT1709A,1719and1732.Ifpersonnel\nisdetectedwithun-exchangedcertificatewillbetreatedastravellingwithoutticketanddealt\naccordingly.\n1006.Permissiontocommencejourneyafterdateofissueofticket(IAFT-1720B):-\nIncaseswherepersonnelholdingticketsissuedinexchangeofmilitarycertificateIAFT1720Aare\npermittedbymilitaryauthoritiestotravelupto14daysafterpurchaseoftickets,apermitinform\nIAFT1720Bwillbeissuedandcarriedbythepassengerwithhim.Oncompletionofthejourney,the\npermittogetherwiththeticketwillbehandedovertotheticketcollectoratdestinationfor\nsubmissiontotheTrafficAccountofficealongtheothercollectedtickets.Anyalterationinthisform\nrendersitnullandvoid.\n1007.Freeallowanceofluggageonmilitarywarrants:-\nSoldierstravellingonmilitarywarrantswillbegivenafreeallowance(RFA)of40kgs.Foreachadult\nand20kgs.Foreachchildforallclasses.Anyexcessbaggagewillbepaidincashandnofree\nallowancewillbegrantedonbaggagebookedunderaluggageticket.Thechargingruleofpartially\nbookedandun-bookedluggageissimilarasnormalluggagerules.\n1008.Militarypersonneldetectedtravellingonun-exchangedwarrantsorotherforms,refusingor\nunabletopayfaresandexcesscharge:-\nIntheeventofthemilitarypersonnelrefusingorbeingunabletopayfaresorexcesschargedueas\nmentionedabove,actionundersection137or138ofIndianRailwayact,asappropriatetothe\ncircumstance,shouldbetaken.\n1009.Warrantsataglance:", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 101, + "text": "Sr.\nNo\n.\nForm\nNo.AccountalIssuedtoWhomIfDetected\nUn-exchanged\nRemarks\n1IAFT\n1752\n1stor2nd\nclassS/Jor\nR/JCST\nissued\nIssuedto\nofficers,Jawans\nwhiletravelling\nondutyoron\nleave\nFare+ECupto\npointofdetection\n&foronward\njourneyfreeEFR\nonwards\nG.C.&difference\nofrate,allowed\nfreeallowance40\nkgs.per\npassenger\n2IAFT\n1707\n1stor2nd\nclassS/Jor\nR/JSoldier\nTicket\nissued\nFamiliesof\nJawans/officer,\nSmallparties\nandInvalids\nFare+ECupto\npointofdetection\n&foronward\njourneyfreeEFR\nonwards\nG.C.&difference\nofrate,allowed\nfreeallowance40\nkgs.\nperpassenger\n3IAFT\n1707A\n1stor2nd\nclassS/Jor\nR/JSoldier\nTicket\nissued\nMilitaryspecial\nTrains,Wagons\norVehicles\nDoesnotariseallowedfree\nallowance40kgs.\nperpassenger\nNote:IAFT1752A;thisisspecialformofrequisitionforadvancereservationformilitarypersonnelholding\nformno.IAFT1707Aand1752.\n1010.Certificates:\nSr.\nNo.\nForm\nNo.\nAccountalIssuedto\nWhom\nIfDetectedUn-\nexchanged\nRemarks\n1IAFY\n1953\n1stor2nd\nclassS/J\nTicket\nissued.Valid\nbyM/E\ntrainswhen\njourney\nabove1250\nkms.\nArmy/Air\nForce\nReservists\nandTAstaff\nwhencalled\nforduty\nTreatedas\ntravellingwithout\nticket\nGCanddifference\noffareallowed,\nFreeallowanceas\nperclassof\ntickets\n2IAFY\n1954\n1stor2nd\nclassS/J\nTicket\nissued.\nArmy/Air\nForce\nReservists\nandNCOmen\nofTAstaff\nwhencalled\nforTraining\nTreatedas\ntravellingwithout\nticket\nGCanddifference\noffareallowed,\nFreeallowanceas\nperclassof\ntickets\n3INF31stor2nd\nclassS/J\nTicket\nissued.\nFleet\nreservistsof\nNavywhen\ncalledfor\nduty\nTreatedas\ntravellingwithout\nticket\nGCanddifference\noffareallowed,\nFreeallowanceas\nperclassof\ntickets\n4INF\n461\n1stor2nd\nclassS/J\nTicket\nissued.\nFleet\nreservistsof\nNavywhen\ncalledfor\nTraining\nTreatedas\ntravellingwithout\nticket\nGCanddifference\noffareallowed,\nFreeallowanceas\nperclassof\ntickets", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 102, + "text": "1011.Concessionsvouchers:\nSr.\nNo.\nForm\nNo.\nAccountalIssuedtoWhomIfDetectedUn-\nexchanged\nRemarks\n1IAFT\n1709A\n1st&1stAC\nchairCar\nS/Jtickets\nissuedon\ncollection\nof60%\nfare\nofficerandtheir\nfamilymembers\nwhenonleave.\nMaximum–6.\nTreatedastravelling\nwithoutticket\nNoGC,freeallowance\n40kgs.\n2IAFT\n1719\n1stclass\nS/Jtickets\nisissued\non\ncollection\nof50%\nfare\nCadetsofNDA,\nAFCandNTE\nTreatedastravelling\nwithoutticket\nNoGC,freeallowance\n40kgs.\n3IAFT\n1720A\n1stAC\nchairCar\nS/Jtickets\nissuedon\ncollection\nof50%\nfare\nJCO/NCOwith\ntheirfamilies.\nMaximum–6.\n50%fareforthe\nentirejourneyallowed\nwithexcesscharge\nuptopointof\ndetection\nGC,freeallowanceas\nperclassofticket.\n4IAFT\n1728\n1st,2nd\nclassS/J\norR/Jis\nissuedon\nS/Jfare\nRegimental\nreunion\nOutwardjourneyS/J\nfare&Excesscharge\nuptopointof\ndetection,forR/Jfree\nEFR.\nGC,freeallowanceas\nperclassofticket.\n5IAFT\n1732\n1stAC\nchairCar\nS/Jtickets\nissuedon\ncollection\nof50%\nfare\nNursesand\nMatronsof\nMilitary\nHospital\nFare+ECuptopointof\ndetection+Singlefare\nonwards\nNoGC,freeallowance\n40kgs.\n6IAFT\n1736\n1stand2nd\nclassS/J\nticketsis\nissuedon\ncollection\nof50%\nfare\nSportspersons\nwithcoachand\nspectators\n50%fareforthe\nentirejourneyallowed\nwithexcesscharge\nuptopointof\ndetection\nGC,freeallowanceas\nperclassofticket.\nNote:\n1.Faresaredebitabletodefensedepartmentincludingreservation/development/superfast\nsurcharge.\n2.Freeallowanceasperclass,Concessions,certificatesandWarrantsaresenttoaccountsoffice", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 103, + "text": "ascashvoucher.PermittedtotravelbyRajdhaniExpress.\n3.Holdersof1stclasswarrantswhentravelin2ndsleeper,norefundisgranted.\n4.Warrants,certificates,Concessionvouchersshouldbecollectedifdetectedun-exchanged.\n5.Theentitlesclassmaybenotedbyaffixingrubberstampontheform(e.g.AC-1,ACsleeperor\nACchaircar).\nChapter-11\nIrregularTravel\n1101.Irregulartravel-\n1.NopersonshallenterorremaininanycarriageonaRailwayforthepurposeoftravelling\nthereinasapassengerunlesshehaswithhimproperpassorticketorauthorityorcertificate\nofpermissiontotravel.-Section55(IRA)\n2.Everypassengerbyrailwayshallpresenthispassorticketondemandforexaminationandat\norneartheendofjourneydeliverupthepassortickettotherailwayservant.Section54(IRA)\n3.Irregulartravelmeanseithertravellingwithoutticketorpassortravellingincontraventionof\ntheticketheld.\n4.Inallcasesofpassengerstreated/detectedtravellingwithoutticket,theyarechargedas\nfollows.\ni.Fromthestationofcommencementofjourneyifascertained.OR\nii.Fromthelastticketcheckingpoint.OR\niii.Fromthetrainstartingstationwhicheverisnearer.\n1102.Ticketcheckingstations/points-\nZone Division Ticketcheckingstation", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 104, + "text": "CentralRailway\nMumbai Igatpuri,Pune\nBhusawal Bhusawal\nNagpur Nagpur,Ballarshah\nSolapur Daund,Solapur\nWestCentralRailway\nBhopal Itarsi,Bina\nJabalpur\nKota\nSouthCentralRailway\nBalharshah,Hyderabad,\nSecunderabad,Wadi,Purna,\nKhandwa,Vijaywada,Guntakal,\nRenigunta,Hubli,Miraj,\nVishakhapatnam,Chennai,\nBangalore.\nWesternRailwaysMumbai(BCT) BCT,ST,BDTS,CCG&NDB\nBARODA(BRC) BRC\nAHMEDABAD(ADI) ADI,GIM,BHUJ,PUN,HMT,MSH&\nVG\nBHAVNAGAR(BVC) BVP,BVC,DHOLA,PBR,VRL\nRAJKOT(RJT) RJT,JAM,SUNR,OKHA\nRTM RTM,INDB,KTT,UJN\nNote:-Incaseofbranchlinestartingstationofthetrainistreatedasaticketcheckingstation.\n1103.ExcessFare:isanamountrealizedfromthepassengerbywayofdifferenceinfares,extension\netc.,duetotheRailwayswhomayormaynotbetravellingirregularly.\n1104.ExcessCharge:isasumequivalenttotheamountotherwisepayable,recoveredfroma\npassengerforhisirregulartravelorRs.250/-whicheverismore.(W.e.f.1stJuly,2004).\n1105.Guidelinetodealwithcertainirregulartravel\nSr.\nNo.\nCircumstances ChargestoberecoveredActiontobetakenif\nthepassengersfailsto\npay", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 105, + "text": "Ondemandcharges\ndue\n1Passengerdetected\nwithoutproperpass\norticket\ninadditiontotheordinarysinglefareforthe\ndistancewhichhehastravelledor,where\nthereisanydoubtastothestationfrom\nwhichhestarted,theordinary,singlefare\nfromthestationfromwhichthetrain\noriginallystarted,or,iftheticketsof\npassengerstravellinginthetrainhavebeen\nexaminedsincetheoriginalstartingofthe\ntrain,theordinarysinglefarefromtheplace\nwheretheticketsweresoexaminedorinthe\ncaseoftheirhavingbeenexaminedmore\nthanonce,werelastexamined;excessfare\nandexcesscharge(minimumRs.250/-)upto\npointofdetectionwillberealized.\nTobedetrainedwith\nHOMandprosecution\nundersection138(1)\n(4)and180ofIRA\n2Travellingontornor\nmutilatedticket\nwhichisnotreadable\nSameasabove Tobedetrainedwith\nHOMandprosecution\nundersection138(1)\n(4)and180ofIRA\n3Adulttravellingon\nchildticket\nDifferenceofadultandchildfaresfor\nentiredistancewithexcesscharge\n(minimumRs.250/-)\nprosecutionunder\nsection137ifjustified,\notherwisesection138\n4Detectedtravelling\ninhigherclass/train\nthanthatofthe\nticket\nDifferenceoffarepaidandpayableupto\nthepointofdetectionplusexcesscharge,\nIncasepassengerdesirestotravelin\nhigherclass;differenceoffaresforboth\nclassforonwardjourney\nprosecutionunder\nsection138(2)(4)and\n180ofIRA\n5DetectedwithM/E\ntickettravellingby\nsuperfasttrain\nwithoutpaying\nsupplementary\ncharges\nSupplementarychargeswillbecollected\nalongwithexcesscharge.Ifatrough\nticketholderhasboardedthetrain\nenroute,excesschargewillnotbe\ncollected\nprosecutionunder\nsection138(1)(4)and\n180ofIRA\n6Travellingonexpired\ndateticket\nTobetreatedaswithoutticketfromthat\nsection/stationwherevalidityexpiresi.e.\nwherethetrainishavinglasthaltbefore\noddhoursaspertimetable\nprosecutionunder\nsection137or138as\npermeritofthecase.\n7Travellingbeyond\nauthorizeddistance\n1.Intentionally\nDifferenceoffarepaidandwithexcess\ncharge,ifdifferenceisnil\nRs.250excesschargetobecollected\nprosecutionunder\nsection138(2)(4)and\n180ofIRA", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 106, + "text": "2.UnintentionallyAllowedtoreturntooriginaldestination\nbyfirstavailabletrainonpurchasingany\nclassofticket.Passengerwillnotleave\nplatform.\n8Travellingby\nrestrictedtrain\na.Withshort\ndistanceticketcan\nbebookedagainst\nenroutestation\nquota/enroute\nreservation\nb.Withoutticket\nFaresuptothestationforwhichbooking\nisopenminusfarespaidplusexcess\ncharge.\nFareswithexcesschargeuptothestation\nforwhichbookingisopen\nprosecutionunder\nsection138(1)(4)and\n180ofIRA\n9Travellingbyanother\nroutethanbooked\nroute\na.Fullypaidticket\nb.Concessionticket\nDifferenceoffarewithoutanyexcess\ncharge\nMusttravelbybookedroute.Tobe\ntreatedwithoutticketovertheportion\nnotcoveredinticket.\nprosecutionunder\nsection138(1)(4)and\n180ofIRA\n10Travellingon\nundatedticket\nTickettobecollectedandfreeEFRissued.\nSpecialreporttoDCM.Passengersname\nandaddresstoberecorded.\n11TravellinginRMSOnlystaffholdingRMStoken/passesare\npermitted,othertobetreatedaswithout\nticketin1stclass,eventhoughholdinga\nticket.Removalandreporting\nprosecutionunder\nsection138(1)(4)and\n180ofIRA.Section156\nifrefusingtovacate.\n12Travellinginbrake\nvan\ntobetreatedaswithoutticketin1stclassprosecutionunder\nsection138(1)(4)and\n180ofIRA.Section156\nifrefusingtovacate.\n13Travellingbyatrain\norondateotherthan\nendorsedonticket Withoutticket\nprosecutionunder\nsection138(1)(4)and\n180ofIRA.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 107, + "text": "14Travellingonaticket\nwithoutobtaining\nbreakjourney\nendorsementwhen\nbreakjourneyhas\nbeenmade\nWithoutticket\nprosecutionunder\nsection138(1)(4)and\n180ofIRA.\n15Travellingonun-\nexchangedrail\ntravelcouponsWithoutticketandrecoveryincash\nprosecutionunder\nsection138(1)(4)and\n180ofIRA.\n16Travellingonun-\nexchangedJail\nrequisition/District\npolicewarrant\nFareplusexcesschargeuptopointof\ndetection,freeEFRforonwardjourney.\nFormtobecollected\nprosecutionunder\nsection138(1)(4)and\n180ofIRA.\n17Travellingon\nuncertifiedHOR\nFreeEFRforentirejourney,HOWtobe\ncollected\n18Travellingon\nunsigned/undated\npass\nafineofRs.10/-forSecondClassand\nRs.25/-incaseofIclasspass,Remarkto\nbegivenonpass.\n19Travellingonun-\nexchangedPTOs\nWithoutticket prosecutionunder\nsection138(1)(4)and\n180ofIRA.\n1106.Chargingofpassengertravellingwithoutticketsorholdingwaitinglistticketsby\nRajdhani/ShatabadiExpress:\n1.Thepersonswhoareholdingwaitlistedticketwithoutconfirmedreservationsorwithout\nticketarenotauthorizedtoboardthesetrains.\n2.Incaseofpassengerboardingthetrainwithwaitlistedticketswillbeexcesschargedsingle\nfareuptothepointheispossessingtheticketwhetheraccommodationavailableisornot.\n3.Passengerboardingthetrainwithoutaticketwillbeexcesschargedfareequaltothedouble\noffareuptothedestinationofthetrainwhetheraccommodationisavailableornot.\n4.Anendorsementshouldbemadeontheticketthatsuchpassengerwillbedetrainedatthe\nfirststoppageofthetrainincasenoaccommodationisavailableonthetrain.\n5.Ifaccommodationisavailable,waitlistedpassengerswillbeallottedaccommodationasper\npriorityonwaitinglistandthereonfirstcomefirstservedbasis.\n6.Norefundwillbeadmissiblefortheuntravelledportion.Toguardagainstanymalpractices,\ntheticketofthepassengerwhohaseitheraccommodationonthetrainfortheentire/partial\njourneyordetrainedenroutemustbeinvariablybeendorsedtothiseffect.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 108, + "text": "7.Whereonagroup/party/familybookedonasingleticket,somepersonsgetconfirmed\nreservationandthetimeofdepartureofthetrainwhileotherremainwaitlisted,insuchcases,\ncancellationchargeswillnotleviedandonlyclerkagechargeswillberetainedforthe\nconfirmedpassengersalsoprovidedthatentireticketissurrenderedforthecancellationatthe\njourneycommencingstationwithin4hoursbeforescheduleddepartureofthetrainandupto3\nhoursaftertheactualdepartureofthetrain.\n1107.Grantingofpermissiontowaitlistedchildrentotravelalongwithfamily/partyinRajdhani\nexpress:\nAsperextantrulesonlypassengershavingconfirmed/RACaccommodationarepermittedtotravelin\nRajdhani/Shatabadiexpresstrain.Thepassengersevenifmembersofthesamepartyarenotallowed\ntoundertakethejourney.\nNowithasbeendecidedthatwhenafamily/partytravellingbyRajdhani/Shatabdiexpress\ntrainhavingapartiallyconfirmedticketinwhichthewaitlistedpassengersis/areonlythechildren\nbelowtheageof12yearsandparty/parentsintendtotakethesewait-listedchild/childreninthe\ntrainalongwiththembysharingtheaccommodationwithoutaskinganybedrolletc.,these\nchild/childrenmaypermittedtotravelbyRajdhaniExpresstrainwithoutpaymentofanypenalty.This\ncauseshallnotbeapplicableinShatabdiexpresstrains.Cateringwouldbeprovidedtosuchwait-\nlistedchild/childrenwhowishtoshareberthwiththeirparentsetc.\n1108.Removalsofbeggars,mendicantsandhawkers-\nThemajorityofbeggarsandmendicantswhendetectedtravellingwithoutticketorwith\nimproperticketsusuallytakethepleathattheyhavenomoneywiththemtopayRailwaydues.\nResultsofprosecutionofthesepeopleincases,aredisproportionatetothetimeandexpenseinvolved.\nTicketcheckingstaffmustthereforeensurethebeggarsandmendicantarenotallowedentryintothe\nrailwaypremises.\nIntrains-Whenbeggarsandmendicantsaredetectedintrainswithoutticketorwithimproper\nticketsthetravellingticketexaminermusttakealleffortstorealizethechargesdue.Ontheir\nrefusalthechargesdue,thefollowingactionistotaken:\n1.Thoseinpossessionofproperty(bysaleofwhichthemagistratecanrealizesufficientamount\ntocovertherailwaycharge)aretobeprosecutedundersectionofIRA137and138.\n2.Othersaretoberemovedfromthetrainsearliestopportunity.\nEntrainingstations-Mendicantsalightingatstationswithoutticketorwithimproperticketsareto\ndealwithsamemannerasin(b)above,andthosenottobeprosecutedaretoberemovedfromthe\nplatform.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 109, + "text": "Chapter-12\nRailwayAct1989–ImportantSections(ForTicketCheckingStaff)\n1201.RailwayAct1989(importantSectionsforTicketCheckingStaff)-\nSection-49:Exhibitionofcertaintimingsandtablesoffaresatstation-Railwayadministrationshall\npasteinaconspicuousandaccessibleplaceateverystationinHindiandEnglishandalsointhe\nregionallanguagecommonlyinuseintheareawherethestationissituated,Atableoftimesof\narrivalanddepartureoftrainswhichcarrypassengersandstopatthatstation,andListoffaresfrom\nsuchstationtosuchotherstationsasitmayconsidernecessary.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 110, + "text": "Section-50:Supplyofticketsonpaymentoffare.-Anypersondesirousoftravellingonarailway\nshall,uponpaymentofthefare,besuppliedwithaticketbyarailwayservantoranagentauthorized\ninthisbehalfandsuchticketshallcontainthefollowingparticulars,namely:--(i)thedateofissue;(ii)\ntheclassofcarriage;(iii)theplacefromandtheplacetowhichitisissued;and(iv)theamountofthe\nfare.\nSection–52:Cancellationofticketandrefund.-Ifaticketisreturnedforcancellation,therailway\nadministrationshallcancelthesameandrefundsuchamountasmaybeprescribed.\nSection-53:Prohibitionagainsttransferofcertaintickets.-Aticketissuedinthenameofaperson\nshallbeusedonlybythatperson:Providedthatnothingcontainedinthissectionshallprevent\nmutualtransferofaseatorberthbypassengerstravellingbythesametrain:Providedfurtherthata\nrailwayservantauthorizedinthisbehalfmaypermitchangeofnameofapassengerhavingreserved\naseatorberthsubjecttosuchcircumstancesasmaybeprescribed.\nSection-54:Exhibitionandsurrenderofpassesandtickets.-Everypassengershall,ondemandby\nanyrailwayservantauthorizedinthisbehalf,presenthispassortickettosuchrailwayservantfor\nexaminationduringthejourneyorattheendofthejourneyandsurrendersuchticket--(a)attheend\nofthejourney,or(b)ifsuchticketisissuedforaspecifiedperiod,ontheexpirationofsuchperiod.\nSection-55:Prohibitionagainsttravellingwithoutpassorticket.-(1)Nopersonshallenteror\nremaininanycarriageonarailwayforthepurposeoftravellingthereinasapassengerunlesshehas\nwithhimaproperpassorticketorobtainedpermissionofarailwayservantauthorizedinthisbehalf\nforsuchtravel.\nSection-56:Powertorefusetocarrypersonssufferingfrominfectiousorcontagiousdiseases.-(1)\nApersonsufferingfromsuchinfectiousorcontagiousdiseases,asmaybeprescribed,shallnotenter\norremaininanycarriageonarailwayortravelinatrainwithoutthepermissionofarailwayservant\nauthorizedinthisbehalf.\nSection-57:Maximumnumberofpassengersforeachcompartment.-Subjecttotheapprovalofthe\nCentralGovernment,everyrailwayadministrationshallfixthemaximumnumberofpassengers\nwhichmaybecarriedineachcompartmentofeverydescriptionofcarriage,andshallexhibitthe\nnumbersofixedinaconspicuousmannerinsideoroutsideeachcompartmentinHindi,Englishand\nalsoinoneormoreoftheregionallanguagescommonlyinuseintheareasservedbytherailway.\nSection-58:Earmarkingofcompartment,etc.,forladies.-Everyrailwayadministrationshall,in\neverytraincarryingpassengers,earmarkfortheexclusiveuseoffemales,onecompartmentorsuch\nnumberofberthsorseats,astherailwayadministrationmaythinkfit.\nSection-59:Communicationsbetweenpassengersandrailwayservantinchargeoftrain.-Arailway\nadministrationshallprovideandmaintainineverytraincarryingpassengers,suchefficientmeansof\ncommunicationbetweenthepassengersandtherailwayservantinchargeofthetrain.\nSection-67:Prohibitionofcarriageofdangerousoroffensivegoods.\nSection-68:Carriageofanimalssufferingfrominfectiousorcontagiousdiseases.-Arailway\nadministrationshallnotbeboundtocarryanyanimalsufferingfromsuchinfectiousorcontagious", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 111, + "text": "diseaseasmaybeprescribed.\nSection-100:Responsibilityascarrierofluggage.–Arailwayadministrationshallnotberesponsible\nfortheloss,destruction,damage,deteriorationornon-deliveryofanyluggageunlessarailway\nservanthasbookedtheluggageandgivenreceiptthereforeandinthecaseofluggagewhichis\ncarriedbythepassengerinhischarge,unlessitisalsoprovedthattheloss,destruction,damageor\ndeteriorationwasduetothenegligenceormisconductonitspartoronthepartofanyofitsservants.\nSection-101:Responsibilityasacarrierofanimal.–ARailwayadministrationshallnotbe\nresponsibleforanylossordestructionof,orinjuriesto,anyanimalcarriedbyrailwayarisingfrom\nfrightorrestivenessoftheanimalorfromoverloadingofwagonsbytheconsignor.\nExonerationfromliabilityincertaincases.-Notwithstandinganythingcontainedintheforegoing\nprovisionsofthisChapter,arailwayadministrationshallnotberesponsiblefortheloss,destruction,\ndamage,deteriorationornon-deliveryofanyconsignment,--\n(a)whensuchloss,destruction,damage,deteriorationornon-deliveryisduetothefactthata\nmateriallyfalse\ndescriptionoftheconsignmentisgiveninthestatementdeliveredundersub-section(1)ofsection66;\nor\n(b)whereafraudhasbeenpracticedbytheconsignorortheconsigneeortheendorseeorbyanagent\noftheconsignor,consigneeortheendorsee;or\n(c)whereitisprovedbytherailwayadministrationtohavebeencausedby,ortohavearisenfrom--\n(i)improperloadingorunloadingbytheconsignorortheconsigneeortheendorseeorbyan\nagentoftheconsignor,consigneeortheendorsee;\n(ii)riot,civilcommotion,strike,lock-out,stoppageorrestraintoflabourfromwhatevercause\narisingwhetherpartialorgeneral;or\n(d)foranyindirectorconsequentiallossordamageorforlossofparticularmarket.\nSection–137:Fraudulentlytravellingorattemptingtotravelwithoutproperpassorticket.-\n1.Ifanyperson,withintenttodefraudarailwayadministration,--\n(a)entersorremainsinanycarriageonarailwayortravelsinatrainincontraventionof\nsection55,or\n(b)usesorattemptstouseasinglepassorasingleticketwhichhasalreadybeenusedona\npreviousjourney,orinthecaseofareturnticket,ahalfthereofwhichhasalreadybeensoused,\nheshallbepunishablewithimprisonmentforatermwhichmayextendtosixmonths,orwithfine\nwhichmayextendtoonethousandrupees,orwithboth.Inabsenceofadequatereasonssuch\npunishmentshallnotbelessthanafineofRs.500/-.\n2.Thepersonreferredtoinsub-section(1)shallalsobeliabletopaytheexcesscharge\nmentionedinsub-section(3)inadditiontotheordinarysinglefareforthedistancewhichhe\nhastravelled,orwherethereisanydoubtastothestationfromwhichhestarted,theordinary\nsinglefarefromthestationfromwhichthetrainoriginallystarted,oriftheticketsof\npassengerstravellinginthetrainhavebeenexaminedsincetheoriginalstartingofthetrain,\ntheordinarysinglefarefromtheplacewheretheticketsweresoexaminedor,incaseoftheir", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 112, + "text": "havingbeenexaminedmorethanonce,werelastexamined.\n3.Theexcesschargereferredtoinsub-section(2)shallbeasumequaltotheordinarysinglefare\nreferred\ntointhatsub-sectionortwofiftyrupees,whicheverismore.\n4.Notwithstandinganythingcontainedinsection65oftheIndianPenalCode(45of1960),the\ncourtconvictinganoffendermaydirectthatthepersonindefaultofpaymentofanyfine\ninflictedbythecourtshallsufferimprisonmentforatermwhichmayextendup-tosixmonths.\nSection–138:Levyofexcesschargeandfarefortravellingwithoutproperpassorticketorbeyond\nauthorizeddistance(travellingwithoutpassorticketwithoutanintentiontodefraudtheRailways).\n–\n1.Ifanypassenger,--\n(a)beinginorhavingalightedfromatrain,failsorrefusestopresentforexaminationortodeliver\nuphispassorticketimmediatelyonademandbeingmadethereforeundersection54,or\n(b)travelsinatrainincontraventionoftheprovisionsofsection55,heshallbeliabletopay,on\nthedemandofanyrailwayservantauthorizedinthisbehalf,theexcesschargementionedin\nsub-section\n(c)inadditiontotheordinarysinglefareforthedistancewhichhehastravelledor,wherethereis\nanydoubt\nastothestationfromwhichhestarted,theordinarysinglefarefromthestationfromwhich\nthetrainoriginallystarted,or,iftheticketsofpassengerstravellinginthetrainhavebeen\nexaminedsincetheoriginalstartingofthetrain,theordinarysinglefarefromtheplacewhere\nthe\nticketsweresoexaminedorinthecaseoftheirhavingbeenexaminedmorethanonce,were\nlastexamined.\n(2)Ifanypassenger,--\n(a)Travelsorattemptstotravelinoronacarriage,orbyatrain,ofahigherclassthanthatfor\nwhichhehasobtainedapassorpurchasedaticket;or\n(b)travelsinoronacarriagebeyondtheplaceauthorizedbyhispassorticket,heshallbe\nliabletopay,onthedemandofanyrailwayservantauthorizedinthisbehalf,anydifference\nbetweenthefarepaidbyhimandthefarepayableinrespectofthejourneyhehasmadeand\ntheexcesschargereferredtoinsub-section(3).\n(3)Theexcesschargeshallbeasumequaltotheamountpayableundersub-section(1)orsub-section\n(2),asthecasemaybe,ortwofiftyrupees,whicheverismore:\nProvidedthatifthepassengerhaswithhimacertificategrantedundersub-section(2)of\nsection55,noexcesschargeshallbepayable.\n(4)Ifanypassengerliabletopaytheexcesschargeandthefarementionedinsub-section(1),orthe\nexcesschargeandanydifferenceoffarementionedinsub-section(2),failsorrefusestopaythesame\nonademandbeingmadethereforeunderoneorotherofthesesubsections,asthecasemaybe,any\nrailwayservantauthorizedbytherailwayadministrationinthisbehalfmayapplytoanyMetropolitan\nMagistrateoraJudicialMagistrateofthefirstorsecondclass,asthecasemaybe,fortherecoveryof\nthesumpayableasifitwereafine,andtheMagistrateifsatisfiedthatthesumispayableshallorder\nittobesorecovered,andmayorderthatthepersonliableforthepaymentshallindefaultof\npaymentsufferimprisonmentofeitherdescriptionforatermwhichmayextendtoonemonthbutnot\nlessthantendays.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 113, + "text": "(5)Anysumrecoveredundersub-section(4)shall,asandwhenitisrecovered,bepaidtotherailway\nadministration.\nSection–139:Powertoremovepersons.-Anypersonfailingorrefusingtopaythefareandthe\nexcesschargereferredtoinsection138mayberemovedbyanyrailwayservantauthorizedinthis\nbehalfwhomaycalltohisaidanyotherpersontoeffectsuchremoval:Providedthatnothinginthis\nsectionshallbedeemedtoprecludeapersonremovedfromacarriageofahigherclassfrom\ncontinuinghisjourneyinacarriageofaclassforwhichheholdsapassorticket:Providedfurtherthat\nawomanorachildifunaccompanied(notaccompanied)byamaturemalepassenger,shallnotbeso\nremovedexcepteitheratthestationfromwheresheorhecommencesherorhisjourneyorata\njunctionorterminalstationorstationattheheadquartersofacivildistrictandsuchremovalshallbe\nmadeonlyduringtheday.\n140.Securityforgoodbehaviorincertaincases.-\nA.Whenacourtconvictingapersonofanoffenceundersection137orsection138findsthathe\nhasbeenhabituallycommittingorattemptingtocommitthatoffenceandthecourtisofthe\nopinionthatitisnecessaryordesirabletorequirethatpersontoexecuteabondforgood\nbehavior,suchcourtmay,atthetimeofpassingthesentenceontheperson,orderhimto\nexecuteabondwithorwithoutsureties,forsuchamountandforsuchperiodnotexceeding\nthreeyearsasitdeemsfit.\nB.Anorderundersub-section(1)mayalsobemadebyanappellatecourtorbytheHighCourt\nwhenexercisingitspowersofrevision.\nSection–141:Needlesslyinterferingwithmeansofcommunicationinatrain.-\nIfanypassengeroranyotherperson,withoutreasonableandsufficientcause,makesuseof,or\ninterfereswith,anymeansprovidedbyarailwayadministrationinatrainforcommunicationbetween\npassengersandtherailwayservantinchargeofthetrain,heshallbepunishablewithimprisonment\nforatermwhichmayextendtooneyear,orwithfinewhichmayextendtoonethousandrupees,or\nwithboth:Providedthat,intheabsenceofspecialandadequatereasonstothecontrarytobe\nmentionedinthejudgmentofthecourt,whereapassenger,withoutreasonableandsufficientcause,\nmakesuseofthealarmchainprovidedbyarailwayadministration,suchpunishmentshallnotbeless\nthan—\na)Afineoffivehundredrupees,inthecaseofconvictionforthefirstoffence;\nb)Andimprisonmentforthreemonthsincaseofconvictionforthesecondorsubsequentoffence.\nSection–142:Penaltyfortransferoftickets.-\n(1)Ifanypersonnotbeingarailwayservantoranagentauthorizedinthisbehalf—\n(a)sellsorattemptstosellanyticketoranyhalfofareturnticket;or\n(b)partsorattemptstopartwiththepossessionofaticketagainstwhichreservationofaseat\norberthhasbeenmadeoranyhalfofareturnticketoraseasonticket,inordertoenableany\notherpersontotraveltherewith,heshallbepunishablewithimprisonmentforatermwhich\nmayextendtothreemonths,orwithfinewhichmayextendtofivehundredrupees,orwith\nboth,andshallalsoforfeittheticketwhichhesellsorattemptstosellorpartsorattemptsto\npart.\n(2)Ifanypersonpurchasesanyticketreferredtoinclause", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 114, + "text": "(a)ofsub-section(1)orobtainsthepossessionofanyticketreferredtoinclause\n(b)ofthatsub-sectionfromanypersonotherthanarailwayservantoranagentauthorizedin\nthisbehalf,heshallbepunishablewithimprisonmentforatermwhichmayextendtothree\nmonthsandwithfinewhichmayextendtofivehundredrupeesandifthepurchaserorholder\nofanyticketaforesaidtravelsorattemptstotraveltherewith,heshallforfeittheticketwhich\nhesopurchasedorobtainedandshallbedeemedtobetravellingwithoutaproperticketand\nshallbeliabletobedealtwithundersection138.\nProvidedthatintheabsenceofspecialandadequatereasonstothecontrarytobementionedinthe\njudgmentofthecourt,thepunishmentundersub-section(1)orsub-section(2)shallnotbelessthan\nafineoftwohundredandfiftyrupees.\nSection–143:Un-authorizedcarryingbusinessofprocuringandsupplyingofrailwaytickets.-\n(1)Ifanyperson,notbeingarailwayservantoranagentauthorizedinthisbehalf,--\na)Carriesonthebusinessofprocuringandsupplyingticketsfortravelonarailwayorfor\nreservedaccommodationforjourneyinatrain;\nb)Orpurchasesorsellsorattemptstopurchaseorsellticketswithaviewtocarryingonanysuch\nbusinesseitherbyhimselforbyanyotherperson,heshallbepunishablewithimprisonment\nforatermwhichmayextendtothreeyearsorwithfinewhichmayextendtotenthousand\nrupees,orwithboth,andshallalsoforfeittheticketswhichhesoprocures,supplies,purchases,\nsellsorattemptstopurchaseorsell.\nProvidedthatintheabsenceofspecialandadequatereasonstothecontrarytobementionedinthe\njudgmentofthecourt,suchpunishmentshallnotbelessthanimprisonmentforatermofonemonth\norafineoffivethousandrupees.\n(2)Whoeverabetsanyoffencepunishableunderthissectionshall,whetherornotsuchoffenceis\ncommitted,bepunishablewiththesamepunishmentasisprovidedfortheoffence.\nSection–144:Prohibitiononhawking,etc.,andbegging.-\n(1)Ifanypersoncanvassesforanycustomorhawksorexposesforsaleanyarticlewhatsoeverinany\nrailwaycarriageoruponanypartofarailway,exceptunderandinaccordancewiththetermsand\nconditionsofalicensegrantedbytherailwayadministrationinthisbehalf,heshallbepunishable\nwithimprisonmentforatermwhichmayextendtooneyear,orwithfinewhichmayextendtotwo\nthousandrupees,orwithboth.Andwillberemovedfromtherailwaycarriageorpremises.\nProvidedthat,intheabsenceofspecialandadequatereasonstothecontrarytobementionedinthe\njudgmentofthecourt,suchpunishmentshallnotbelessthanafineofonethousandrupees.\n(2)Ifanypersonbegsinanyrailwaycarriageoruponarailwaystation,heshallbeliablefor\npunishmentasprovidedundersub-section(1).\n(3)Anypersonreferredtoinsub-section(1)orsub-section(2)mayberemovedfromtherailway\ncarriageoranypartoftherailwayorrailwaystation,asthecasemaybe,byanyrailwayservant\nauthorized\ninthisbehalforbyanyotherpersonwhomsuchrailwayservantmaycalltohisaid.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 115, + "text": "Section–145:Drunkennessornuisance.-Ifanypersoninanyrailwaycarriageoruponanypartofa\nrailway-\n(a)isinastateofintoxication;or\n(b)commitsanynuisanceoractofindecencyorusesabusiveorobscenelanguage;or\n(c)willfullyorwithoutexcuseinterfereswithanyamenityprovidedbytherailway\nadministrationsoastoaffectthecomfortabletravelofanypassenger,hemayberemoved\nfromtherailwaybyanyrailwayservantandshall,inadditiontotheforfeitureofhispassor\nticket,bepunishablewithimprisonmentwhichmayextendtosixmonthsandwithfinewhich\nmayextendtofivehundredrupees.\nProvidedthatintheabsenceofspecialandadequatereasonstothecontrarytobementionedinthe\njudgmentofthecourt,suchpunishmentshallnotbelessthan--\n(a)afineofonehundredrupeesinthecaseofconvictionforthefirstoffence;and\n(b)imprisonmentofonemonthandafineoftwohundredandfiftyrupees,inthecaseof\nconvictionforsecondorsubsequentoffence.\nSection–146:Obstructingrailwayservantinhisduties.-Ifanypersonwillfullyobstructsorprevents\nanyrailwayservantinthedischargeofhisduties,heshallbepunishablewithimprisonmentfora\ntermwhichmayextendtosixmonths,orwithfinewhichmayextendtoonethousandrupees,orwith\nboth.\nSection–147:Trespassandrefusaltodesistfromtrespass.-\n(1)Ifanypersonentersuponorintoanypartofarailwaywithoutlawfulauthority,orhavinglawfully\nentereduponorintosuchpartmisusessuchpropertyorrefusestoleave,heshallbepunishablewith\nimprisonmentforatermwhichmayextendtosixmonths,orwithfinewhichmayextendtoone\nthousandrupees,orwithboth:\nProvidedthatintheabsenceofspecialandadequatereasonstothecontrarytobementioned\ninthejudgmentofthecourt,suchpunishmentshallnotbelessthanafineoffivehundredrupees.\n(2)Anypersonreferredtoinsub-section(1)mayberemovedfromtherailwaybyanyrailwayservant\norbyanyotherpersonwhomsuchrailwayservantmaycalltohisaid.\nSection-155:Enteringintoacompartmentreservedforothersorresistingentryinto.-\n(1)Ifanypassenger—\n(a)Havingenteredacompartmentwhereinnoberthorseathasbeenreservedbyarailway\nadministrationforhisuse,or\n(b)havingunauthorizedoccupiedaberthorseatreservedbyarailwayadministrationforthe\nuseofanotherpassenger,refusestoleaveitwhenrequiredtodosobyanyrailwayservant\nauthorizedinthisbehalf,suchrailwayservantmayremovehimorcausehimtoberemoved,\nwiththeaidofanyotherperson,fromthecompartment,berthorseat,asthecasemaybe,and\nheshallalsobepunishablewithfinewhichmayextendtofivehundredrupees.\n(2)Ifanypassengerresiststhelawfulentryofanotherpassengerintoacompartmentnotreservedfor\ntheuseofthepassengerresisting,heshallbepunishablewithfinewhichmayextendtotwohundred\nrupees.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 116, + "text": "Section–156:Travellingonroof,steporengineofatrain.-Ifanypassengeroranyotherperson,\nafterbeingwarnedbyarailwayservanttodesist,persistsintravellingontheroof,steporfootboard\nofanycarriageoronanengine,orinanyotherpartofatrainnotintendedfortheuseofpassengers,\nheshallbepunishablewithimprisonmentforatermwhichmayextendtothreemonths,orwithfine\nwhichmayextendtofivehundredrupees,orwithbothandmayberemovedfromtherailwaybyany\nrailwayservant.\nSection–157:Alteringordefacingpassorticket.-Ifanypassengerwillfullyaltersordefaceshis\npassorticketsoastorenderthedate,numberoranymaterialportionthereofillegible,heshallbe\npunishablewithimprisonmentforatermwhichmayextendtothreemonths,orwithfinewhichmay\nextendtofivehundredrupees,orwithboth.\nSection–162:Enteringcarriageorotherplacereservedforfemales.-Ifamalepersonknowingor\nhavingreasontobelievethatacarriage,compartment,berthorseatinatrainorroomorotherplace\nisreservedbyarailwayadministrationfortheexclusiveuseoffemales,withoutlawfulexcuse,--\na)Enterssuchcarriage,compartment,roomorotherplace,orhavingenteredsuchcarriage,\ncompartment,roomorplace,remainstherein;\nb)Occupiesanysuchberthorseathavingbeenrequiredbyanyrailwayservanttovacateit\nHe(Thesaidpassenger)shall,inadditiontobeingliabletoforfeitureofhispassorticket,be\npunishablewithfinewhichmayextendtofivehundredrupeesandmayalsoberemovedbyany\nrailwayservant.\nSection–163:Givingfalseaccountofgoods.-Ifanypersonrequiredtofurnishanaccountofgoods\nundersection66,givesanaccountwhichismateriallyfalse,heand,ifheisnottheownerofthegoods,\ntheowneralsoshall,withoutprejudicetohisliabilitytopayanyfreightorotherchargeunderany\nprovisionofthisAct,bepunishablewithfinewhichmayextendtofivehundredrupeesforevery\nquintalorpartthereofofsuchgoods.\nSection–164:Unlawfullybringingdangerousgoodsonarailway.-Ifanyperson,incontraventionof\nsection67,takeswithhimanydangerousgoodsorentrustssuchgoodsforcarriagetotherailway\nadministration,heshallbepunishablewithimprisonmentforatermwhichmayextendtothreeyears,\norwithfinewhichmayextendtoonethousandrupeesorwithbothandshallalsobeliableforany\nloss,injuryordamagewhichmaybecausedbyreasonofbringingsuchgoodsontherailway.303\nSection–165:Unlawfullybringingoffensivegoodsonarailway.-Ifanyperson,incontraventionof\nsection67,takeswithhimanyoffensivegoodsorentrustssuchgoodsforcarriagetotherailway\nadministration,heshallbepunishablewithfinewhichmayextendtofivehundredrupeesandshall\nalsobeliableforanyloss,injuryordamagewhichmaybecausedbyreasonofbringingsuchgoodson\ntherailway.\nSection–166:Defacingpublicnotices.-Ifanypersonwithoutlawfulauthority—\n(a)pullsdownorwillfullydamagesanyboardordocumentsetuporpostedbytheorderofa\nrailwayadministrationonarailwayoranyrollingstock;or\n(b)obliteratesoraltersanylettersorfiguresuponanysuchboardordocumentoruponany\nrollingstock,heshallbepunishablewithimprisonmentforatermwhichmayextendtoone\nmonth,orwithfinewhichmayextendtofivehundredrupees,orwithboth.\nSection–167:ProhibitionofSmoking-(1)Nopersoninanycompartmentofatrainshall,ifobjected\ntobyanyotherpassengerinthatcompartment,smoketherein.\n(2)Notwithstandinganythingcontainedinsub-section(1),arailwayadministrationmayprohibit", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 117, + "text": "smokinginanytrainorpartofatrain.\n(3)Whosoevercontravenestheprovisionsofsub-section(1)orsub-section(2)shallbepunishable\nwithfinewhichmayextendtoonehundredrupees.\nSection–172:Penaltyforintoxication.-Ifanyrailwayservantisinastateofintoxicationwhileon\nduty,heshallbepunishablewithfinewhichmayextendtofivehundredrupeesandwhenthe\nperformanceofanydutyinsuchstateislikelytoendangerthesafetyofanypersontravellingonor\nbeinguponarailway,suchrailwayservantshallbepunishablewithimprisonmentforatermwhich\nmayextendtooneyear,orwithfine,orwithboth.\n179.Arrestforoffencesundercertainsections.-\n(1)Ifapersoncommitsanyoffencementionedinsections137,141to147,150to157,\n160to162,164,166,168and172to175,hemaybearrestedwithoutwarrantorotherwritten\nauthoritybyanyrailwayservantorpoliceofficernotbelowtherankofaheadconstable.\n(2)Therailwayservantorthepoliceofficermaycalltohisaidanyotherpersontoeffectthearrest\nundersub-section(1).\n(3)AnypersonsoarrestedunderthissectionshallbeproducedbeforethenearestMagistratewithina\nperiodoftwenty-fourhoursofsucharrestexcludingthetimenecessaryforthejourneyfromthe\nplaceofarresttothecourtoftheMagistrate.\n180.Arrestofpersonslikelytoabscond,etc.\n(1)IfanypersonwhocommitsanyoffenceunderthisAct,otherthananoffencementionedinsection\n179,orisliabletopayanyexcesschargeorothersumdemandedundersection138,failsorrefusesto\ngivehis\nnameandaddressorthereisreasontobelievethatthenameandaddressgivenbyhimarefictitious\northathewillabscond,anyrailwayservantauthorizedinthisbehalforanypoliceofficernotbelow\ntherankofaheadconstablemayarresthimwithoutwarrantorwrittenauthority.\n(2)Therailwayservantorthepoliceofficermaycalltohisaidanyotherpersontoeffectthearrest\nundersub-section(1).\n(3)AnypersonarrestedunderthissectionshallbeproducedbeforethenearestMagistratewithina\nperiodoftwenty-fourhoursofsucharrestexcludingthetimenecessaryforthejourneyfromthe\nplaceofarresttothecourtoftheMagistrateunlessheisreleasedearlierongivingbailorifhistrue\nnameandaddressareascertainedonexecutingabondwithoutsuretiesforhisappearancebeforethe\nMagistratehavingjurisdictiontotryhimfortheoffence.\n(4)TheprovisionsofChapterXXIIIoftheCodeofCriminalProcedure,1973(2of1974),shall,sofaras\nmaybe,applytothegivingofbailandtheexecutionofbondsunderthissection.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 118, + "text": "Chapter-13\nChargesheetandRailwayMagistrates\n1301.DefinitionofCognizableandNoncognizableoffences:\n1301.1Cognizable-‘Cognizable’offencemeansanoffencefor,and‘Cognizablecase’meansacasein\nwhichapoliceofficer/AuthorizedRely.Servantmayarrestwithoutwarrant.\n1301.2NonCognizable-‘NonCognizable’offencemeansanoffencefor,and‘NonCognizablecase’\nmeansacaseinwhichapoliceofficer/AuthorizedRely.Servantmaynotarrestwithoutwarrant..\n1302.Chargesheet-WhenapassengersaremadeovertotheGRP/RPFbytheRailwaystafffor\nprosecutionbeforetheMagistratefortrialeitherforticketlesstravellingorforthenoncognizable\ncase,ChargesheetinproperformaretobesubmittedtothenonGRP/RPFalongwithsuch\npassengers.Thesechargesheetsareintwodifferentformsi.e.forticketlesspassengersandtheother\nforothercases.\n1303.RailwayMagistrate:\nNotwithstandinganythingcontainedinthecodeofcriminalprocedure,1973(2of1974),nocourt\ninferiortothatofametropolitanmagistrateorajudicialmagistrateofthefirstclassshalltryanycase\nundertherailwayact.\na.InordertodealexpeditiouslywithticketlesspassengerswholetimeRailwaymagistrateboth\nstationaryandmobilewithspecificjurisdictionhavebeenappointedonmostofRailways.\nb.Anypersoncommittinganoffenceunderrailwayactoranyrulemadethereundershallbe\ntriableforsuchoffencesinanyplacewhichhemaybeorwhichthestategovernmentmay\nnotifyinthisbehalf,aswellasinanyotherplaceinwhichheisliabletobetriedunderanylaw\nforthetimebeinginforce.\nEverynotificationundersub-section(1)shallbepublishedintheofficialGazetteandacopy\nthereofshallbeexhibitedfortheinformationinthepublicplacesatrailwaystationsasthe\nstategovernmentmaydirect.\nc.TheMagistrateshavemostlybeenprovidedwithcourtroomsituatedeitherinthestation", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 119, + "text": "buildingsorintheneighborhood.\nd.TheseMagistratewillalsodisposeofcasespertainingtoothernoncognizableoffences,\nreferredtothischapter.\ne.AsstationwherethereisnoRailwaymagistrateareposted,Railwaycaseswillbedealtwith\neitherbymagistratespeciallydeputedforthepurposebystateGovernmentoratthelocal\nCivilcourt.\n1304.Chargesheetforticketlesspassengers-\na.AspecimenofthisformisinAppendix‘I’anshouldbeusedforprosecutionofticketless\npassengersundersection137&138ofIndianRailwayAct.\nb.Chargesheetsareseriallynumberedandhave3foils,Record,PoliceandAccountswhichare\nwritteninoneoperationwithadoublesidedcarbonpaper.\nc.Thechargesheetagainstpassengersshouldbecorrectlyframedandthepolicecopyofcharge\nsheetshouldbehandedovertotheGRP/RPFalongwithpassengerforfurtheraction.\nd.TheAccountsfoilofchargesheetistobesignedbyGRP/RPFintokenofhavingreceivedthe\nticketlesspassengersandreturnedtotheRailwaystaff.Alistofallchargesheetsissued\nduringthemonthalongwiththeindividualaccountsfoilaretobesenttothechiefAccount\nofficeralongwiththebalancesheetofthemonth.Theamountofchargesheetwillnothowever\nbeincludedasdebitorcreditofbalancesheet.\ne.ThepoliceauthoritiesmustproducethearrestedpersonsbeforethenearestMagistratewith\nleastpossibledelay.\n1305.ResultSlips-\na.Atthefootofthechargesheetformthereisadetachableportionheaded‘ResultSlip’bearing\ntheserialnumberofthechargesheet.\nb.AftertheMagistratefinallydisposesofthecases,hewillentertheparticularsoftheamountif\nanyrealizedandreturnthe‘Resultslip’tostationconcerned.\nc.Chiefticketinspector/HeadticketcollectororStationmanager/masterissuingchargesheets\nareresponsibleforseeingthatallresultslipsarereceivedbackfromtheMagistrateand\nparticularscopiedonthe‘record’foilofchargesheetandtheoriginalresultslipsenttothe\nchiefaccountofficer(TA)withthemonthlyreturns.IntheeventofCTI/HD.Ticketcollectoror\nSS/SMfailingtogetallresultslipbackfromMagistratewithinareasonabletime,heshould\nreportthemattertohisSR.DCMfornecessaryaction.\nd.Ateachstationaregisteristobemaintainedshowingdetailsofcasessentundersection137\nand138andresultofprosecutionintheformshownintheappendix‘P’.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 120, + "text": "1306.DisposalofcashrealizedbySpecialRailwayMagistrate-TheRailwayfaresrealizedbythe\nRailwayMagistratefromticketlesspassengersisdepositedinRailwayandjudicialfinedepositedin\ntheStateTreasury.\n1307.Chargesheetsforoffencesotherthanticketlesspassengers(undersection137&138)-A\nspecimenofthechargesheetwhichistobeissuedinfollowingcaseshowninappendix‘A’\n1307.1.Noncognizableoffences:-\nSectionofIRA Subject\nSection-57 beingandsufferingpersontotravelwithinfectiousorcontagious\ndisease.\nSection-142 transferoftickets.\nSection-144 Canvassing,HawkingorbeggingonaRailwaypremises.\nSection-147 Trespassorrefusetodesistfromtrespass.\nSection-155 Enteringcompartmentreservedoralreadyfullorresistingentry\nintoacompartmentnotfull.\nSection-156 Travellingonroof,steporonengineoftrain.\nSection-157 Alteringordefacingapassorticket.\nSection-164 Unlawfullybringingofdangerousgoodsonarailway.\nSection-165 Unlawfullybringingofoffensivegoodsonarailway.\nSection-166 DefacingPublicnotices.\nSection-167 Smoking\nNote:Thesechargesheetsarenotseriallynumberedandaremadeoutinduplicateonly,onefor\nRecordandotherforpolice.\n1307.2.cognizableoffences:-\nSectionofIRA Subject\nSection-137 Fraudulentlytravellingorattemptingtotravelwithoutproperpass\norticket.\nSection-141 Needlesslyinterferingwithmeansofcommunicationinatrain(ACP).\nSection-145 DrunkennessornuisanceonRailway.\nSection-146 ObstructingaRailwayservantinhisduties.\nSection-150 Maliciouslywrackingorattemptingtohurtpersonstravellingina", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 121, + "text": "train.\nSection-153 Endangeringsafetyofpersonstravellingberailwaybywillfulactor\nomission.\nSection-162 Enteringcarriageorotherplacereservedforfemales.\nSection-168 Subsection(i)Actsofchildrenendangeringsafetyofpersons\ntravellingbyarailway.\nSection-172 Drunkennessofrailwayservantonduty.\nSection-175 Endangeringthesafetyofpersonsbyarailwayservant.\nNOTE:\n1.Nospecialforofchargesheetisrequiredinthesecasesbutawrittenreportmustbemadeto\nthepolicewhowilltakefurtheraction.AdetailedreportmustbesubmittedtoSr.DCM.\n2.Undersection137regularchargesheetcanbeissued\n3.Onlyseniorstaffshouldissuechargesheetsforother“non-cognizableoffences”andreport\n“cognizableoffences”tothepolice.\n1308.Prosecutionofchildrenfornon-cognizableandcognizableoffences-\n1308.1.Section82(Indianpenalcode)-Nothingisanoffencewhichisdonebyachildunderseven\nyearsofage.\n1308.2.Section83(Indianpenalcode)–Nothingisanoffencewhichisdonebyachildabove7years\nageandunder12yearswhohasnotattainingsufficientmaturityofunderstandingtojudgethe\nnatureandconsequenceofhisconductonthatoccasion.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 122, + "text": "Chapter-14\nVariousKindofChecks\n1401.Objectofcheckandcollectionoftickets-\nPassenger’sticketsarecheckedandcollectedwiththeobjectof:\ni.Ensuringthateverypassengerisinpossessionofaproperticket(orotherauthority)entitling\nhimtotravelbytheparticularclassortrainortoenterrailwaypremises.\nii.Examinationwhetherticketisissuedinconformitywiththeprescribedrulesandinstructions;\nand\niii.Seeing(ultimately)thattheticketshavebeencorrectlyaccountedforinrailwaybooks.\n1402.KindsofChecks:\nInadditiontothepreventionoftheticketlessandotherirregulartravelthefollowingtypeofchecks\nareconductedtoascertainthepercentageofticketlessandotherirregulartravelobtainableoneach\nsectionorspot.\n1.Concentratedsectioncheck\n2.Concentratedspotcheck\n3.Replacementcheck\n4.Crosscountryorsurprisecheckbyroad\n5.magisterialcheck\n6.Fortresscheck", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 123, + "text": "7.Ambushcheckraids\n8.Massiveoperationalcheck\n9.Mid-sectioncheck\n1402.1.Concentratedsectioncheck:ThischeckisarrangedonastandardizedsectionofaRailway\ncoveringaperiodof3daysorforaminimum24hourscoveringalltrainsrunningonthesection.The\nstaffisdeputedoneachbogieofeachtrainrunningonthissectiontoensurethatnopassengeris\ntravellingwithoutorwithirregulartickettherein.\nStandardsectionisasectionprescribedbytheRailwayAdministrationinordertobring\nuniformityintheRailwayworkingofalldepartments.Thefollowingstatisticaldataisfurnishedinthe\nrelevantstatementafterthecompletionofthecheck-\na.Totalno.ofstaffutilized\nb.Totalno.oftrainschecked\nc.Carryingcapacityofeachtrainanditsactualoccupation.\nd.Totalnumberofpassengerschargedeitherfortravellingwithoutorwithirregularticketorfor\ncarryingun-bookedandpartiallybookedluggage.\ne.Totalearningsrealized.\nf.TotalT.T.E.TrainKilometerworkedoutduringthecheck.\ng.Numberofbeggarsturnedout.\nh.Numberofpassengerssufferedimprisonmentandnumberofpassengersletoffbythecourt.\ni.Bookingwindowearningsforthedayofcheck,fortheprevious3daysandforthe\ncorrespondingdayoftheweek.\n1402.2.ConcentratedSpotCheck-\nThischeckisarrangedatastationorspotconcentratingalargenumberofstaffforchecking,which\nincludesTTEs,HawkersandBeggarscheckers,RakshaksandGRP/RPF.AsperRailwayBoard`sorder,\nthischeckshouldbearrangedforonecalendardateandfor24hours.Howeverduetopaucityofstaff,\nthischeckcanbeholdatastationcoveringaminimumof3trainspassingsuchaspot.Censusof\ntrainssubjectedtocheckistoberecordedalongwiththeoccupationonthedayofcheck.Duringsuch\nacheckallpassengersinthetrainsarethoroughlychecked.Thefollowingparticularsaretobe\nfurnishedtotheofficeafterthecheckisover.\na.Totalno.ofstaffutilized\nb.Totalno.oftrainssubjectedtochecked\nc.Carryingcapacityofeachtrainanditsactualoccupation.\nd.Totalnumberofpassengerschargedwithexcesscharge.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 124, + "text": "e.Totalnumberofpassengerschargedforcarryingun-bookedluggageandpartiallybooked\nluggage.\nf.Amountinrespectedofitem(d)and(e).\ng.Numberofpassengersprosecutedandamountoffineandfarerecoveredbythecourt.\nh.Numberofpassengersimprisonedorletoff.\ni.TotalNumberofpassengerschargedandtotalamountrecovered.\nj.Bookingwindowearningsforthedayofcheck,fortheprevious3daysandforthe\ncorrespondingdayoftheweek.\nifthepercentageofticketlessandotherirregulartravelismorethan3%,itisconsideredasaBAD\nSPOT.3similarchecksarenecessarytodeclareaspotasabadspot.\n1402.3.Replacementcheck-\nThischeckisintroducedwithaviewtojudgetheefficiencyofthestationticketcheckingstaff.This\ncheckisarrangedonastationwhereticketcollectorsfailstoachievetherequisitestandardof\nearninglaiddownbythedivisionauthorities.Similarlythisreplacementcheckcanalsobeconducted\noncertainsectionswhereTTEsarepostedintrainTTEsystemorsectionalTE/TTEsareposted.\nWhilearrangingsuchchecks,thefollowingfactorsshouldbespeciallytakenintoconsideration:\na.Equalno.ofstaffutilized.\nb.Dutiesshouldbeperformedaccordingtotherosterofstaffonthestationorsection.\nc.Thecheckshouldarrangeonnormaldayorweekday.\nOncompletionofthecheck,thefollowingdatashouldbefurnishedtotheoffice-\na.Totalearningsofthestaffwithbreakupforthelast12monthsindicatingthetargetfixedfor\ntheselectionforthestationorTTEandreasonsfornotachievingit.\nb.Comparativestatementshowingtheparticularsofexcessfareearningsrealizedandbooking\nwindowscalesinrespectof:\ni.Dayofcheck.\nii.2daysprevioustocheck.\niii.Correspondingofthepreviousmonth.\nIftheearningsofthereplacementcheckaremorethanthatofthepermanentstaff,areport\nwillbesubmittedontheslackworkingofthepermanentstafffornecessaryaction.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 125, + "text": "1402.4.CrosscountryorSurpriseChecksbyroad-\nThisispurelyasurprisecheckconductedonabadsection,whereitisknownthattheticketlessor\nirregulartravelisonahighsideorisconnivedatbythestaffworkingonthetrains.Alargenumberof\ntheticketcheckingstaffaccompaniedbyRPFandGRPpersonneltravelbyroadeitherbyBusorany\notherconveyancetoaparticularspotandsubjectedtotheintendedtraintoasurprisecheck.The\nelementofsurpriseandsecrecyismaintainedatallcoststomakesuchsurprisechecksasuccess.\nDuringthesecheckstheentiretrainsissubjectedtoathoroughlycheckatthehaltandsubsequently\nontherunofthetrain.Theresultsofsuchcheckaresubmittedinthesamemannerasinthecaseon\nconcentratedspotchecks.Inaddition,theamountofhirechargesforconveyanceincurredonaccount\nofthesechecksisalsoindicatedtherein.\n1402.5.MagisterialCheck-\nThischeckisarrangedwiththehelpofMagistrateandGRPpersonnelwithaviewtocheckeffectively\ntheincidenceofticketlesstravel.Personsapprehendedaresummarilytriedanddisposedoffbythe\nMagistrateonthespot.Astatementdisplayingoftheprosecutionslaunchedduringsuchchecksare\nsubmittedtotheDivisionalofficebytheIn-chargeforfurtherdisposal.\n1402.6.FortressChecks-\nFortressmeansafortifiedplace,andaFortresscheckwouldnormallymeantheentirestation\nplatformbecondemnedoff,sothatnotasinglepersoncouldgainentryorexitfromanyotherplace\nthantheauthorizedgates.Toensurethesearrangementsitisnecessarytodeputeadequateticket\ncheckingstaff,GRPandRPFpersonnelassistedbyvolunteersforthesechecks.Thesejunction\nstationsstrategicallysituatedshouldbechosenforthesiteofthesechecks.\n1402.7.AmbushedchecksRaids-\nIntheyear1967theincidenceofalarmchainpullingreachedalarmingproportionsandanewcheck\nknownas‘ambushraids’cameintoexistencetointensifythedetectionofthosewhopullthealarm\nchainforunjustifiedreasons,asalsotorounduptheticketlesstravelerswhogetawaywithouttickets\nfromthetrainbydetainingitawayfromthestations.\nForthepurposeofthesecheck,sufficientticketcheckingstaffassistedbyGRP/RPFpersonnelare\ndeployedonthatdayinwaitwellintimebeforethearrivalofthetrain,ataplacewherealarmchain\nisusually/regularlypulled.Notonlytheoffendersindulginginunauthorizedalarmchainpullingbut\nalsothoseentrainingatunauthorizedhalts,aredealtwith.\n1402.8.Massiveoperationalchecks-\nThesechecksaretobeconductedoveraradiusof80kms.againstticketlesstravelforadurationof3\nto6days.\nThefollowingchecksareconductedovertheareatobecovered:\ni.Runningtrainchecks\nii.SpotChecks", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 126, + "text": "iii.RoadChecks\niv.AmbushRaids.\nTwotothreemagistratesshouldbeutilizedatstrategicallyspotfortryingthecasespreventedunder\ntheIndianRailwayAct.\nComparativefiguresofbookingwindowearningshouldberecordedtoshowtheimpactofthecheck\novertheareaofcheck.\n1402.9.Mid-sectioncheck-\nThisisasurprisechecktobeaconductedbytheHeadquartersticketcheckingsquadsomewhereina\nMid-section.TheticketcheckingstaffworkingthetrainVIZConductor/SleepercoachTTE/Attendants\netc.shouldbereplacedbytheHeadquartersticketcheckingstaff.Theworkingstaffrecheckthe\ntrain/Carriagetakenover.Thecheckshouldbeconductedatfrequentintervalsondifferentintervals\nondifferentsectionsineachdivisionandsevereactionisbetakenagainsttheRailwaystaffif\nticketlesstravelisdetectedonthetrainonwhichcheckswerealreadyexercised.\n1403.Surprisecheckstocombatticketlesstraveling-\nSurprisechecksshouldbecarriedoutbothatstationsandinrunningtrains,byspecialsquads\nconsistingoftravellingticketexaminersassistedbyGRP/RPFunderthesupervisionofselected\nsubordinates.Allcasesoffraudortravellingwithoutticketdetectedduringthecourseofthese\nsurprisechecksshouldbecarefullyexaminedtoseewhethertheyhavebeenfacilitatedbydefectsin\nthesystemorchecksinforce.Theresultofsurprisechecksshouldbejudgetheefficiencyofthework\nofstationstaffandsectionaltravellingticketexaminersandremedialmeasures,whenevercalledfor,\nshouldbetakentoeliminateticketlesstraveling.\n1404.Specialstepstocombatticketlesstravelonpartofstudents-\nPreventionofticketlesstravelbystudentsastoalargeextentamatterofsocialeducationonfor\nwhichtheactivecooperationoftheeducationalauthoritiesisessential.Itistherefore,desirablefor\nSr.DCMmaintainacloseliaisonwiththeheadsoftheeducationalinstitutionsintheirrespective\njurisdictions.Chiefinspectorofticketsshouldmaintainthiscontactatapersonallevel.\nTheyshouldalsoperiodicallyarrangetoaddressthestudentsandexplaintothemthe\nundesirabilityoftravellingbyrailwithoutholdingpropertickets.Theheadsoftheeducational\ninstitutionsshouldberequestedtotakeseveredisciplinaryactionagainstthestudentswhoare\nreportedbytheRailwayauthoritiestohavetravellingwithoutticket.Inadditiontheyshouldbe\nrequestedtotakeactiononthefollowinglines:\n1.Obtaindeclarationfromeverystudentinregardtoplaceofresidence.\n2.Incasethestudentresidesattheplacewherefromherequiredtoavailofrailtransportto\nattendhisschool/college,heshouldbeprovidedwiththestudentsconcessionformtoobtaina", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 127, + "text": "seasonticketatconcessionalrateapplicabletostudents.\n3.Aregistershouldbemaintainedindicatingthenameofsuchstudentsasalsotheparticularsof\nconcessionformsuppliedtothem.\n4.Classandnumberofindividualticketsobtainedinlieuofconcessionformshouldberecorded\nintheregisteragainstthenameofeverystudent.\n5.Responsiblerepresentativeofstudentsmaybenominatedbytheeducationalauthoritiesto\nseethattheirfriendsdonotresorttosuchpractices.\n6.Theheadsofeducationalinstitutionsmayeitherpersonallyattendsomeofthechecksagainst\nticketlesstravelersornominatesomeoftheirseniorstafftoattendsuchcheckstoproduce\nnecessarymoraleffectsonthestudents.\nAllstationshouldsubmittotheirSr.DCMamonthlystatementgivingthefullparticularsofthe\nstudentsmonthlyseasonpurchasedbystudentsofvariouseducationalinstitutionsservedbythe\nstation.Thisshouldalsoenabledivisionalofficertocomparethesefigureswiththerecords\nmaintainedbytheeducationalinstitutionsandtakesuitableactionincaseofdiscrepancy.\nParticularsofallstudentsdetectedtravellingirregularlyduringcheckshouldberecordedbyticket\ncheckingnames,givingtheirname,age,father’sname,placeofresidence,institutionswhere\nstudyingandclassinwhichstudyingetc.\nAdetailedreportshouldthenbefurnishedtotheSr.DCMtoenablethelatertoreporttheheadsof\neducationalinstitutionsconcernedfortakingdisciplinaryactionagainstthestudentconcerned.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 128, + "text": "Chapter-15\nRulesregardingExamination,CollectionandDisposaloftickets\n1501.CheckingofReservedandUnreservedComputerizedTickets-\nThereservedandunreservedjourneyticketsareissuedmanuallyaswellasbycomputerized\nsystem.Althoughboththesystemhavebeendevisedwithvarioustypeofsafeguardstopreventits\nmisusebyunscrupulousperson/staff.Howeverthefollowingsignificantpointsshouldbekeptinmind\nwhileexamining/checkingcomputerizedtickets.\na.Reservedcomputerizedtickets-TheseticketareissuedwithPRSwithfollowingdescription:\nPNRno.,Trainno.,Dateofjourney,FromandTo,Class,Fare,RT/SCauthorityofissue,Age,Sex,\nStatus,CoachNo.andSeatno.,Randomno.,Dateofissue,timeofissue,stationofissue,\nterminalno.anddeparturetimeoftrainnumber.\nTicketcheckingstaffwhilecheckingsuchticketsshouldminutelychecktheabove\nentriestoascertainthatthepassengerisholdingthecorrectticket.Theyshouldalsocheckthe\nauthoritymentionedinsuchticketsandpassengerfoundtravellingwithauthoritymentioned\nthereinshouldbetreatedastravellingwithoutticket.Theyshouldalsocheckthatthezero\namountticketsissuedfromcomputerterminalareaccompaniedbyvalidpass,BPT,EFT,any\nothertravelauthorityifany.\nIthasbeenobservedthatcertainunscrupulouspersons/staffindulgeinprocuringthe\nreservationonfakeBPTs,EFTs,Soldierstickets,Studentconcession,Orthopedichandicapped\ncertificateconcession,TBconcessionetc.Ticketcheckingstaffshouldminutelycheckthese\nticketsandmayinterrogatethepassengerstoexaminethegenuinenessoftheauthorityof\nzeroamountquotedinPNRtickets.\nSometimesunscrupulouspersonsprocurereservationfromsuchterminalsonexpired\ndateorusedtickets,TTEs,TCsshouldtactfullydetectsuchmalpracticebyverificationfromthe\npassengers.AdvancereservationonPRSisnotpermittedenrouteonpreboughtticketunless\ncoveredbysecuringmemoortelegram,passengerdetectedtravellingonsuchreservation\nshouldbethoroughlychecked.NofreeEFTshouldbeissuedinsuchcasewhenitisestablished\nthattheticketheldbythepassengerisfakeorexpireddatedandsuchpassengersshouldbe\ndealtwithunderrelevantsectionofIRA/IPCasthecasemaybe.\nTicketcheckingstaffshouldalsoensurethatpassengeriscarryingoriginalPNRticket,\nasjourneyonphotocopyofticketisnotpermitted.Theyshouldalsochecktherandomno.\nmentionedinsuchticketsastherandomno.ofparticulardateandclassisalwaysthesameby\nthattrainirrespectiveofthedateofissueandplanofissue.Staffshallalsocheckdigitsviz\n“Lastthreedigitsprintedbycomputeragainstactualserialno.ofticketroll”areidenticaland\ncorrect.\nSpecialattentionshouldbegivenbyticketcheckingstafftocheckthatMPprocuring", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 129, + "text": "reservationonauthorityofidentitycardno.havingPNRticketsareactuallytravelling.The\nidentitycardofsuchreservationshouldinvariablycheckedtoensurethatsomeimpostersare\nnottravellingonsuchreservations.\nb.Unreservedcomputerizedtickets-Theseticketsareissuedonaprescribedstandardsizeand\ntypeofpaperwithfollowingdescriptions:\nSerialno.oftheticket,FromandTo,Class,,Supercharge,Noofpassengers,Fare,natureof\nconcession,Date,TimeofissueandRandomno.andcounterno.Thepassengermaypurchase\nanyclassordestinationofticketfromanycomputercounterbuttherandomno.ofevery\ndestinationthoughchangeseveryday,shallbesameforparticulardayanddateofonestation.\nTheticketcheckingstaffwhilecheckingunreservedcomputerizedticketsshouldinvariably\nchecktherandomnumber,dateandtimeofissuetopreventmisuseorreuseofanyfakeand\nexpireddatetickets.TheTTEandTCshouldniptheseticketseitherbycheckingnipperorbyink\nendorsement.Sinceserialnumberofsuchticketsforaparticulardateandstationsarenot\nconsecutiveassuchgenuinenessofticketscanonlybeascertainfromthecheckofdateofissue,\ntimeofissueandrandomnos.watermarkandhessianonticketformat.\n1502.CheckingofLadiescompartment-\n1.Thecheckofcarriagereservedforladieswillordinarilybemadeatstationswherethereisa\nladyticketcollectorbutinothercasestheworkofcheckandcollectionofticketsfromlady\npassengerswillbedoneatdestinationstationaftertheyalight.Travellingticketexaminersare\nforbiddenfromenteringcarriagessetapartforladies.\n2.maleticketcollectors/Travellingticketexaminersmaychecktheticketsofpassengersina\nfemalecompartmentfromplatform,ifrequired.\n1503.CheckingofRMS(RailMailService)Compartments-\n1.Thisshouldbeinvariablycheckedlikeotherpassengercompartmentsandirregularities\nnoticedmustbereported.Thestaffishowever,strictly,prohibitedfromtravellinginsuch\ncompartments.\n2.RMScompartmentshouldhowevertobecheckedfrominsideasincaseofothercompartments.\n3.EverymemberofRMSstaff,whileondutyshallholdmetaltokenoridentitycard,indicating\nthedivisionofRMSandaserialnumber,asanauthorityfortravellinginRMScompartment.\nTheyalsohaveinstructionstoshowtheirtokensoridentitycardondemandtotheRailway\nstaffresponsibleforcheckingoftickets.\n4.UnauthorizedpersonstravellinginRMScompartmentaretobechargedas1stclassfarewith\nexcesschargeinaccordancewithrulesandevictedfromthevanandmatterreported.\n5.Aftercheckingthecompartment,theticketcheckingstaffshouldsignthedailyreportofRMS.\nHeadsorterandticketcheckingstaffspeciallymentionthereinanyirregularitythatmighthad\nbeennoticedbyhimduringthecourseofhischeckinadditiontomakingaspecialreporttothe\nDCM.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 130, + "text": "1504.CheckingofPantryCars-\n1.PantrycarsarerunningoncertainMail/Expresstrainsorpassengerstrainsasspecifiedintime\ntable,shouldalsobecheckedbyTTEs.\n2.Staffofpantrycarsissuppliedwithnecessarypassesandtravellingticketsexaminersareto\ncheckthatnounauthorizedpersonstravelwiththem.\n1505.Checkingofticketsinreservedcoaches-\n1.Ticketsofpassengersintravellinginreservedcoachshouldusuallybecheckedduringtheday\nbutwhenitisfoundnecessary,checksshouldalsobemadebetween21.00hrsand6.00hrs.,\nutmostcarebeingtakenbytheticketcheckingstafftoensurethatthepassengersarenot\nundulydisturbedthereby.\n2.Secondclasspassengerticketsaretobeexaminedintrainsduringthedayaswellasnight.\n3.Checkingofticketsatthecommencementofthejourney,thecoachattendantwhereever\nauthorizedtodosowillcheckticketsofallpassengerswhoentraininACcoachandheis\nresponsibleforseeingthatallpassengerstravellinginthecoachholdpropertickets.\n4.Conductors/TTEworkingonthetrainswithACcoacheswillalsochecktheticketsto\npassengerstravellingbyACcoaches.\n5.Intheeventofspecialchecksbeingcarriedout,thecoachattendantsassistanceshouldbe\ntakenwherevernecessary.\n6.Railwayemployees,pantrycarstaffandcoachattendantsmustproducetheirpassesatany\ntimeondemand.\n1506.Checkingofunauthorizedtravelbyparceltrains-\nUnauthorizedpassengersdetectedtravellinginpassengerscoaches,parcel-vansorbrake-vansof\nParcelexpresstrainsonsectionswherethesetrainsarenotscheduledtocarrypassengersmustbe\nremovedfromthetrainand,ifwithouttickets,chargesaretoberecoveredfromthemasfollowas:\n1.Inpassengercoachesfaresaccordingtotheclassinwhichfounttravellingplushigherexcess\ncharge.\n2.inparcel-vansandothercoachingvehiclesecondclassfareplusHEC.\n3.Inbrakevans1stclassfareplusHEC.\n1507.Checkingofattendantsofcattletravellingwithoutticketincattlewagons-\nSuchattendantsfoundtravellingwithoutticketsorauthoritytotravelshallbechargedsecondclass\nfareplusHEC.\n1508.CheckingofWorkmen’strains-\n1.Unauthorizedpersonsdetectedtravellingbyworkmentrainprovidedexclusivelyforthe\njourneyofworkmentoandfromworkshop,aretobecharged1stclassfareplusHEC.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 131, + "text": "2.WorkmenholdingworkshopMetaltokendetectedtravellingtoandfromshopbyordinary\npassengerstrainsaretobetreatedaspassengerstravellingwithoutticketsandchargedfare\nandHECasperrules.Suchworkmenhoweverbeenpermittedtotraveloncertainpassenger\ntrainswhicharespecifiedintheworkingtimetableofeachdivision.\n1509.CheckingofHighofficialstravellinginsaloonsandinreservedcarriagesorcompartments-\n1.RulesregardingHighGov.officialstravellinginsaloonsandinreservedcarriagesor\ncompartmentsaredetailedinIRCACoachingtariff.ForreservedcompartmentsforMilitary\nofficersseepara1912ofMilitarytariff.\n2.HighGovt.officialrequisitionsarepresentedintwoportions,onefortheRailwayswhichis\ntreatedascashandtheotherfortheHighofficialswhichishisauthoritytotravel.\n3.Onlyaseniorofficialofthestationinuniformshouldcheckticketsandthismustbedonein\nsuchamannerasnotcauseanyinconveniencetotheoccupants.\nNote-DisputeinchargingchildrenwithoutticketsreferencestoSMonduty-Ticketcollectors,while\nadmittingchildrenthroughgates,shouldexercisepropervigilancesothatchildrenofover5yearsof\nagedonotentrainwithoutpropertickets.Similarcheckwillbeexercisedatthetimeofpassing\nchildrenwhohavealightedfromthetrain.Intheevent,howeverofanydisputeastotheage,\nreferenceshouldbemadetothestationmasteronduty,whoshould,afterpersonallyseeingthechild\ndecidewhetherexcessfareshouldbecollectedornot.\n1510.TicketNippers-\na.Thefollowingkindsofnipperswillbeusedforthepurposeofcheckingandcancellingthe\ntickets.\ni.Gatenippers,whichcutouta‘V’portionfromtheticket;\nExample\nii.Checkingnippers,whichembossontheticket;\n1.Alettertoindicaterailway;and\n2.AletterofletterstoindicateDivision/Areaoftherailwaytowhichtheticket\ncheckingstaffattached,followedbyanumbertoidentifythecheckingstaff.;\n3.Cutoutasemi-circlemarkfromtheticket.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 132, + "text": "Example\niii.Cancellingnippers,whichcutoutan‘M’portionfromtheticket.\nExample\nb.Whennippersarenotavailableorinthecaseofpapertickets,etc.Wherenipperscannotbe\nused,theTicketCollector/TravellingTicketExaminershouldshowthedateandtrainnumber\nunderhisinitialsinindeliblepencilonthereverseoftheticket.\n1511.Checkingandnippingofticketsatstationsofcommencementofjourney-\na)Nopersonshouldbeallowedtoentertheplatformofastationwithoutaproperpassoraticket.\nAtstations,whereTicketCollectorsarepostedinall,allthecardticketsofpassengers\nadmittedtoplatformsshouldbenippedwithgatenippers.Attheotherstationstheticket\nshouldbesonippedbytheBookingClerkbeforehandlingovertheticketstopassenger.The\nticketshouldbenippedatthecenterofthebottomportion.\nb)Thenippingshouldbedonecarefullysothatthematterontheticketisnotcutout.\n1512.Collectionanddisposalofcollectedtickets-\nPassengers,whileterminatingtheirjourneyshouldsurrendertheirjourneyticketsatthegatebefore\nleavingthestationpremises.Thestaffondutyattheexitgate,whilecollectingtheticketsshould\nsatisfythemselvesregardingthefollowing-\nTheticketmustbeproperandissuedaccordingtoRailwayrules.Further,ticketmustbeintact\nwithoutanydamage.Theticketshouldcorrespondtothejourneyperformed.Thestaffshouldsatisfy\nhimthatthejourneyhasbeencompletedwithinthecurrencyperiodoftheticket,takinginto\nconsiderationoftheissueandendorsementregardinganybreakofjourney.Ifthereisnobreakof\njourneyendorsementthepassengershouldbeastravellingwithatimeexpiredticket.Specialcheck\nmustbemadeonnon-transferableticketslikeseasontickets,concessiontickets,reservedtickets,\npassesandPROtickets.Insuchcasesthesignatureofthepersonconcernedcanbeobtainedina", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 133, + "text": "pieceofpaperforcomparisonwithoriginalsignature.Itshouldbeensuredthatthechildrenabove5\nyearsandbelow12yearsofagearetravellingwithproperticketsandadultsarenottravellingwith\nchildtickets.Allthechecksandverificationsmustbedoneasquicklyaspossiblebeforepassenger\nleavesthegateandanychargesduetotheRailwayiscollectedandaccountedproperly.\nNote:-AsperRailwayBoardcircularno.42of2006“ticketcollectorsatexitgatesmayhandoverthe\nticketsbacktothepassengersafterpropernippingifdemandedforthepurposeof\nLTC/reimbursementoftravellingexpensesfromtheiremployers.”\nAftercollectingthetickets,thecollectedcardticketshouldbecancelledimmediatelywith“M”type\nnipper.Thepaperticketsshouldbecancelledbywritingtheword“CANCELLED”ininkwithdateand\ntrainofcollectionacrossthetickets.Allthecollectedticketsaftercancellationwillbesortedstation\nwise,classwiseandnumberwise.Thehighestprogressivenumbercollectedfromeachstationwillbe\nenteredinaregistercalled“TICKETCOLLECTEDREGISTER”.Thisismaintainedatallstationsfor\nenteringtheticketscollectedbyallthetrains.\n1513.TicketcollectedRegister:\n1.Fromstation\n2.Class\n3.Commencingnumber\n4.Highestnumbercollectedbyeachtrain\n5.totalnumberofticketcollected\n6.printednumberofmissingtickets\n7.Totalmissingtickets\nThestationnamesintheregisterwillbewritteninadvancebythestationstaff,Thehighest\nprogressivenumbercollectedfromeachstationwillberecordedagainsttheendofeachday,atotal\nwillbepreparedfortheticketcollectedandmissingforeachstation.Fromthisagrandtotalwillbe\npreparedatarriveofthetotalnumbersofticketscollectedandtotalnumberofmissingticketsfor\neachday.\nTicketscollectedduetootherstationswillbeenteredseparatelyunderthecolumn“Irregulartickets”.\nAllpapertickets,checksoldiertickets,withEFTswillbeenteredseparately.Thecommencingnumber\nforeachstationfornextdatewillbearrivedbyaddingonetothelastprogressivenumbercollected.\n1514.T.C.ReturnforCollectedTickets-\nWithregardtodailycollectedtickets,areturnshouldbepreparedbeeverystationforsubmissionto\naccountofficedailyalongwithcollectedtickets.AttheendofeachdayanextractoftheTCregister\nwillbeprepared,showingthetotalnumberofticketscollectedandmissingfromeachstationwith\ngrandtotal,irregularticketsandpaperticketswillbeenteredseparately.thecommencingnumberof\nthedayandclosingnumber(Highestprogressivenumbercollected)willalsobeshownforeach", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 134, + "text": "station.WhentheTCregisterismaintainedundercarbonprocess,acopyforthesameshouldbesent\nasTCreturns.\nThehighestprogressivenumbernumberscollectedfromeachstationwillbebundled\nseparately.\nAllothercollectedticketswillbebundledseparatelysuchascardtickets,paperticketsand\nirregulartickets.AllbundlesalongwiththeTCreturnswillbeputintheticketcanvaswrapperand\ndepositedinAuditcanvassbagspeciallysuppliedforthispurpose.Thebagwillbesealedand\ndispatchedtoaccountofficedailybynotifiedtrainsonthedayfollowingthedayofcollection.\n1515.SubmissionofjourneyformscollectedfromMemberofParliament-\na)ForthepurposeofmaintainingaccountofthejourneyperformedbyMemberofParliament\n(LokSabhaorRajyaSabha),themembersarerequiredtofillupaformshowninappendix‘k’\nandhanditoverdulysignedtotheticketcheckingstaffontheterminationoftheirjourneyat\nthedetrainingstation.Ticketcollectorshouldpolitelyinsistofthisformbeinghandedover.\nb)ToavoidanyinconveniencetotheMembersofParliament,whomaynothavetheseforms\nreadilyavailablewiththemthestationwillindentandstockalternativejourneyforms.These\nformswillbein3counterfoils,machinenumberedandboundinbooks.Thestationstaffshould\nfillintheparticularsintheformandobtaintheMemberofParliament`ssignatures.The\nMember`sfileshouldbehandedovertoMPs,theaccountfoilshouldbesenttotrafficaccount\nofficeandtherecordfoilretainedatthestation.Whereprintedformsarenotreadilyavailable\nthestaffshouldpreparetheforminmanuscriptandobtaintheMPssignature.\nTheparticularsofthejourneyformscollectedshouldbeenteredinaseparatemanuscript\nregisterwhichshouldbepostedinduplicatebycarbonprocess.Thesejourneyformsshouldbe\nsentdailytothetrafficaccountsofficedulylistedinacoveringmemo.Attheendofthemonth\nonecopyofthemanuscriptregistershouldbehandedtothetrafficaccountsofficeandother\ncopyretainedasstationrecord.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 135, + "text": "Chapter-16\nEarningsofTTE/TCandJointAccountsandCommercialProcedure\nforPromptAccountalofEFTsandRemittanceofCash(T.C.\nReturns)\n1601.EarningsofTicketCheckingStaff-\n1.Thecashcollectedbyticketcheckingstaffwillbedepositedbytheminthebookingofficeafter\nthedepartureofeachtrain.Where,howeverduetofrequenttrainservice,thedepositofcash\nimmediatelyafterthedepartureofeachtrainmaynotbefeasible,theDCMmayprescribeany\notherintervalatwhichtheticketcollectorstaffwilldeposittheirearningsinthebookingoffice.\n2.Thetravellingticketexaminerwilldeposittheirearningsattheendofthedaywiththestation\nmasterorthebookingclerkonanystationoftheirrespectivebeatsforremittancetothecash\noffice.IncasehoweveratthecloseofthedayTTEiftravellingbyatrain,scheduledtoarriveat\nhisdestinationintheearlyhoursofthefollowingday,hemaydepositthepreviousday’s\ncollectionsimmediatelyafterthearrivalatthedestinationstation.\n3.Thestationstaffreceivingcashfromtheticketcheckingstaffshouldagiveamoneyreceipt.\nThemoneyreceipt’saccountfoilormoneyreceipt(UTS)shouldbesenttothetrafficaccount\nofficealongwiththeconnectedEFTsinformComR-19Rev.\n4.Inadditiontotheissueofthemoneyreceipt,thestationstaffwhiletakingovercashfromthe\nTTE/TCshouldendorseontherecordfoilsoflastEFTissuedanacknowledgementofthe\namountreceived,quotingthenumberanddateofthemoneyreceiptandaffixingthestation\nstampthereon.\n1602.ActionbyTicketCheckingStaff-\n1.HewilldrawblankEFTbooksonlyfromthenominatedCTI.\n2.HewillatthetimeofdrawinganEFTbook,checkthenumberingofthebookandcertifythe\ncorrectnessthereofonthecoverofbook.\n3.HewillnotkeepmorethanoneforeignandonelocalEFTbookatatime.Hemay,however\ndrawathirdbookonlyif5orlessblankfoilsareleftinthepreviousbook.\n4.HewillprepareEFTslegibleusingdoublesidedcarbonandwillnotoverwriteorerasefigures\nentered.\n5.HewillremitthecashonlyathisnominatedHQsexceptionAccordingtoRailwayboardcircular\nno.53of2012“TTEshalldeposittheamountrealizedfromEFTduringtheiroutwardjourney\nfromHQataUTScounteratstationwhereheends/breakoutwardjourney.”\n6.Hewillobtainmoneyreceiptfromthebookingofficeandwillalsoobtainanendorsementon", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 136, + "text": "backoftherecordfoiloflastEFTissued,showingtheamountdeposited,Moneyreceipt\nnumberonlastrecordfoiltowhichremittancepertains.\n7.heshouldprepareastatementinFormCom/T.28.Rev.summarizingthetotalno.ofcasesdealt\nwithduringthemonthundervariousgroupsdetailedintheform.Thestationmaster/manger\norCTIinchargeshouldpersonallychecktheanalysistoensurethatithavebeencorrectly\nprepared.Aftercheck,thestatementwillbesubmittedtotheDCM.\n8.Hewillsubmithismonthlyreturnsintriplicate,latestby5thofthefollowingmonthtotheCTI\ncomprisingofthefollowingstatements:\ni.AccountsfoilsoftheEFTs.\nii.Moneyreceipt.\niii.SummaryofEFTsi.e.Returns.\niv.Summaryofmoneyreceipts.\nHewillincaseoflossofanEFTbook,lodgeareportwiththenearestGRPsimultaneously\nreportingittoCTIquotingGRPcaseno.\n1603.Actionbybookingclerk-\n1.Hewillmaintainalistofticketcheckingstaffwhodepositedcashathisstation.\n2.HewillendorseonthebackoftherecordfoilofthelastEFTissuedpertainingtothe\nremittanceshowingtheamountcollected,Moneyreceiptshowingtheamountcollected,\nMoneyReceiptnumberandputclearandlegiblestationstampwithhissignatureinfullwith\ndate.\n1604.RecordtobekeptbyCTI-\n1.HewillkeepproperaccountalofblankEFTbooksreceivedandkeeptheminsafecustody.\n2.HewillmaintainTTE/TCwiseregistershowingserialno.ofEFTbooksissuedandreceivedback\nwithdatesthereof.\n3.HewillkeepEFTbooksreturnedbytheTTE/TCfor3yearsseriallyarrangedundersafecustody.\n4.IfanydebitisoutstandingagainstTTE/TCconcerninganyEFTbook,theparticularEFTbook\nshallbekeptundersafecustodybeyond3yearstillthedebitiscleared.\n1605.CheckstobeexercisedbyCTI-\n1.Hewillissuemaximumofoneforeignandonelocalbookatatimetoaticketcheckingstaff\nandwillnotissueathirdbookunlessthepreviousoneisreturned.However,athirdbookmay\nbeissuedonlyif5orlessblankfoilsareleftinthepreviousbook.\n2.HewillchecktheTTE/TCreturnscontainallfouritemslistedat(i)to(iv)inpara8abovehave\nbeensubmittedbytheTTE/TCfailingtowhichhenotissueafreshEFTbookandwillnotcertify\nTTE/TCsTAbillforthemonth.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 137, + "text": "3.Hewillcomparethetotalamountshowninthesummaryofthemoneyreceiptwiththetotal\nshowninsummaryoftheEFTsandincaseofdiscrepancywillgetitreconciledbefore\nforwardingreturnstoDRMoffice.\n4.Hewillafterexercisingthechecksasperitem2and3above,forwardtwocopiesofTTE/TCs\nreturnstoDRMofficeandretainthe3rdcopyasrecord.\n5.HewillenquireintoanycaseoflossofEFTbook,reportedbyTTE/TCandsubmithisreportto\nDRMoffice.\n1606.StatementtobesubmittedbyCTI-\n1.Hewillprepareamonthlystatement,inthetriplicateshowingthenameofTTE/TC,EFTbook\nnos.issuedtoandreturnedbyeachandalsodetailsofEFTbooksreceivedfromSPSretaining\nonecopyasrecordandforwardingtwocopiestoDRMoffice.\n2.Hewillprepareamonthlystatement,induplicateshowingthenamesofTTE/TCswhohave\nfailedtosubmitthereturnsbytargetdateretainingonecopyasrecordandforwardingthe\nothertoDRMoffice.\n1607.ActionbyDRMoffice-\n1.ItwillmaintainCTIwiseregistershowingthedatesofreceiptofTTEsmonthlyreturnswiththe\nnamesofTTEswhosereturnshavenotbeenreceived.\n2.ItwillforwardtheTTEsmonthlyreturns,asalsotheTTEwisestatementreceivedfromCTIas\nperpara1,tothetrafficaccountsbranchwhowillobtainacknowledgementandsealofthe\ntrafficaccountsofficeshowingthedateofdelivery.\n3.ItwillinitiateDAR/recoveryproceedingsonreceiptofCTIsreportonlossofanyEFTbookbya\nTTEandarrangetopublishthesameintheGazette.kindlyalsoreadRailwayboardcircularno\n8of2007formoreinformation.\n1608.CheckstobeexercisebyTIAs-\n1.HewillcheckwhethertheTTEs,CTIsandbookingclerkshavetakenactions,mainmaintained\nrecordandrecordsandsubmittedreturnsandstatementsprescribed.\n2.HewillcheckthattheamountshownistherecordsfoilsofEFTswiththeamountshowninthe\nrecordcopyofsummaryofEFTs(EFTR)submittedwithmonthlyreturns.\n3.HewillcheckthattheamountshownistherecordsfoilsofEFTswiththeamountshowninthe\nMoneyreceiptspastedinEFTbooks.\n4.HewillcheckfromCTIsregisterthatthecompletedEFTbookshavebeenreceivedbyCTIand\nkeptundersafecustody.\n1609.Actionbytrafficaccountsoffice-\n1.ItwillcheckthecontinuityoftheserialnumberofEFTsfromtheAccountsfoilsoftheEFTs\nreceivedwithTTEsmonthlyreturns.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 138, + "text": "2.Itwillcheckifthereturnshavebeensubmittedintime.\n3.ItwillchecktheserialnumberoftheEFTbooksshownintheTTEsmonthlyreturnswiththe\ndispatchadviceoftheblankEFTbookreceivedbySPS.Thecheckshouldalsoincludeaccountal\nofcompletesupplyfromSPSbytheCTIandaccountalbyTTEsofbooksshownasissuedbythe\nCTIinthestatementfurnishedbyCTI.\n4.ITwillcheckthetotalsoftheamountcollectedagainsteachEFTbookwithtotalsofaccounts\nremittedundertheMonetReceipts.\n5.ItwillcheckTTEwiseremittanceinamonthshownintheTTEsmonthlyreturnswiththe\namountshowninthestationbalancesheet.\n6.ItwillchecktheEFTsforselecteddaysforthecorrectnessintheroute,numberofpassengers\nandfareshowntherein.\n7.ItwillraisedebitagainsttheuncountedEFTsat2ndclassfarerateforthefartheststationon\ntherailwayincaseoflocalEFTsandfarthestjunctionofanyRailwayincaseofforeignEFTs.\n8.Itwillexercisechecksasprovidedinparagraph2150to2158oftrafficaccountscode\nparagraph2.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 139, + "text": "Chapter-17\nMiscellaneous\n1701.TTEsroughjournal-\n1.EachConductor/Travellingticketexaminerwillmaintainaroughjournalbook(Diary)showing\nthenumberofcoacheschecked,irregularitiesdetectedetc.andsleepercoachesTTEswillalso\nmaintainpositionoftheircoaches.\n2.AnincomingTTEmustnotleavethetrainunlesshehasdisposedofcasesdetectedbyhimor\nmadeoverthecasestostationstaffortooutgoingTTEforrecoveryofchargesdue.Incases\nwherenooutgoingTTEhasbeenbookedtoworkthetrain,bywhichincomingTTEhadarrived,\nhewilladvisetheparticularsofthesecasestothetrainsuperintendentortheGuardasthe\ncasemaybe,whowillberesponsibleforensuringthatthechargesduearerecoveredat\nstationsahead.\n3.Caseswhichcannotbedealtwith,shouldbebroughttothenoticeofoutgoingTTEinwriting\nandsignaturetotheeffecttakenonthecombinedmovementdiaryanddetailedstatementof\nearnings.ThematteralsoshouldbereportedinwritingtotheChiefticketinspector/HDTC/\nStationMaster/Manger/Sr.TCathisHQstationwhowillascertainhowthecasehavebeen\ndisposedoff.ThisworktobedonebysquadinchargeorinhisabsencebytheSr.TTEwhere\nmorethanoneTTEsareworkingthetrain.\n1702.TTEsEquipment-\n1.EachTTEwillbesuppliedwiththefollowingarticleswhichshouldbecarriedwithhimwhen\nworkingintrains,CTI/HDTC/StationSuperintendentshouldcheckTTEs/Conductors/Coach\nattendantareinsufficientsupplyofequipmentatleastoveramonthandreportallshortage\nwithexplanationofstaffconcerned;\na.Excessfareticketbooks(Local&Foreign)\nb.Handingovermemo(journalCOM/P.20Rev)book\nc.Tableofdistanceandfares.\nd.Timetableandguide\ne.Roughjournalguide.\nf.ticketpunchnipper\ng.Manualforticketcheckingstaff\nh.Springbalancewhenevermadeavailable", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 140, + "text": "i.Identificationnumber,badges,scroll\nj.Dutycardpass\nk.Dailytripreportforms\nl.pen,pencil(Red&Blue)doublesidedcarbonpapers\nm.Wirebook(Messagebook)\nn.Chartpaper\no.Checkingauthoritycard\np.Coupons\nq.Logbook\nr.FIRforms\ns.complaintbook\nt.GuardCertificatebook\n1703.Coachattendant’sEquipment-\na.jerrycan(duringsummerseason)\nb.Duster\nc.Messagebook\n1704.GuardCertificate(G.C.)-\nCertificateofpermissiontotravel(com164B)isissuedaspersection55/2ofI.R.A.Thecertificate\ncanbeissuedby:\n1.GuardsofallpassengertrainsexceptBBSubsectionandcertainbranchlines.\n2.Upperclassconductors.\n3.BatchinchargeHDTCsofcertainnominatedstation.\n4.Thecertificateisseriallynumbered.Eachcertificatehas3foils.1)Passenger2)Accounts3)\nRecord.Certificatecanbeissued/permissiontotravelcanbegrantedinthefollowingcases,\nprovidedthatpassengerhassoughtpermissionbeforeincurringthecharges.\ni)Ifapassengerunabletopurchasethejourneyticketbuthaspurchasedaplatformticket\nandinformstheconductor/Guardofthetrainbeforetravelling.Incasepassengerintends\ntotravelfromastationwhereplatformticketsarenotissuedtheninsuchcasespermission\nbeforetravellingobtainedfromConductor/Guardofthetrain.\nii)Lowerclassticketholderdesirestotravelinhigherclass.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 141, + "text": "iii)OrdinaryticketholderdesirestotravelbyM/Etrain.\niv)Passengerdesirestotravelbeyondthestationforwhichheisoriginated/booked.\nv)Upperclassticketholderiscompelledtotravelinlowerclassforwantofroomintheclass\nforwhichheholdstheticket.\nvi)Un-exchangedmilitarywarrants.\nvii)Un-exchangedmilitarycertificates.\nviii)Un-exchangedmilitaryconcessions,IAFT1720,1728,1736.\nGuardcertificatewillbepreparedwiththehelpofcarbon,passengerfoilalongwiththe\npassengerwillbehandedovertotheTCstaffatastationwherethereistimetodoso.\nPassengerfoilshouldnotbehandedovertothepassengerexceptionitemno.(5)\nmentionedabove,inallotheritemsstaffpreparingtheEFRwillretainthepassengerfoilof\nGC,whichwillbesentalongwithEFRreturns.\nItwillbepersonalresponsibilityoftheconductor/GuardtoensurethattheExcessfarehasbeen\ncollectedandhemustnotedown,EFTnumberonallthe3foilsofGC.\n2ndfoilofGCwillbesenttotheaccountofficealongwiththemonthlystatementofGuardcertificate.\nNote-certificatecanalsobeissuedforbookingofluggagefromhaltstations.\n1705.1IssuingGC/EFRincaselesspassengerstravellingoncombinedticket-\nTheCOR/TTEmanningthecoachshouldissuetheGC/FreeEFRtothepassengertravelling\naboutthepersonsnottravellingexceptincaseofE-ticketinwhichEDRshouldbefedfornot\ntravellingpassenger.TheCOR/TTEwillissueGC/FreeEFRimmediatelyafterthecheckingthetickets\nandmakenecessaryendorsementinthechart.\nOriginalticketshouldbecollectedandsenttoCCM,partywillbeadvisedtoapplyandClaim\nrefundfromCCMoftheticketissuingrailwayenclosingGC/FreeEF.\n1706.Extensionofjourneyticket-\nExtensionofjourneyticketisgrantedbeyondthestationforwhichpassengernotifieshis\nintentionofextendinghisticket,benefitoftelescopicfareswillnotbegrantedi.e.Fareforthe\nextendedportionofjourneywillbecollected.\nNote-\n1.Extensionisgrantedonlyonce.\n2.Noextensionshouldbegrantedonticketsbookedagainstenroutestationquotaorenroute\nreservationunlessaccommodationisavailableforextendedjourneyinthecoach.\n3.Extensionshouldnotbegrantedfromaenroutestationi.e.ifapassengerholdaticketfrom\nHowrahtoCSTM,extensioncan’tbegrantedenrouteforChalisgaontoDhule.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 142, + "text": "4.Whileextendingtheticketensurethatticketisnotconvertedintoacircularjourneyticket,\nwhilegrantingextension/differenceofrouteensurethatthepassengerstartingstation\nreviseddestination/revisedrouteiswithinthenormalandreasonabledirectroute.For\ndefinitionofnormalandreasonabledirectrouterefercircularjourneyticket.Forexample-a\npassengerholdingticketforALDtoBSL(916km)desirestogethisticketfromBSLtoNGP(393\nkm).Inthiscaseitisclear;thepassengerdesirestotravelexALDtoNGPviaBSL,ifpassenger\ndemandsaticketatALDbookingofficefromALDtoNGPviaBSLsuchwillnotbeissued\nbecauseALDtoNGPviaBSLisitisnotanormalandreasonablydirectroute.AssuchAKD-BSL\nticketholdercan`tbegrantedextensionfromBSLtoNGP.\n1707.Handingovermemo-\nPassengerdetectedtravelingwithoutticketoranyotherirregulartravelbytravellingticket\ncheckingstaffthatdeclinetopaythechargesdue,shouldbehandedovertothestationstafffor\nrecoveryoftheamountduewithaHOM.Theseformsaremachinenumberedprintedandconsistof4\nfoils1)record2)Accounts3)Stationstaff4)DCM.\nWhilehandlingoverthepassengersignatureofthestationstaffshouldbeobtainedonthe\nrecord\nportion.\nAtstationwherenoTCsarepostedpassengershouldbehandedovertothemandatother\nstationtotheSM.Ifneitherofthemisathand,passengershouldbehandedovertothebookingclerk.\nIncasepassengerispreparedtopaychargesdue,amountshouldbecollectedunderEFR\notherwisenecessaryactionundertherelevantsectionofIRAshouldbetaken.\n1708.AcceptanceofRailmoneyvaluecouponsfromMLAs/andMLCs-\nTheCOR/TTEinrunningtrainwillacceptcashand/orcouponstowardsthechargesduein\nrespectofreservationfee,supplementarycharges,differencetothehigherclassandwhenticketsare\nextendedenroute.\nAbovechargescanbecollectedthroughcouponswhenMLA/MLC,theirspouses/childrenand\nattendantsaretravellingonticketsissuedinexchangedofcoupons.COR/TTEshouldpassremarkon\nEFT“issuedinexchangeofrailtravelmoneyvaluecoupon”.SuchEFTshouldbeaccountedforinthe\nEFTreturnswithoutshowingthemoneyvaluerecoveredthroughcouponsintheamountcolumn,\ngivingfullparticularsofthecoupons,togetherwiththeirfacevalueintheremarkscolumn.The\ncouponscollectedshouldbesenttoTrafficaccountofficealongwiththereturns.\nMLAs/MLCs,theirspouses/childrenandattendantsaretravellingonun-exchangedcoupons\nwillbechargedwithoutticket,farewithexcesschargerecoveredincashuptothepointofdetection\nandsinglejourneyfareincashforonwardjourney.\n1709.Attendantinsolechargeofchildrenbelow12years-\nAttendantsinsolechargeofchildrenbelow12yearsareallowedtotravelinthesame", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 143, + "text": "compartmentasthatofthechildren,onpaymentof1stclassfarewhentravellinginAC1stclassand\n60%ofthe1stclassfarewhiletravelingin1stclass.Onlyoneattendantisallowedtotravelinthe\nsamecompartmentwitheachpartyatthereducedfare.Theattendantmustnotoccupyaberthtothe\nexclusionforapassengerwhohaspaidfare.Anattendantsinsolechargeofchildrenof5yearsofage\nandunderwillnotbeallowedtheconcession.\nNote-ThisruleonlyapplieswhenchildtravelsinAC1stor1STclass.\n1710.BreakJourneyRules-\nHoldersofsinglejourneyticketsfordistanceofmorethan500kms.(Actualdistance)areallowedto\nbreakjourneyoncefortwodaysatanystationen-route.Thisfacilitycanbeavailedonlyafter\ntraveling500Kms.fromthestartingstation.Ifticketisformorethan1000Kms,passengerwillbe\nallowtobreakjourneytwice.Thedayofdepartureandarrivalmustbeexcludedwhilecalculatingthe\nnumberofeligibledaysforfirstbreakofjourneyandticketshouldbeendorsedbythestation\nmanager/ticketcollectoratthestationwherethebreakjourneyisintended.\nNote:\n1.ThisfacilityisnotavailabletopassengerstravelingbyRajdhani/Shatabdi/JanShatabdiexpress\ntrains.\n2.Thisfacilityisnotpermittedshortofthestationuptowhichreservationhasbeendone.\n3.Intentiontobreakjourneyistobeadvisedatthetimeoforiginalbookingandnotafterobtaining\nreservation.\nExample:\n1Apassengerwithsinglejourneyticketfor800kms.wantsto\nbreakhisjourneyat423kms. notpermissible\n2Apassengerwithsinglejourneyticketfor600kms.wantsto\nbreakhisjourneyat501kms.\nPermittedoncefor2days\nmaximum\n3Apassengerwithsinglejourneyticketfor1050kms.wants\ntobreakhisjourneyat400kms.and801kms.\nOnlyonebreakjourneyat801\nkms.ispermittedfor2days\nmaximum\n4Apassengerwithsinglejourneyticketfor2000kms.wants\ntobreakjourneyat800kms.,905kms.and1505kms.\nTwobreakjourneyspermitted\nasperchoiceofpassengerat\ntherateoftwodaysmaximum\nateachpointofbreakof\njourney\nNote:\n1.Wheneverathroughpassengerdetrainsatastationen-routeforcatchingaconnectingtrain,it\nshouldnotbetreatedasbreakjourneyprovidedsuchhaltisforlessthan24hours.For\nexample,theholderofadirectticketfromPunetoJammuTawiviaDadartravelsfromPuneto\nBombaybyanydaytrainadayearlierinordertocatchBombay-JammuTawiExpressnext\nmorningleavingBombayat6.25hoursshallnotbetreatedasbreakjourney.\n2.BreakofjourneyisnotpermissibleontheticketsofcertaintrainslikeRajdhaniExpress,\nShatabdiExpress,etc.,whichhaveseparateallinclusivefarestructureonpoint-to-pointbasis,\nandtherefore,refundonsuchpartiallyusedticketsisalsonotadmissible.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 144, + "text": "3.Passengersarerequiredtohavetheirticketsendorsed.Theendorsementshallconsistofthe\nStationCode,StationMaster'sinitialsandthedate.\n4.Passengersbreakingjourneyandnotobtainingtheendorsementasprescribedwillbetreated\naspersonstravelingwithoutaproperticketanddealtwithaccordingly.\n5.Passengersbreakingthejourneyen-routeexceptasprovidedinparagraph(1)abovemust\nsurrendertheirticketsatthestationwherejourneyisbroken.Refundfortheuntraveled\nportiononsuchticketswillbeallowedinspecialcircumstancesonlysubjecttothecondition\nlaiddowninRule213,4andprovidedalsothattheproceduregiveninthatruleisfollowed.\n6.Breakjourneyshallnotbepermittedshortofthestationuptowhichreservationhasbeen\ndone.Ifapassengerseekingreservationonthroughticketsasksforbreakjourneyenrouteit\nshouldbeclearlyindicatedontheRequisitionformthenamesofthestationwherethebreak\njourneyisrequested.Reservationinthiscasewillbedoneuptobreakjourneystationonly.\n1711.RebookingofpassengersatintermediatestationbySM-\n1.Passengerwishingtotravelbyotherthanbookedroute-ExceptasprovidedinRule101(5)of\nIRCAcoachingtariffpart-1(volume2),passengersdesirousofadoptinganalternateroutefrom\nanyjunctionmaytravelbythatroutebypayingthedifference,ifany,betweenthebooked\nrouteanddivertedrouteforthemselves,attendantsandluggage.Ifthefarebytheselected\nrouteisnotinexcessofthatbythebookedroute,thejunctionstationmasterwillcollectthe\noriginalticketortherespectivehalfoftheticket,asthecasemaybeandissueanexcessfare\nticket,makingthefollowingendorsementthereon:\n“permissiongrantedtotheholdertotravelvia…………..”.Insuchcases,noexcessfarewillbe\ncharged.\n2.CircumstanceunderwhichSMsareauthorizedtorevalidatejourneyticketsbyanothertrain-\ni.Passengerdetrainedatstationundertheinstructionofpolice(policecertificatetobe\nproduced).\nii.Detectionofpassengersattackedwithinfectiousdiseases(Medicalofficerscertificateto\nbeproduced).\niii.Passengermissingconnectingtrainatanyjunctionstationduetolaterunningoftrainby\nwhichhehadtravelled.\niv.Returnjourneyreservedticketholdernotprovidedwithreturningjourneyreservation.\nv.Trainrunningmorethan3Hrs.lateandreservedticketholderdesiringtotravelby\nearliertrain.\nvi.Incaseofroadblockadeduetolandslidesorcancellationofairflight(onproductionof\ncivil/transportauthorities/airlines).\n1712.Passengersdetrainedunderinstructionofpolice-\n1.WhenapassengerhastoremainbehindataroadsidestationunderinstructionofRailway", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 145, + "text": "policetoattendaninquiryortogiveevidenceinanycaseconnectedwiththerailwayorforthe\nsamereason,isunabletocommencehisjourneybytrainforwhichticketisissued,thestation\nmasterisauthorizedtomaketheticketavailablebyanothertrain(providednodelayhas\noccurredinbringingthemattertonoticeandthestationmasterissatisfiedwiththe\nexplanationgivenbythepolice.Insuchcasesthestationmastermustwriteonthebackof\nticket“AvailablebyTrainNo.………of………..”.thenthenameofthestationandsignwithhis\nnameinfull.\n2.Wheneveraboveactionistaken,thestationmasterconcernedmustfurnishtothetraffic\naccountofficefulldetailsalongwithoriginalcertificateinthefollowingformfromthepolice\nofficenotbelowtherankofSub-Inspectoronwhichtherequestismadethatapassenger\nshouldbedetrained.\n1713.Diversionofpassengertrafficincaseofinterruptionofthroughcommunication-\n1.Whenowningtointerruptionofthroughcommunicationduetobreachesetc.trafficis\nrestrictedbyanyroute,passengersholdingtickets(singleorreturnjourney)purchasedbefore\ntheintroductionoftherestrictionmaybeallowedtotravelbytheshorterorthequickestopen\nroute,whichevertheypreferwithoutanyextracharge.\n2.If,howeverreturnticketsareissuedtothenotificationofrestrictionthechargeswillbe\nCertificatetobeobtainedbythepassengerdetrainedatstationunder\ninstructionsofthepolice\nRailwayFormNo.__________\nNo.___________\nTo,\nTheStationMaster____________________________certifiedthat\n_______________holderofsingle/return_____________classticketNo.________\ndated__________from______\nto________________(station)wasdetrainedfrom________20..to____________20...\nforthepoliceenquirytogiveevidenceincourtandisnowallowedtoproceed.\n______Station\nDate______ Sub-Inspectorofpolice\nGovernmentRailwaypolice", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 146, + "text": "collectedbythedivertedroutebothfortheoutwardandreturnjourneys.Ifthereturnticketis\nperformedbythenormalroute,refundwillbegrantedfordifferenceinfaresbetweenthe\ndivertedrouteandnormalroute.\n3.a.Whenpassengersareunabletocontinuetheirjourneyduetointerruptionofthrough\ncommunicationsasaresultofflood,breachesetc.thepassengersdesiringtoreturntotheir\noriginatingstationsmaybepermittedtodosofreeofchargeprovidedthatthejourneyismade\nbytheshorterorquickestroute,nobreakjourneyisallowed.Theauthorityforreturnjourney\nwillbeafreeexcessfareticketissuedbythestationmasterinexchangedfortheoriginalticket.\nInsuchcasesnorefundwillbeallowedunderrule213.14ofIRCACoachingTariffpart-1\n(volume-1).Theoriginalticketaftercollectionshouldbecancelledandsenttoaccountsoffice\nasinthecaseofnonissueticketasauthorityforfreeaccountaloftheconnectedexcessfare\nticketintheExcessfarereturn.\n4.SubjecttotheprovisionofRule223(1)and(2)ofIRCACoachingTariffpart-1(volume-1)when\npassengerholdingreturnjourneyticketsareunabletocontinuetheirjourneydueto\ninterruptionofthroughcommunicationsasaresultofflood,breachesoranyunforeseen\noccurrence,Passengerdesiringtoreturntotheiroriginalstationwithanintentionnotto\nperformboththeoutwardandreturnjourneymaybepermittedtodosoprovidedfreeof\nchargeprovidedthatthejourneyismadebythequickestorshortestroute,nobreakjourney\nbeingallowed.Theauthorityforreturnjourneywillbefreeexcessfareticketissuedbystation\nmasterofdispersalstationinexchangefortheoriginalticket,showingthenumberofreturn\ntickets,class,station,fromandtoandthefarecollectedwithanendorsement“Passengernot\nwillingtocontinuetheiroutwardjourneyanddesiringtoreturnto……………….Originating\nstation,permittedtodoso.FaresofRs………forreturnjourneyex……toonlytoberefund.”\nExcessfarereceipt(passengerfoil)willberetainedbythepassengertoclaimrefund.Insuch\ncases,norefundwillbeallowedunderrule213.14fortheoutwardjourneyonly.Original\nticketsaftercollectionshouldbecancelledandsenttoaccountofficeasincaseofnon-issued\nticketsasauthorityfortheaccountalofconnectedexcessfareticketsintheExcessFareReturn.\nHoweverwhereoutwardjourneyiscoveredis5%orlessthanthetotaldistanceandfurther\noutwardjourneyisnotpossibleduetointerruptionofthroughtravelasaresultofunforeseen\noccurrence.Theclaimfortherefundcanbeconsideredandwhilegrantingtherefundthefare\n(outward)uptothepointoftravelandthefareforreturntotheoriginatingpointshouldbe\ndeducted.\n1714.Ticketstampedindistinctly-\nWhenatickethasbeenindistinctlystamped,thewordillegibleshouldbewrittenbeneaththedate\nandtheticketcancelledandtreatedasnon-issuedticket.Undernocircumstanceshouldadateonce\nstampedontheticketbetamperedwithnorshouldaticket.Ticketsbearingdoubleimpressionof\ndatesshouldbeviewedwithsuspicionbytheticketcheckingstaff.Innecessary,theticketshouldbe\ncollectedandafreeticketfareticketissuedinlieuthereofanddetailedreportalongwiththeticket\nsubmittedtotheDivisionalCommercialManagerendorsingacopythereoftotheTrafficAccounts\noffice.\n1715.Righttocorrectcharges/Re-weighing-", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 147, + "text": "Railwayreservetherightofre-measurement,re-weighing,reclassificationandrecalculationat\ndestinationandofrecoveringanyunderchargesarisingtherefrom.\nTheweightofarticlesasgivenintheRailwayReceiptorluggageticketismerelyinsertedforthe\npurposeofestimatingtherailwaychargesandrailwayreservetherightofreweightandre-\nmeasurementatdestination.NoadmissionisconveyedbyaRailwayReceiptthattheweightasshown\nthereinhasbeenreceived.\n1716.PassengerscrossingRailwaylines-\nAtstationwherethereisnooverbridgeorsubwaysareprovidedpassengersmustuseendsofthe\nplatformformovingfromoneplatformtoanother.Innocircumstancesshouldpassengersbe\npermittedtocrossrailwaylineswithoutadequateprecautionsbeingtakenfortheirsafety.\n1717.IssuingCertificatetoAttendanton1stclasspass-\nAsperrule2(b)oftheRailwayServantPassRule1986theterm“attendant”meansaperson\nexclusivelyemployedinthepersonalserviceofaRailwayservant.AsperRly.Board’sLetterNo.E(W)\n97PSof%-D/4dated-14/1/91inordertoobviatethehardshipfacedbyattendantsduringthetravel,\nthe1stclasspassholderwhoiscarryingtheattendantinthe2ndclassmayissueanauthoritytothe\nattendantindicatingthenameoftheattendant,1stclasspassno.onwhichtheattendantistravelling,\ncoachandseatno.anddestinationofthepassholder,sothatcanbeshowntotheTTEsondemand\nwhomaytakenoteoftheseparticularsforhisintentionandcheckasnecessary.\nAttendantsofholdersof1stclasspass(Duty,Privilege,andComplimentary)and1stclassticket\nexchangedforPTOareallowedtotravelinsleeperclasscoaches.\n1718.Responsibilityforensuringthattariffs,etc.arecorrectlypostedandassimilated-\nThestationmasterandthesupervisorinchargeofthebookingluggage,parcelsandgoodsofficesare\npersonallyresponsibletoseethatthecopiesofthetariffsinusearekeptup-to-datebythestaffand\nthatthecopiesofthetariffinuseareup-to-datebythestaffandthatallordersandinstructions\nnotifiedfromtimetotimeareunderstoodandcorrectlycarriedoutbythestaffunderthem.A\ncertificatetothiseffectshouldberecordedinaseparateregistertobekeptespeciallyforthis\npurposeinwhichthenameanddesignationofthepersonwhosetariffs,booksandmanualshavebeen\nexaminedshouldalsobeentered.Thesecertificatesshouldbecheckedbyofficersandinspectorsof\ntraffic/commercialandaccountsduringtheirinspectionandasuitablenoterecordedinthe\ninspectionbookandintheinspectionreport.\n1719.AmenitiestoPassengers-\n1.General:\ni.Waitinghalls\nii.Waitingroomsforupperclasspassengers\niii.Retiringrooms\niv.LavatoriesandUrinals.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 148, + "text": "v.Bathingcubicles\nvi.Drinkingwater/Watercooler(Seasonalsupplyduringsummer)\nvii.Facilitiesforqueuingbeforecounter\nviii.Provisionofsheettimetablenearcounters\nix.Exhibitionoffarestoimportantstationsnearcounters.\nx.Fansinwaitinghall\nxi.Auxiliarystallsforsellingfruits,softdrinks\nxii.Cateringfacilities,vegetarianandnon-vegetarian\nxiii.Platformvendingoffruits,eatablesandbeverages\nxiv.Freetrolleyservice\nxv.Invalidchairsandstretchers\nxvi.Overbridgesandsubways\nxvii.Bookstalls\nxviii.Medicalstalls\nxix.Coveredaccommodationinplatforms\nxx.Provisionofseatingarrangementsandshadytrees\nxxi.Bedroll/Travelbags\nxxii.Clockroom\nxxiii.Safedepositlocker\nxxiv.Publicaddresssystem\nxxv.Provisionofclocksonplatform\nxxvi.Computerizedreservationsystem\nxxvii.Sleeperfacilitieswithcushionfor2ndclasspassengers\nxxviii.IndrailpassticketsforForeigners\nxxix.Appointmentoftravelagent\nxxx.CBO/CBA\nxxxi.Outagency\nxxxii.Superfast/Intercitytrains", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 149, + "text": "xxxiii.FullyAirconditionedtrains\nxxxiv.SeparatecompartmentsforLadies,DisabledandMarketVendors\nxxxv.Vestibulecoaches\nxxxvi.Ladiesspecialtrains\n2.Facilitiestoladies:\ni.Aspersection58ofIRAcompartmentorcertainberthsorcertainseats\nwillbeearmarkedineverypassengercarryingtrainforexclusiveuseof\nfemales.\nii.Awomanorchildifunaccompaniedbymaleisrefusingtopaythefareand\nexcesschargedueundersection138ofIRA,thentheycanbedetrained\nonlyatthestationfromwheretheycommencedtheirjourneyorata\njunctionorataterminalstationoratastationatcivildistrictHQandsuch\nremovalshouldbemadeonlyduringthedaybetween6AM&6PM.\niii.CheckingofladiescompartmentswillbeordinarilydonebyfemaleTC/TTE,\nMaleTC/TTEmustnotenterladiescompartmentbutmaycheckthetickets\nfromplatformonly.\niv.Whenafemalepassengerisfoundtravellingwithoutaticket,\nunaccompaniedbyanyfriendsorrelativesorhasnomeanstopaythedue\ncharges,sheshouldbedealtwithpara(2)above.\nFurtheratastation,ifshecannotprovideanyreliableaddress,theSM\nmustseetheeverypossibleprotectionisprovidedtoheronRailway\npremises.Sheshouldbetreatedconsiderably,pendinginstructionsfrom\nDCMorPolice,AtstationwherethereisanAyahorladywaitingroom\nattendantsheshouldbeplacedundertheirprotection.\nv.AtstationswhereladyTCsareposteditistheirdutyofspeciallyinterest\nthemselvesinaccommodatingtheladypassengers.Atstationwherelady\nTCsarenotposted,thestaffiswarnedthatladypassengersarenottobe\ninterferedwithmorethanisconsistentwiththeirduty.\nMaleTTEsarestrictlyforbiddentoentercarriagesorcompartments\nreservedforladiesonanypretextwhatsoever.\nvi.Ifaladytravellingaloneorwithchildrenbelow12yearsofagein1stclass\ncompartmentreservedforladiesthenshecantakeonefemaleattendant\nholding2ndclassticketinthesamecompartmentbetween8PMand6AM.\nTheattendantmustleavethecompartmentwhenmorethan2lady\npassengertravellinginthesamecompartment.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 150, + "text": "1720.EnquirySystem-\nEnquiryofficehavebeenprovidedatmanystations,dealingwithlargenumberofpassengers\nwhereenquiriesregardingrunningoftrains,arrival,departuretiming,trainconnectionandother\nmattersrelatingtorailtravelcanbemade.Atsmallstationsenquiriesareansweredbythe\nASM/BC/TC.Runningoftrainsupdatedineveryhalfofhourandenquiryclerkisabletofurnish\ncorrectandaccurateinformationonrunningoftrains.Withtheprovisionofcentralizedtelephone\nenquiryfacetofaceenquiryofficeatcertainstationshavebeenrelievedoftheworkofattendingto\ntelephoneenquiries.\n1721.Publicaddresssystem-\nImportantstationsareprovidedwithpublicaddresssystem.Eachplatformshallbeprovided\nwithenoughnumberofloudspeakers.Announcementaremaderegardingthelaterunningoftrains,\nNonattachmentofcoaches,alternatearrangementforreservedpassengers,positionofcoaches,\nguidanceregardingtheavailabilityofcoolie,freeluggagetrolleys(whereveravailable),warning\npassengeragainsttrespassing,footboardtravelling,rooftravelling,,standingneartheedgeof\nplatform,entrustingluggagetounauthorizedcollies/persons,transferofreservedtickets,carryingun\n-bookedluggage,andpossessionofexplosivesetc.\n1722.Platformporters(coolies)atimportantstations-\nLicensedporteratimportantstationsattendsallmailandpassengertrainsforcarryingparceland\nluggage.Thesemenarenotrailwayemployees,butlicensedbyrailwayfortheconvenienceof\npassengersandmustpaidthelocalauthorizedcharges.Thesechargesarepostedupinaconspicuous\nplaceatthestationtowhichtheyareapplicable.Anycomplaintagainstlicensedportersshouldbe\nimmediatelymadetothestationmasteronduty,thenumberofbadgewornbyeachmenbeingnoted\nforidentification.\n1723.Waitingrooms-\nWaitingroomsatstationareintendedfortheconvenienceofpassengersonly.Theymustnot\nbeusedas‘DarkBungalows’.Stationmasterhaveinstructiontoopenthem2hoursbeforeatrain\ncarryingpassengersisdueandtoclosethem2hoursafteratraincarryingpassengershasleft,except\nforpersonsdulyauthorizedtooccupythemforlongerperiod.Passengersarrivingbynighttrainsmay\nremaininthewaitingroomuntilmorningandpassengersleavingbynighttrainsmayremaininthem\nuntiltheirtrainleaves.Dogsarenotpermittedinwaitingrooms.\nWaitingroomsorseparatetoiletfacilitiesarenotprovidedatmetroRailwaystationsfor\npassengerswaitingfortrainorforpassengersarrivingbythetrains.\n1724.Safetyandcomfortsofpassengers-\n1.Closingofdoorsbeforetrainstarts:Beforeatrainstartsthecarriagedoorsonplatformsidemust\nbeclosedandoutsidelatcheswhereprovided,fastened.\nLockingofcarriagedoors-\ni.Thedoorsthecarriageontheoffsideshallbeasageneralruletobelockedondouble", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 151, + "text": "line.\nii.Thedoorsofbothsidesofcarriageonatraincarryingpassengersshallneverremain\nlockedatthesametime,exceptincaseofcompartmentreservedforladieswhichmay\nbelockedattherequestoftheoccupants.\n2.Carriagenottobeopenedbeforeatraincomestoastand-Thestationstaffshall,asfaras,\npreventthedoorsofcarriagesbeingopenedbeforetrainhasstoppedattheplatform.\n3.Exerciseofcareinopeningcarriagedoors-\nWhenitfoundnecessarytouseforcetoopenacarriagedoorbecauseithasgotjammedfor\nsomereason,itisthedutyoftheRailwaystafffirsttomakesurethateverypassengersinsidethe\ncarriageisclearedofthedoorasotherwisesuchpassengersarelikelytobeinjuredbythesudden\nopening.\nStationmasterwillberesponsibleforensuringtheseinstructionsareunderstoodandobserved\nbyluggageporters,licensedportersandanyotherstaffwhoseservicesmaybeusedfor\nopeningcarriagedoorsinthecircumstancestaredabove.\n4.Securingofcarriagedoors,frominsideduringthenightforprotectionagainstthieves-\na.Withaviewtopreventthievesfromenteringthecarriagesduringnight,passengers,may\nbeforeretiringforthenights-\ni.Secureeachwindowbyplacingthewiregaugeframeand/orthewoodenvenetianan\npositionandlockingeachwiththesidecatchesprovided,and\nii.Afterclosingthedoorssecureeachmaybemeansofthrowovercatchorboltprovided\nontheinsideofeachdoor.\nb.Whenthedoorssecurefromtheinside,theoccupantsofthecompartmentsdesiringtomust,\nwhenrequiredtodosobyotherpassengerdesiringtoentrain,unlockthecatchtoallowthe\ndoortobeopened.\nc.Stationstaff,TravellingticketexaminersandGuardsshouldensurethattheseinstructionsare\ncompliedwith.\nNote-Ticketcheckingstaffshoulddrawtheattentionofpassengers,particularlyladiestothe\nmeansofprotectionafforded.\n5.Overcrowdingontrains-\nStationmastersatprincipalstationshouldinspecttrainswithaviewtoascertainiftheyare\ncrowdedandincasetheyare,thefactshouldbeimmediatelyreportedtothechiefcontroller\nonduty.\nThechiefcontrollerondutyonreceiptofinformationthatatrainisrunningovercrowd,will\nmakenecessaryarrangementeithertoaugmenttheloadoftrainorfortherunningofspecial\nandduplicatetrainasnecessary.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 152, + "text": "Thenecessaryinformationfurnishedbythestationandactiontakenthereonbythechief\ncontrollerwillberecordedbythelatterinstatementwhichshouldbesubmittedtotheSr.DOM,\nforhisinformation.\n6.Overcrowdingofcompartment-\nWhenacompartmentisovercrowded(thatisoccupiedgreatlyinexcessofthemarked\nseatingcapacity)andanoccupantofsuchovercrowdedcompartmentpullsthealarmchainto\nstopthetraininordertoprotestagainstsuchcrowding,everyendeavorshouldbemadeto\nremovetheinconveniencecomplainedof.\n1725.Medicalassistancetothepassenger-\na.Invalidchairsorstretchersfortheuseofsickandinjuredpassengersareavailableatlarge\nstationslistedinthetimetableofeachrailway.\nb.Thestaffarenotauthorizedtocallinoutsidemedicalaidexceptincasesofinjuryfroma\nrailwayaccident.Thepoliceandmedicalofficershall,howeverbeadvisedatoncesoastobein\nreadinesstoattendthetraincarryingthepassenger.\nc.Allsickpassengersandpassengerswhohavesustainedinjuriesforwhichtherailwayisnot\nresponsible,andareunabletoproceedtheirjourneyshallbemadeovertothepolicefor\nconveyancetothenearestpublichospitalordispensary.\nd.AtstationwheretherearenopublichospitalsordispensariesbutRailwaymedicalaidis\navailable,thesameshallbearranged.\ne.IncaseswherenorailwaymedicalstaffnorGovernmentRailwaypolicestaffisavailable,the\nstationstaffshallmakeoverpassengertothenearesthospitalordispensary,butatthesame\ntimeshallinformthereofthattheRailwayshallnotbeliableforanyexpensesincurredbythe\npassenger.\nf.Incasesofseriousillness,Whenthepatientisunfittotravel,Stationmasteratstationswhere\nthereisnohospitalshallseethatthepatientissuitablyaccommodateduntilheiswellenough\ntobesenttothehospitalbythePoliceorMedicalofficer.\ng.Exceptincaseofinjuriesreceivedduetoaccidentforwhichtherailwaymayberesponsible,\nthecostofmedicalassistancerenderedtothesickpassengerwillhavetobebornebythe\npassengerhimself.\n1726.CarriageofpassengersSufferingfromInfectiousandContagiousdisorder/diseases-\n1.Railwayadministrationshallnotcarry,exceptinaccordancewithconditionslaiddowninthese\nrulespersonssufferingfromthefollowingdiseases:\na.Cerebro-Spinalmeningitis.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 153, + "text": "b.Chicken-Pox\nc.Cholera\nd.Diphtheria\ne.Leprosy\nf.Measles\ng.AIDS\nh.Scarletfever\ni.Typhusfever\nj.Typhoidfever\nk.Whoopingcough\n2.Nothinginsub-rule(1)shallapplyincaseofclosed(non-infective)leprosypatientscarryinga\ncertificatefromaRegisteredMedicalPractitionercertifyingthemtobenon-infectiveandsuch\nacertificateshallbeproducedondemandinsiderailwaypremisesbyanyrailwayservant.\n3.Apersonsufferingfromanyofsuchdiseases,asmentionedinpara(1)ofthisrule,shallnot\nenterorremaininanycarriageonarailwayortravelinatrainwithoutpermissionofthe\nStationMasterortherailwayemployeeinchargeoftheplacewheresuchpersonsentersupon\ntherailways.Anypersonswhoentersorremaininanycarriageonarailwayortravelinatrain\nwithoutproperpermission,suchapersonandpersonaccompanyinghimshallbeliableto\nforfeitureoftheirpassesorticketandremovalfromrailwaybyanyrailwayservant.\n4.Arailwayservantgivingsuchpermissionmay,onthepersonsufferingfromdisease,agreeing\ntopaytheusualamountoffareforreservingacompartment,arrangeforhisseparationfrom\notherpersonsbeingortravellingupontherailway.\n5.Detentionofpassengerattackedwithanyinfectiousorcontagiousdisease-whenapassenger\nisdetrainedatarailwaystationbyamedicalofficer,asameasureforpreventionofthespread\nofinfectiousorcontagiousdiseasesreferredtoinsub-rule(1)andwhensuchapassengeris\nunabletocontinuetheirjourneybythetrainforwhichticketisissuedandtheperiodofits\navailabilityintermslaiddownforthebreakofjourneyenrouteisexceeded,thestationmaster\nontheauthorityofthemedicalofficer,shallmakeonthebackoftheticketasunder:\n“AvailablebyTrainNo.…………………….Date……………………From…………….(station)”\nandsignhisnameinfull.\n6.Passengerssufferingfrominfectiousorcontagiousdiseasesdetectedtravellingintrain-\na.Allpassengerssufferingfrominfectiousorcontagiousdiseasesshouldbeprevented\ntravellingbythetrain,butwherethediseasedetectedduringthejourney,passenger\nwithhisrelativeorfriends,ifany,shallbeisolatedinthecompartmentofthecarriagein", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 154, + "text": "whichheistravellingandiftheyarewillingtoattendonhim,willbeallowedtotravelin\nthesamecompartmenttotheneareststationwherethereisaMedicalofficer.Ifthereis\nroominthetrain,allotherpassengerwhowereinsamecompartmentasofthepatient,\nshallberemovedtoanothercompartment,whichshallbeemptiedforthepurposeand\nthepassengerwhooriginallyoccupiedit,accommodatedelsewhereinthetrain.Itwill\nbedutyoftheGuardofthetraintosendtheadvanceintimationtothemedicalofficerof\ntheneareststationsothatthepassengermayreceivethemedicalaidimmediatelyon\nthearrivalofthetrain.AreportshouldbesenttothepoliceauthoritiesandtheDCM\nconcerned.\nb.Ifapassengeroranintendingpassengerisfoundtobesufferingfromcholera,in\nadditiontotheusualtreatment,thestationmasterwillberesponsibleforadvisingthe\nDistrictMedicalofficer,thenearestRailwaypoliceofficialandDistrictMagistratebyan\nurgenttelegram.\n1727.Proceduretobeadoptedincaseofsickanddeceasedpassenger-\nWhenapassengeralightsfromatrainduetosickness,orheistakenoutofthetraindead,orina\ndyingstate,thefollowingruletobeobservedindisposingofhisluggageandpersonaleffects:\n1.IFthepassengeriscompetenttomanagehisownaffairsheshallbeaskedwhetherhis\nvaluable,ormoney,tobetakencareof,andifso,aninventoryshallbepreparedinhispresence,\nareceiptindetailshallbegiventohim,Thevaluableslockedupinrailway’scashsafewitha\nlistthereof,andaduplicatecopyoftheinventoryshallbesenttotheDCM.\n2.Incasethepassengeristooilltodecide,allvaluablesorarticlesnotrequiredbyhimfor\nimmediateuse,shalltakencareofandaninventoryshallbemadeoutinduplicate,onecopy\nretainedatthestationandtheothersenttotheDCM.\n3.Incaseofdeath,allarticlesbelongingtothedeceasedshallbetakenchargeof,and\ninventoriespreparedinduplicateonebeingretainedatthestationandtheothersentatoneto\ntheSr.DCM.\n4.IfnoPoliceofficerispresenttotakethechargeofthepropertyreferredtotheproceeding\nparagraphs,thestationmastershallcarryouttheseordersminutelyandcarefully,andarrange\nforinventoriestobeverified,byatleastoneperson.\n5.Ifapoliceofficerispresent,thestationmastershallnotberesponsiblefortakinganyaction\nwhatsoever,unlesspoliceofficerrequesthimtodoso.\n6.Shouldthepoliceofficerbepresentbeofalowergradethanasubinspector,thestation\nmastershallinallcasesoffertomaketheinventoryinconjunctionwithhim.\n7.Incaseunderclause(1),above,ifforanyreasontheownerofthepropertyisunabletotake\nchargeofthepropertythesameshouldbehandedovertothepoliceondemand.Underclause\n(2),(3)and(4)thepropertyshallbehandedovertothepolice,stationmastershallnottakethe\nchargeofthepropertyunlessatthewrittenrequestofthepolice.\n1728.Proceduretobeadoptedincasesofmurderorseriousassaultsinrailwaycarriages-", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 155, + "text": "Ifacrimeofseriousnaturesuchasamurderorseriousassaultbecommittedinarailwaycarriageon\narunningtrain,thefollowingactionshallbetakenbythestaffwithaviewtohelpthepoliceofficials\nintheirinvestigation-\na.TheGuardofthetrainshallhavethecompartmentemptiedandlockedupafterallshuttershave\nbeenraisedfromoutsideimmediatelythecommissionofsuchanoffenceinknownsothatblood\nstains,marksofstrugglefootprints,fingerimpressionmayremainundisturbed.\nb.Ifthecrimetakesplaceinasecondclasscompartmentthecarriageshallbedetachedatthe\nstationwherethecrimeisdetectedandkeptunderwatchtillthepolicearrivetotakeoverthe\ncase.\nc.Ifthecrimetakesplaceinupperclasscompartmentsthecompartmentshallbeimmediately\nlockupandthecarriageallowedtoproceedtotheneareststationwhereitcanbereplaced,ifno\nGovernmentRailwayPolicestaffarepostedatthisstation,amemberofRailwaystaffwillwatch\nthis,untilapoliceofficercomesuponthescene.\nd.Noone,eitheraRailwayemployeesoranoutsider,shallbeallowedtoenterthecompartment\nuntilthepolicearrive,exceptisnecessarytoattendtoinjuredpersonsunabletoleavethe\ncompartmentwithoutassistance.\ne.TheRailwaypolicestationconcernedshallbeadvisedofthestationwherethecarriagehasbeen\norwillbedetached.Afterthecarriageistakenoverbyofthepolice,itshallnotbemovedor\notherwiseutilizedwithoutthewrittenauthorityplaceonthepartofthepoliceinreleasingthe\ncarriage,themattershallbereportedtheDCMconcerned.\n1729.CarryingCapacityofCoaches-\nSr.\nNo.\nAbbreviation AccommodationTareWeight(intones)\nSeatingSleeping\n1WGFAC(1STAC) 1818 53.56\n2WFC(1STCLASS)33/36/3922/24/26 39.3/41.3\n3WFCZ(1STCHAIRCAR)60- 41.4\n4ACCW(ACSLEEPER)46/4846/48 53.5\n5WGACCN(AC3TIER)6464 53.5\n6WSCZAC(ACCHAIRCAR)70- 50.9\n7WGSYCN(3TIER/SLEEPER)7272 42.25\n8WGSCZ(DAYCOACH)90- 37.10\n9GD/GDY(ORDINARY)80/90- 37.9", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 156, + "text": "10WGSD(DOUBLEDECKER)144/148- 44.0\n1730.Oneormorepassengersdesiringtobreakjourney/Extendcombinedticketissuedtoagroup-\nIncaseofthecombinedticketissuedtoagroupofpassengers,whenoneormorememberofthe\npartydesiretobreaktheirjourneyatsomestationandotherswanttocontinuetheirjourney,freeEFR\nmaybeissuedtoboththesubgroupsaftercollectingtheoriginalticketandmakingendorsement\nindicatingthedetailsoftheoriginalticketincludingthenameoftheticketissuingstation.Similar\ncrossreferenceshouldbealsobegivenontheoriginalcollectedticketandalsoaboutthefreeEFR\nissued.\nWhenthepartywantsextensionalongwithsplittingofticketattimeofmakingarequestforsplit\nticket(s)theoriginalticketshouldbecollectedandtwoormoreEFRsshouldbeissuedtothegroup\nwhichwantextensionjourneyticket,thefaresfortheportion(newdestination)shouldbecollectedin\naccordancewithrule220ofIRCACoachingtariffno.25part1volume-1.Theparticularsoftheoriginal\nticketshowingthefulldetailsshouldbeenteredontheEFRs.\nNote-\n1.Notelescopicbenefitwillbeallowed.\n2.OneanEFRhasbeenissuedeitherforfreeorfortheextendedjourneyintermsofRule220\nofIRCA\nCoachingTariffnofurtherextensionwillbeallowedinsuchcases.\n1731.GratuitiesorFeestoRailwayServant-\nGratuitiesorfeesshouldnotbeofferedtoRailwayservants.Railwayservantsarestrictlyforbidden\nfromaskingfor,oracceptingfromthepublic,anysuchirregulargratification.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 157, + "text": "Chapter-18\nBooksofReference\nThefollowingpublicationscontainingrules,conditions,rates,faresanddistanceforchargeforthe\ncarriageofcoaching,militaryandothertrafficforwhichthestationisopenshouldbemaintainedby\nthestationstaffdulycorrectedup-to-date:\n1.IndianRailwayConferenceAssociationCoachingTariffNo.25Part-1(Vol-1)containinggeneral\nrules.\n2.IndianRailwayConferenceAssociationCoachingTariffNo.25Part-1(Vol-2)containing\nconcessions.\n3.SupplementaryCoachingTariffcontainingsupplementaryrules.\n4.LocalDistanceTable.\n5.JunctionDistanceTable.\n6.IndianRailwayConferenceAssociationMilitaryTariffNo.6vol-1.\n7.IndianRailwayCommercialManualVol-1.\n8.Otherbooksissuedfromtimetotime.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 158, + "text": "Chapter-19\nImportantPhoneNumbers\n1901.TelephonenumbersofCommercialControlofIndianRailwayason01.01.2010-\nSr.No.ZoneDivisionRly.STDRly.No.STDCodeP&TNo.\n1CR\nHQ 01054527 02222697092\nBB 01055630,5564602222659563\nBSL 01155132,5513302582223004\nNGP 01255133,5513407122544386\nPA 01355121,5539902026124636\nSOLAPUR01455132,5513302172312752\n2ER\nHQ 02027267,2728903322106510\nMLDT02072210,7222703512268138\nHWH 02022271,2223203326606142\nSDAH02032211,3293603323509736\nASN 02082210,8221103412304170\n3SER\nHQ 08044225,4412203412304170\nKGP 08062081,6209403324396191\nCKP 08072712,7271603222255970\nADA 0808270306584238070\nRNC 08088334,8833203251245045\n4NR\nHQ 03032323,3292401123381174\nDLI 03022427,2349101123740024\nFZR 03122108,2234801632243413\nLKO 03223246,2361105222234533\nMORADBAD03322406,2394705912412034\nUMB 03422440,2244101712610596\n5NER\nHQ 04062352,6237805512202964\nIZN 04122311,2231305812411402\nLKO 04231341,3134205222233042\nBSB 04350999,5199905422224742\n6NFR\nHQ 05022328,2384403612676092\nKIR 05044216,4420906452230692\nLMG 0505424003674264077\nTSK 05064220,6422103742351549\nRNY 0503820603621244279\nAPDJ05034216,3420603564259935", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 159, + "text": "7NWR\nHQ 09545230,4523101412725811\nJP 0954429901412220915\nALL 0964421 01452622163\nBKN 09744215,4421601512544764\nJU 0984421402912431646\n8SWR\nHQ 06525390,2539208362289988\nSBC 06552390,5236008022876288\nMYSORE0656533008212422401\nHUBLI06545444,4539008362366702\n9SR\nHQ 06022673 04425350308\nMAS 06022641/2324804425355793\nMDU 06072250/7222304522308050\nPGT 06062250/6226004912556198\nTVC 06083250/8325104712320012\nTPI 06077250/7721804312418992\n10SCR\nHQ 07086834 04027834044\nHYB 07086656 04027834004\nGTL 0702718508552220305\nSC 07086678 04027833099\nBZA 07067720/67719086625776143\nGUNTUR0703299908632254161\nNED 0705222402462223545\n11ECR\nHQ 0252424806224273293\nDHN 0264221303262205284\nSEE 02962240/6222406158222468\nSPJ 02832250/3225106274221741\nDNR 02582231/8222506115232398\nMGS 02772244/7224505412253255\n12WR\nHQ 09022531/2255502222082809\nRTM 09244217/4421807412280710\nRJT 0944422002812473409\nBVP 0994422002782445538\nBRC 09144219026526438377\nADI09344219/4421307922200190\nBCT 09044216/4421502223017370\n13NCR\nHQ 03523853/2385405322230155\nALD 03522067/2206805322600977\nJHS 0375133/514105102473469\nAGC 0362111/211205622421026\n14WCR\nHQ 0155454007612677072\nJBP 01555133/5512207612627480\nBPL 0165116/512207552454602\nKOTA01744216/4424307442467021\n15ECOR\nHQ 0855133306742303110\nKUR 0857233406742490670\nSBP 0856233206632400093\nWAT08582415/8234508912842415\n16SECR\nHQ 07564557/6305107752417814\nNGP 07552636/5255207122540243\nR 0757343007712252236\nBSP 07562257/6305107752417814\n17RLYBD  03043897 01123782382\n18KRCLPNCL01987039402227572015", + "extraction_method": "text" + }, + { + "document_id": "circulars__Ticket Checking Manual (West Central Railway).pdf", + "document_name": "Ticket Checking Manual (West Central Railway).pdf", + "document_path": "circulars/Ticket Checking Manual (West Central Railway).pdf", + "doc_category": "circular", + "rule_type": "ticket_checking", + "priority": 2, + "authority": "Indian Railways", + "description": "Procedures and powers of ticket checking staff", + "is_static": false, + "effective_year": null, + "page_number": 160, + "text": "Chapter-20\nVariousPerforma", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 1, + "text": "Chapter 1 Unreserved Ticketing System in Indian Railways \n 1 \nChapter 1 Unreserved Ticketing System in Indian Railways 1.1 Highlights ð* Indian Railways did not have any structured mechanism for resolving delays on the part of CRIS in acquisition of hardware and peripheral equipments. The decision of Indian Railways to procure dot matrix printers for initial phases of implementation of UTS at different locations despite knowing its vulnerability to manipulation rendered the system prone to misuse and frauds. (Para No 1.8.1) ð* The Unreserved Ticketing System was frequently disrupted by extensive link failures in the leased communication channels provided by BSNL/MTNL and Indian Railways did not have any mechanism to ensure minimum guaranteed efficiency of the leased lines. Indian Railway \u0019s plan of providing thin clients in smaller stations experiencing frequent link failures was not achieved even after a lapse of about five years. (Para No 1.8.2) ð* The system design did not comprehensively incorporate all the business rules and had various deficiencies, which not only caused operational constraints but also warranted manual intervention leading to increased security risks and inconvenience to passengers. (Para No 1.8.3) ð* Disaster recovery and business continuity plans were not formulated and the back up measures were not tested leading to operational problems. Para No 1.9.1) ð* Inadequate physical and logical access controls exposed the system to unauthorised access and IT assets were not adequately protected. Change management controls were also weak as changes were carried out incorrectly or belatedly after revision of rules. Changes were not documented. (Para Nos 1.9.2 and 1.9.3) ð* Validation controls for issue of advance journey tickets, cancellation of tickets and issue of season tickets were inadequate. The policy of allowing cancellation of non-suburban tickets was prone to misuse in case of travel to short distance destinations. (Para No 1.10.1) ð* Fares and distances between stations were incorrectly adopted in the system leading to incorrect levy of fares from passengers. Several routes were not defined in the system preventing issue of tickets to", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 2, + "text": "Report No.PA 18 of 2008 (Railways) \n 2 \ndestinations; the validation controls for issue of blank paper tickets were also inadequate. The database contained various inaccuracies casting doubts on its reliability. (Para Nos 1.10.2 to 1.10.4) ð* The system was also deficient in controls to monitor and check any fraudulent use of pre printed ticket stationery. (Para No 1.10.5) 1.2 Gist of recommendations ð* Indian Railways may institute a structured mechanism incorporating penal provisions for deficiencies in performance vis-a-vis CRIS. The dot matrix printers should be replaced on priority with thermal printers to prevent the possibilities of misuse and to enhance the printing speed of tickets. ð* Indian Railways should formalise service level agreements with BSNL/MTNL for minimum guaranteed efficiency of leased lines and penalties for link failures. Indian Railways should expedite replacement of dumb terminals with thin clients in a specified time frame to improve the continuity of UTS operations. ð* The system should be comprehensively designed incorporating all the business rules relating to issue of unreserved tickets, to minimise manual interventions and to generate periodical reports accurately to enhance its utility. ð* Indian Railways should have a documented disaster recovery and business continuity plan encompassing all factors relating to IT risks. The back up measures need to be tested on a regular basis to avoid problems of synchronisation. ð* Indian Railways should develop a comprehensive IT policy. Adequate physical access controls should be instituted to safeguard UTS assets and access controls should be strengthened to ensure accountability for transactions. Assignment of various privileges should be standardised and adequate controls need to be established to prevent misuse of privileges. ð* Indian Railways should institute a mechanism for effecting changes to the program logic promptly and accurately as and when revisions in the business rules take place. All changes should be properly authenticated and documented. ð* Indian Railways should rectify the system and strengthen validation controls. Indian Railways may review its policy on cancellation of tickets issued for short destination journeys to prevent misuse. The fares and distances adopted in the system should also be rectified to be in accordance with the business rules and to ensure correct levy of fares from passengers. ð* Indian Railways should assess the completeness of master data on priority and incorporate all routes in the database. The inaccuracies in the database", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 3, + "text": "Chapter 1 Unreserved Ticketing System in Indian Railways \n 3 \nshould also be rectified to enhance reliability of data. The control mechanism for issue of blank paper tickets may also be strengthened. ð* Indian Railways may strengthen its monitoring mechanism for use of the pre-printed ticket stationery. Validation checks may be built in the system to highlight cases of discontinuity in ticket rolls. 1.3 Introduction Indian Railways (IR) carries about 1.4 crore passengers everyday out of which about 1.2 crore passengers travel in unreserved coaches and thus form the bulk of rail users contributing significantly towards railway \u0019s earnings. A railway ticketing system software namely Scalable Modular Advanced Rail Ticketing System (SMARTS) was implemented (1998) over IR on stand alone Self Printing Ticketing Machines (SPTMs) for issuing unreserved tickets. While SMARTS contributed towards reducing ticket inventory and provided automated accounting at the station level, the system had several limitations viz., non-availability of the facility for across-the-counter cancellation of tickets, increased transportation cost in updating program logic, need for huge manpower and lack of centralised control over individual booking offices etc. To overcome these limitations, IR planned (2001-02) a new System - Unreserved Ticketing System (UTS) for implementation initially at 23 locations in Delhi area. Centre for Railway Information System (CRIS) was the nodal agency for procurement of hardware and development of software that started from August 2002. UTS has since been replicated in all the zones of Indian Railways. UTS provides the facility to purchase unreserved tickets three days in advance of the date of journey. A passenger can buy a ticket for any destination from the UTS counter for all such destinations which are served by that station. The cancellation of tickets has also been simplified. Passengers can cancel their tickets upto one day in advance of the journey from any station provided with a UTS counter. On the day of journey, the ticket can be cancelled from any station of the cluster from where the journey was to commence. UTS is developed on UNIX operating system with C++ language interface for the front-end and SYBASE for the backend database. UTS database is maintained on servers placed at seven locations across the country (Mumbai, Delhi, Kolkata, Chennai, Secunderabad, Gorakhpur and Patna). 1.4 Organisation At the apex level, Railway Board is controlling the activities of UTS through the Computerisation and Information Systems Directorate. At the zonal level, UTS activities are controlled by Chief Commercial Manager who is assisted by Deputy Chief Commercial Manager, Senior Commercial Manager, Office Superintendents and other supporting staff. The technical support is provided by Deputy Chief Electrical Engineer, and Deputy Chief Signal & Telecommunication Engineer.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 4, + "text": "Report No.PA 18 of 2008 (Railways) \n 4 \nDevelopment and maintenance activities of the UTS are managed by Center for Railway Information System (CRIS), which is headed by a Managing Director. The Managing Director is assisted by Group General Managers, Chief General Managers and General Managers. At the zonal level, CRIS is headed by Chief General Manager/General Manager who is assisted by Regional Manager/Managers and Senior Software Engineers/ Software Engineers. 1.5 Audit objectives The review of Unreserved Ticketing System was conducted with a view to assess whether the: ð* acquisition and maintenance of hardware, communication network channels and software including system design were adequate and effective. ð* general controls were adequate and system was operating in an adequately controlled environment. ð* application controls were adequate and the system was in compliance with business rules and adequately secured from possibilities of fraud. 1.6 Audit scope, criteria and methodology The scope of audit review included test check of records maintained in the office of the CCM of zonal railways and at CRIS offices relating to development of software, procurement of resources, and implementation of the UTS for evaluation of general and application controls operating in the IT Environment. The rules and provisions contained in Indian Railway Commercial Manual Volume \u0013I, Indian Railway Conference Association \u0019s Coaching Tariffs, Indian Railway Stores Codes, guidelines, instructions and orders issued by Railway Board from time to time, minutes of the meetings, procedures defined by Railway Administration and best practices prevalent in IT environment were used as audit criteria for assessing the performance of the system. Relevant documents/records about implementation of UTS including records of selected 254 locations [CR:20, ER:20, ECoR:12, ECR:9, NCR:4, NER:10, NEFR:19, NWR:10, NR:20, SCR:30, SER:17, SECR:10, SR:20, SWR:20,WCR:13, and WR:20] were scrutinised. Simulation tests were conducted at CRIS and different UTS locations through test data. Output generated by the system at different locations on various Zonal Railways was also checked. Analysis of UTS data was done through Computer Assisted Audit Techniques (CAATs) to verify the integrity, completeness and availability of data. 1.7 Audit findings The audit findings are given in the following three sections: ð* Acquisition and implementation ð* General controls ð* Application controls", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 5, + "text": "Chapter 1 Unreserved Ticketing System in Indian Railways \n 5 \n1.8 Acquisition and implementation Acquisition and subsequent maintenance of hardware, including the communication network, is vital for implementing the computerised system in a specified time frame and for providing uninterrupted service. Further, for a system to be implemented effectively, it is imperative that the system is designed comprehensively incorporating all the relevant business rules and is compatible with all situations so as to be operationally convenient and to be utilised optimally. Audit observed deficiencies in the acquisition and maintenance of hardware, communication network and system design as brought out below: 1.8.1 Deficient acquisition and maintenance of hardware Railway Board had laid down year wise targets for implementation of UTS in identified locations across all zones. The hardware and peripheral equipment required for UTS at the various locations were to be acquired by CRIS. Zones were required to enter into Annual Maintenance Contracts (AMCs) with the original equipment suppliers for maintenance of the hardware acquired by CRIS. Audit observed that: ð* There were delays in implementation of UTS in 12 out of the 16 zones. In most of the zones the delays were on account of inordinate delays by CRIS in acquisition of hardware and as a consequence IR was running behind schedule in implementation of UTS as shown below. This also indicated that IR \u0019s monitoring mechanism was weak. Zone Target Number of locations Period Actual implemen-tation Number of locations not yet implementedReasons SR 71 2006-07 27 44 Delayed acquisition by CRIS. ER 203 2006-07 7 196 Delayed acquisition by CRIS. WR 116 2005-06 54 62 Delayed acquisition by CRIS. SCR 91 2005-06 66 25 Delayed acquisition by CRIS CR 90 2006-07 25 65 Non-availability of hardware. Delayed acquisition by CRIS. NWR 10 2004-05 and 2005-06 1 9* Implementation in 9 locations delayed up to 9 months due to delayed procurement of hardware by CRIS. ECoR 45 2004-05 to 2006-07 23 22 NFR 33 2006-07 2 31 WCR 25 2006-07 Nil 25 Work still in progress. SER 76 2004-05 to 2006-07 41 35 NR 25 2004-05 6 19 NCR 35 2006-07 Nil 35 Delayed acquisition by CRIS.(Phase \u0013II) For phase one also, no progress during 2004-05 and only four locations out of 18 were covered up to March 2007 due to delayed supply of equipment by CRIS.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 6, + "text": "Report No.PA 18 of 2008 (Railways) \n 6 \nð* In ECR, UTS locations could not be commissioned because communication channels made available by BSNL could not be tested. Review of records of Dhanbad division revealed that nine channels provided by BSNL could not be tested for want of modems. These channels were only verified with local leads and were lying idle. BSNL had already informed that lease rentals for the channels would commence from the date of testing with local leads. Therefore, non-commissioning the locations not only delayed implementation of UTS in ECR but also resulted in avoidable payments to BSNL. ð* Railway Board in its \u0018Action Plan for Unreserved Ticketing \u0019, had decided in September 2002 itself that thermal printers, which are tamper proof and could print tickets at higher speeds, should only be used in UTS rather than the conventional dot matrix printers, which were susceptible to misuse and frauds. Railway Board Vigilance also advised and intimated all the zones about the possibility of frauds in issue of tickets in UTS as booking clerks could abort or tamper with the printing process of a dot matrix printer and use the blank/partially printed tickets for issuing higher value tickets and embezzle amounts collected by subsequently showing the higher value tickets as not printed. Further, to check the genuineness of tickets, UTS project envisages provision of Hand Held Terminals (HHTs) to the Travelling Ticket Examiners. The HHTs would verify the bar code that would be printed on the ticket issued through UTS by comparing it with the number stored in the server. A legible bar code could be printed only through a thermal printer. Despite the known vulnerability of manipulation with dot matrix printers by the booking clerks and inherent advantages of having thermal printers, IR proceeded with bulk purchases of dot matrix printers across all zones. For three zones alone, 1,296 printers were procured at a cost of Rs.1.32 crore (WR-400 printers costing Rs.0.48 crore, CR-298 printers costing Rs.0.27 crore and SCR-598 printers costing Rs.0.57 crore) rendering them susceptible to misuse and frauds. Further, the dot matrix printers deployed in the suburban stations in CR also led to formation of long queues in front of booking counters due to the slow printing speed of the printers. Instances of manipulation of tickets generated through UTS were already noticed in ECR, NR and WCR. In ECR, unreserved tickets of low value were manipulated and converted into high value tickets and such manipulated tickets were used for travel as well as for seeking refunds thereby resulting in loss to IR. In NR, fraudulent practices were prevalent at a number of UTS locations such as Azadpur, Sonepat and Lucknow bypassing the security features of printers. Test check by audit at some UTS locations further disclosed that the security locks of four out of eight ticket printers at Lucknow, all the six printers at Haridwar and one out of the ten printers at New Delhi were unlocked. Keys were found with the operators at Lucknow and Haridwar. In WCR, platform ticket valuing three rupees generated by the system was manipulated by typing the destination as Surat and fare as Rs.209.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 7, + "text": "Chapter 1 Unreserved Ticketing System in Indian Railways \n 7 \nð* Procurement of 866 thermal printers for the subsequent phases of implementation of UTS in WR and CR was entrusted to CRIS (474 printers for WR and 392 for CR). CRIS was, however, yet to acquire these printers adversely affecting the efficiency of UTS. ð* The Memoranda of Understanding (MoUs) entered into by the various zones with CRIS did not provide for penal clauses and therefore IR did not have any mechanism to hold CRIS accountable for the delays in acquisition of hardware. ð* A test check disclosed that AMCs for maintenance of computer hardware and peripheral equipment at UTS locations were not entered into by four zones (CR, NER, WCR and ECoR). In WR, though the AMC expired in September 2006, neither was it renewed nor was a fresh AMC entered into. In CR, AMC was not entered into for the networking equipment also, even though its warranty period had expired in October 2006. Further in CR, the faulty dumb terminals of various stations from all over the zone were transported to headquarters for service and maintenance. ð* Even the basic equipment such as Uninterrupted Power Supply (UPS) to protect the equipment from power surges and to avoid power interruptions was not available in many locations in ER and ECoR. In SCR, the UPS provided was not working in many locations. ð* After implementation of UTS, the self printing ticketing machines (SPTMs) were lying un-utilised in zones. In ER, 209 SPTMs withdrawn from service from 49 locations were lying un-utilised. In NCR also, SPTMs were lying un-utilised in 17 locations. ð* Railway Board had decided (August 2004) that UTS being a critical passenger interface application, 25 per cent spares should be built up at each location. However, such spares were built up in only one station out of 20 stations test checked in WR. Thus, the entire mechanism of acquisition of hardware and peripheral equipments was defective. While the procurement by CRIS was predominantly characterised by delays, IR \u0019s decision to procure dot matrix printers for the initial phase of implementation of UTS at different locations despite knowing its vulnerability to manipulation lacked logic. Further, IR did not have any structured redressal mechanism against CRIS for the persistent delays in acquisition of hardware. The maintenance of hardware and peripheral equipment was also poor. Recommendations IR may institute a structured redressal mechanism with CRIS by incorporating penal provisions for deficiencies in performance. IR needs to strengthen its monitoring mechanism to avoid slippages in achievement of targets. IR should replace the dot matrix printers on priority with thermal printers to prevent the possibilities of misuse and fraud leading to leakage of revenue and to enhance the printing speed of tickets.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 8, + "text": "Report No.PA 18 of 2008 (Railways) \n 8 \n 1.8.2 Deficient communication network Data communication between locations and server was either through leased lines from BSNL or through Railway \u0019s own communication channels. Important locations had two channels; combination of BSNL and Railway channels while smaller locations had only one channel, either of BSNL or of Railways. Audit observed that: ð* There were frequent and extensive link failures of BSNL channels in all the zones. Since UTS locations are provided with dumb terminals, which do not have a hard disk to store data, connection to the central database is lost in the event of communication link failures and tickets cannot be issued through UTS. The zone wise link failures, which adversely affected the availability of the UTS services are shown below. Zone Observations NWR Number of breakdown cases increased from 439 cases during 2005-06 to 676 failures during 2006-07, 83.14 per cent of the cases involving 1106.18 hours were due to link failures. NEFR The average hours lost in a month due to link failures ranged from 10 hours to 28 hours in various locations during the period from September 2006 to December 2006. Similarly during the period from January 2007 to March 2007 the downtime due to link failure ranged from 35 minutes to 56.18 hours in the two PRS cum UTS locations (Goalpara Town and Harishchandrapur). NER 572.20 hours of downtime at various locations was attributed to link failures over a period of ten months from August 2006 to May 2007. ECoR In 10 out of 12 locations test checked, the daily average system down time ranged from 14 minutes (at Bhubaneswar) to 4 hours and 20 minutes (at CHE). Further, in Khurda Road Division, 90.1 per cent of the down time in May 2007 was due to link failures. WR In four locations viz; Vasai Road, Virar (suburban locations), Amalner and Nandurbar stations, the down time ranged from 3 hours and 12 minutes to 54 hours and 29 minutes in a month, which was mainly on account of link failures of BSNL/MTNL channels. ECR In Danapur Division alone, 229.12 hours were lost due to link failures during the period from 1 September 2006 to 10 October 2006. WCR At 13 locations test checked, 672 out of the 815 disruptions were on account of link failures and UTS terminals were out of service for 1694 hours and 7 minutes. NCR 202 out of the 223 failure cases were due to link failures and the downtime ranged from five minutes to 5 hours and 45 minutes. ER In Howrah, 27 out of the 34 failures during October and November 2006 were due to link failures. The duration of failures ranged up to 21 hours and 25 minutes. Frequent link failures coupled with extensive power failures led to the closure of one UTS location at Pirpainti Station in Malda Division and tickets were being issued manually. SER Records relating to link failures were available only in nine locations out of 17 locations test checked and 233 failures were observed in these nine locations during the period from October 2005 to June 2007.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 9, + "text": "Chapter 1 Unreserved Ticketing System in Indian Railways \n 9 \nSECR 21 instances of system failures were reported at five locations during the period from January 2007 to March 2007 involving a total downtime of about 114 hours, which was mainly due to link failures. SWR There were frequent link failures ranging from 5 minutes to 8 days and printed card tickets/Blank paper tickets were issued in some of the stations during the link failures. NR 596 cases of communication (including 17 dual channels) failures were reported during the period from March 2007 to May 2007. CR Major cause of failure of UTS was attributed to link failures. A review of failure register maintained at nine locations disclosed that the failure data in the database did not tally with the registers maintained by the locations, indicating that either all failures were not properly reported or they were not updated in the system. SR One instance of major communication failure occurred in December 2006 resulting in breakdown of UTS. The system was restored after a gap of 20 hours and during this period unreserved tickets were issued manually ð* There was no service level agreement between the Railway administration and BSNL/MTNL explicitly setting out the minimum guaranteed efficiency and penalties for failure and IR continued to incur expenditure towards hire charges even though the leased communication channels were disrupted due to frequent link failures. ð* As early as 2002, Railway Board decided to introduce thin clients, which have flash memory, at smaller stations where link failures are frequent so as to issue tickets through UTS even during link failures. After the link is restored these devices synchronise the transactions done during link failures with the servers to keep the database updated. The thin clients were to be procured by CRIS. Even though about five years has lapsed since Railway Board \u0019s decision, thin clients have not been provided in any UTS location over IR. Thin clients were not provided in various locations over ECoR, WR and NWR even though they were planned in 2004-05 and 2005-06. In SCR they were not provided even though Rs.16 lakh was already paid to CRIS for the procurement. While in CR 26 terminals of Mumbai suburban stations (Kurla, Ghatkopar and Thane) could not be commissioned for want of thin clients and thermal printers, in NER though 24 thin clients were purchased in May 2006 they were not yet installed at various locations by the engineers of CRIS. Thus, even though communication link failures in the channels provided by BSNL/MTNL were extensive, IR did not have any mechanism to ensure minimum guaranteed efficiency of leased lines. IR \u0019s plan of providing thin clients in smaller stations experiencing frequent link failures has remained unachieved even after a lapse of about five years. Recommendations IR should formalise service level agreements with BSNL/MTNL for minimum guaranteed efficiency of leased lines and penalties for link failures. IR should expedite the replacement of dumb terminals with thin clients in a specified time frame to improve the continuity of UTS operations.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 10, + "text": "Report No.PA 18 of 2008 (Railways) \n 10\n1.8.3 Deficiencies in system design Audit observed several design deficiencies in the UTS software as indicated below: ð* Concessions to be granted to various categories of passengers as per extant rules of IR were not defined in the system. o Provision to issue concessional tickets to members/students/industrial workers traveling in group, foreign students studying in India, persons attending annual sessions of all India bodies of educational, cultural and social importance and All India Women Conference, Teachers honoured with National Award by President of India on Teachers Day; were not made in the system. (ECR, NR, NEFR, ER and NWR). o In WR all the concession codes were not defined in the master database. o Concessions in some cases were improperly provided. In SECR, 50 per cent concession was improperly provided as against 30 per cent admissible as per rules for recipients of President \u0019s Police Medal for distinguished service. ð* Even though issue of circular journey tickets was permissible as per IRCA coaching tariff there was no provision in the UTS software to issue circular journey tickets to passengers. (NWR, ECR, NR, CR, WCR, SWR, ECoR, ER, NER, WR and SR). Consequently passengers are being disallowed the benefit of lower rates for circular journeys apart from the inconvenience of booking tickets for each leg of the journey separately. ð* As per extant rules, if a passenger misses the connecting train for his continued journey at any station owing to late running of the train in which he is travelling, the fare for the travelled portion would be retained and the balance fare for the un-travelled portion should be refunded within 3 hours of the actual arrival of the train. There was no such provision in the UTS software for cancellation of un-travelled portion of a ticket (ECR, NR, NWR, WR and SECR). ð* The system does not provide for issuing a receipt for clerkage charge when unreserved tickets are cancelled. As such non accountal of the amount received towards clerkage charge was not ruled out as it was possible for booking clerks to collect the clerkage charge of Rs.10 while not actually cancelling the tickets and reissuing the same to other passengers. (ECoR, CR, ER, NER and SER). ð* Unreserved tickets for various classes (Sleeper, Chair Car, AC III and First class) issued from UTS subsequently presented for reserved accommodation through Passenger Reservation System (PRS) could be cancelled through UTS only. UTS, however, did not have any provision for realisation of the cancellation charges as envisaged in the rules. These tickets were being cancelled manually, which was time consuming and inconvenient for passengers.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 11, + "text": "Chapter 1 Unreserved Ticketing System in Indian Railways \n 11\nð* UTS did not properly account for the cancellation of a ticket initially issued on 100 per cent concession vouchers such as military warrants etc. When such a ticket was cancelled, the system did not include the refunded amount through vouchers under \u0018voucher refunds \u0019 in the Daily train cash book-cum-summary (DTC) generated by the system at the end of the shift of the booking clerk resulting in an extra debit against the booking clerk. To regularise the transaction, a special credit was being obtained manually from the accounts department each time. (ECR, SR, CR, SCR, NER, NR, SECR and SWR). ð* UTS was generating incorrect accounting reports. Many locations complained of discrepancy between the DTC and figures shown in the reports generated through UTS raising questions on the reliability of the information extracted from the system (SCR, ER, and NER). In SCR, the differences between DTC and cash reports range from Rs.3 to Rs.620. Though these differences are a recurring phenomenon in UTS, no action was initiated by CRIS to rectify the errors. A test check for the month of March 2007 in ER disclosed that transactions of seven days, as recorded in the Daily Summary of Transactions, did not tally with the corresponding figures in the Monthly Summary of Transaction (Cash Information). Such discrepancy was noticed in respect of both the servers, viz; Cal 1 and Cal 4. Likewise in NER, while the monthly statement for July 2006 for Pilibhit station indicated the figure as Rs.32,00,076 the corresponding 31 daily transaction summaries indicated the figure as Rs.32,62,126. ð* Stock Roll Management Module, which facilitates users to enter the details of ticket rolls disbursals from stores and allows users to record the roll transfer from one booking location to another etc, was not implemented thereby rendering the system vulnerable to possibilities of frauds and manipulations in use of unaccounted tickets (NR, WCR, NWR, CR and ECoR). ð* UTS also restricted the maximum number of passengers per ticket to four for second class /Mail express/ Ordinary, two for sleeper class and one for upper class (except AC I or AC II ), which had the effect of inconveniencing the passengers. ð* One of the objectives of UTS was to provide centralised accounting, database and system administration. UTS has not yet been integrated with Advanced Finance and Railway Earnings and Expenditure System (AFRES) or any other accounting system and therefore online information of UTS earnings or apportionment of UTS earnings over different zones could not be provided. Further, as per the functional specifications, the system should generate Balance Sheet, Passenger Classification for the purpose of data for 6A Statement/Apportionment of Earnings and Cumulative Shortage-In-Booking (SIB)/ Excess-In-Booking (EIB). Audit scrutiny revealed that provision to generate these reports was not made in the UTS system. Presently monthly Balance Sheets of the stations are prepared on the daily", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 12, + "text": "Report No.PA 18 of 2008 (Railways) \n 12\nand monthly position of UTS earnings and other manual bookings. These are sent to Traffic Accounts Office for further compilation (ECR, CR, SER, SECR, WCR, WR, ECoR and NEFR). Thus, the software had various deficiencies, which not only caused operational constraints and warranted manual interventions leading to increased security risks but also inconvenienced the passengers. The business rules relating to grant of concessions to various categories of passengers were not incorporated in the system. Recommendations The deficiencies in the system design pointed out above need to be rectified based on user requirements. The system should be comprehensively designed so as to encompass all the business rules of IR relating to issue of unreserved tickets, to minimise manual interventions and to generate periodical reports accurately to enhance its utility. 1.9 General controls General controls regulate the environment in which the IT application is operated and includes disaster recovery and business continuity planning, access controls- both physical and logical access and organisational issues such as change management, segregation of duties and providing adequate training. Audit observed that the disaster recovery and business continuity arrangements were inadequate, IT security practices comprising physical and logical access and environmental controls were inadequate, change management was deficient and training of staff was inadequate as brought out below: 1.9.1 Inadequate disaster recovery and business continuity arrangement A structured disaster recovery and business continuity plan is essential to reduce the risks arising from unexpected disruption of the critical systems and to have continuity in business activities. The disaster recovery plan includes off-site storage of valuable data and back up server(s) at an alternative location to continue business operations in the event of a major disaster. Keeping in view the criticality of UTS which provides continuous online processing of transactions on a real time basis and is a major source of revenue to IR, a duly tested, documented and comprehensive disaster recovery and business continuity plan and a ready-to-start reserve facility with offsite storage of important data is essential. Audit observed that: ð* A disaster recovery and business continuity plan was not formulated and put in place in all the zones of IR. Failure to curb the high incidence of link failures as explained in paragraph 8.2 was partly due to the absence of a business continuity plan to address interruptions in service. ð* Although back up servers were available, the mechanism of accessing the back up servers and the data stored in them were not tested leading to operational problems as detailed below:", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 13, + "text": "Chapter 1 Unreserved Ticketing System in Indian Railways \n 13\no In SER it was noticed that tickets issued through Cal-2 (Back-up server) could not be cancelled through Cal-3 server. Even in ER, the two servers Cal-1 and Cal-2 were not integrated and therefore tickets issued through one server could not be accessed and cancelled using the other server. o Similarly in NR, the system prevented field locations (New Delhi, Delhi, Nizamuddin, BVH) on 5 and 17 March 2007 and 3, 4, 6 and 7 April 2007 from canceling tickets from back up servers (DR servers). Further, when the main servers were down on 24 April 2007, booking from DR server could not be done and tickets were issued manually at Delhi, Ghaziabad and all other locations of the zonal server. This indicated that back up servers were not containing the entire data as a replicated copy of data residing on the primary server. o UTS on CR and WCR failed (17 April 2006) from 0.05 hours and 8.50 hours due to server problem and the loss was assessed as Rs.50 lakh. Similarly, both the UTS primary and secondary server failed (5 February 2007 at 17.20 hrs) hampering the UTS operations in WR for over 50 minutes. o In SCR, when the UTS/Secunderabad switched over to disaster recovery server (9 December 2006) located at Chennai from 10.00 to 11.00 hours all the locations in SCR were advised to log into MAS server of Chennai. But many locations were denied access to MAS server with messages like \u0018Invalid login name/pass word \u0019 \u0018remote end disconnected \u0019 etc. Only 25 locations were able to log into MAS server and issue UTS tickets. Even the locations that logged into MAS server could not generate cash summaries from UTS/MAS server for the transactions done between 10.00 to 11.00 hours. Further one location could not cancel the tickets issued from MAS server. ð* Off site storage of data were also not provided in some zones (ECR and EcoR). In ECR, the back up data was stored in the same premises, exposing it to the same set of risks. In Dhanbad Division the booking data was lost due to computer viruses and UTS operations came to a halt for 15 days. Thus, there was no disaster recovery and business continuity plans in the zones and the back up measures were not tested leading to operational problems of non-synchronisation of primary servers with the back up servers. Recommendations Railways should have a formal and documented disaster recovery and business continuity plan encompassing all factors relating to IT risks. The back up measures need to be tested on a regular basis to avoid problems of synchronisation of primary servers with the back up servers.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 14, + "text": "Report No.PA 18 of 2008 (Railways) \n 14\n1.9.2 Inadequate IT security practices Every organisation leveraging IT in a big way has an obligation to secure IT and related assets including data, applications and infrastructure to ensure confidentiality, integrity and availability of the information systems and communication systems that store, process and transmit data. It is imperative that physical and logical access and environmental controls are adequately provided for. The prevalent checks were inadequate as brought out below: 1.9.2.1 Inadequate physical access and environmental controls Physical and environmental controls prevent unauthorised physical access and interference to IT services. UTS being a mission critical system, it is imperative that the computer equipment and the information contained therein are physically safeguarded with access only to authorised personnel and that the IT assets are properly maintained and adequately protected. Audit observed that: ð* There was no effective mechanism to restrict entry of unauthorised persons to UTS locations where terminals, communication equipments, cash and other documents were kept and to the server rooms rendering the system vulnerable to disruption by unauthorised persons (SR, ECoR, WR, NR, NER, SECR and SER). Physical security of server room was also deficient (SR and WR). ð* Neither security personnel were posted nor were any instruments installed to restrict unauthorised access in UTS locations over ECoR and SER. In NR, the biometric identification system installed at CCM/IT office buildings for controlling entry to the console room housing the zonal servers, was not in use. ð* Costly equipment like routers, modems etc. deployed on UTS needed to be protected against water, dust etc. In CR, it was observed that at many locations, the booking offices were prone to water seepage. In one location, it was seen that the rain water dripped from the ceiling and affected the working at counters. Staff used containers to collect the water to prevent damage to printers, terminals etc. It was reported that the air conditioners provided to protect UTS equipment had to be replaced thrice due to water seepage at this location. 1.9.2.2 Inadequate logical access controls The activity of management of access rights and assignment of privileges is done through \u0018User Definition Management \u0019 (UDM), a software utility. The creation of new user IDs, assigning privileges, modification of existing privileges and deletion of users are important activities under UDM. Requests for new user ID and changes required are proposed by supervisors of locations and the database administrator assigns the requisite privileges to the user. Logical access to the UTS is to control and protect the applications and underlying data files from unauthorised access, amendment or deletion. The access is to be controlled by identifying each individual user through his/her", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 15, + "text": "Chapter 1 Unreserved Ticketing System in Indian Railways \n 15\nunique login ID which is also linked to the user rights and access to various areas of the application. The system provides for two very important operation level rights as given below: Terminal Type User Type Rights Booking Booking Enquiry/ Issue/Cancellation Supervisor Supervisor Supervisory functions such as special cancellations in addition to all the above rights It was observed that the controls which govern the management of user IDs and passwords were absent. This made the system vulnerable to unauthorised access and attendant problems relating to accountability as brought out below: ð* Commercial clerks having booking privileges were allowed to login to the system with supervisory user ID/password to perform supervisory functions such as special cancellations (SR and SECR). Further, in some stations where chief booking supervisor was not available on all the shifts, it was observed that supervisory privileges were carried out by the booking clerks present on duty, which was an inherent risk. (CR, ECoR, SER and WCR). In five locations of ECoR, 18 staff members were allotted with both operator as well as supervisor privileges. ð* In some locations, user IDs of commercial clerks, who went on long leave or were transferred to another booking location or retired from service were not deleted and the system was therefore prone to unauthorised access. (SR, SER and NER). In SR, some of the users IDs were used by the subsequent incumbents. User ID and password in many cases were the same resulting in one user logging into the system with user ID and password of another user. Passwords were shared amongst different users even in ER. In SR, duplicate users were created when user privileges were upgraded e.g. from operator to supervisor, supervisor to administrator etc. and hence, one user had two or more user IDs with different roles. In WR, it was found that 354 users of 57 locations had two or more IDs and in ER, one user had 12 IDs. ð* As per functional specifications of the UTS, the length of all user passwords should be of 10 digit alphanumeric characters. Audit however observed that the maximum length of user passwords accepted by the system was only 6 digits. Moreover, there was no restriction on minimum length of password and system even accepted a single digit/character password (NR, NER, SER, SWR, ER, SECR and ECR). On being pointed out by Audit, the length of password was increased to four digits in Delhi UTS, which was till not as per functional specifications. In NR, multiple user IDs were created for some users as noticed at Moradabad and Ghaziabad locations. It was further observed that passwords were lying unencrypted in system tables in NR. ð* On WCR, ER and ECoR, it was noticed that the user \u0019s passwords were not changed since installation of UTS at various locations.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 16, + "text": "Report No.PA 18 of 2008 (Railways) \n 16\nThus, the IT security practices were deficient with inadequate physical and logical access controls as a result of which the system was exposed to unauthorised access and the IT assets were not adequately protected. Recommendations IR should develop a comprehensive IT policy. Adequate physical access controls should be instituted to safeguard UTS assets and access controls should be strengthened to ensure accountability for transactions. Assignment of various privileges should be standardised and adequate controls need to be established to prevent misuse of privileges. 1.9.3 Deficient change management A dynamic system such as UTS is based on the policies of the Government. From time to time, the framework of rules undergoes changes and these would need to be incorporated into the system in time. A sound change management procedure ensures that the requisite changes are made into the software in an authorised, accurate and timely fashion. Audit observed that: ð* There was no documentation (for testing of changes, formal approval/authorisation before releasing new online versions) in many of the zones to trace the authenticity of changes made to UTS software from time to time. Further, it was seen in NR that even oral requests for changes in the application were accepted. As a consequence, changes to be made in the software were not analysed properly and often implemented incorrectly. For instance, while Railway Board had directed to reduce the fare of second class ordinary fare by one rupee (September 2005), a fare reduction of two rupees for combined tickets (Mail/express and ordinary tickets) was incorrectly incorporated in the program logic. Similarly while Railway Board reduced the second class fare by one rupee with effect from 1 April 2007 for non-superfast mail/express trains only, the changes were incorrectly made in the system to reduce the fare of superfast trains also apart from the fact that the changes were carried out after a delay of three months. ð* The problems faced during the operation of UTS were referred to CRIS telephonically and the necessary modifications were carried out by CRIS without following proper documentation procedures (NEFR). ð* The changes in tariffs were not carried out in the system in a timely manner resulting in improper levy of fares from passengers. While in some cases the changes were not effected at all, in others the changes were effected belatedly. For instance, in an important case of change of business rule affecting all the railway zones, second class fare of mail/express trains was reduced by one rupee with effect from 1 April 2007 necessitating superfast surcharge ticket to cost nine rupees for holders of mail/express tickets who traveled on superfast trains instead of eight rupees chargeable earlier. No changes have been made so far in the UTS versions operational in various other zones (ECR, SR, ECoR, ER, NER and SER) while the required change was made in the system after a delay of one month and 20 days in CR leading to short collection of fares from passengers. In SR", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 17, + "text": "Chapter 1 Unreserved Ticketing System in Indian Railways \n 17\nalone, the short collection of fares for two months i.e.; April and May 2007 was Rs.1.68 lakh. It was further seen in CR that five out of the 12 changes made in the system from January 2006 to May 2007 were done belatedly. Similarly, even though the inflation in distance between Gooty-Dharmavaram section of Guntakal Divison for charging fares were withdrawn (September 2006) the corresponding changes were not carried out in the system and the tickets issued from Bangalore Station to Bellary, Hospet, Gadag, Hubli etc. via Gooty-Dharmavaram Section continued to be issued with the inflated distance, resulting in levy of extra fares from passengers. Thus, the mechanism to carry out changes in the software to be in line with the changes in the framework of rules was deficient as incorrect or delayed changes were carried out and were not documented. Recommendations IR should institute a mechanism for effecting changes to the program logic promptly and accurately as and when revisions in the business rules take place. IR should ensure that all changes are properly authenticated and documented. 1.9.4 Inadequate training As training of booking clerks was a critical input for successful operation of UTS, all the zones were instructed (June 2003) to ensure proper training of staff on an urgent basis. Audit, however, observed that trained staff was not adequately available to man the UTS terminals in various zones. Training in various zones was to be imparted by CRIS. Audit observed inadequacies in providing training to staff in the zones as shown below. ð* In WR, only 123 out of the strength of 534 were trained in UTS in the 20 locations test checked. Similarly in ECoR, only 14 staff members were trained as per records. During the course of audit at selected locations, the booking supervisors intimated that none of their staff members were trained. ð* Only 34 staff members were trained for a day in three batches in SER despite three MoUs being signed with CRIS for Rs.11.90 lakh for imparting training to 230 persons in 23 batches in two phases apart from imparting training in 36 stations in the third phase. Most of the booking clerks in SWR were not trained and in NEFR, training in most cases was organised by deputing UTS operators from divisional headquarters for a very limited period, which was inadequate. ð* Moreover, none of the audited locations were provided with user manuals leading to the risk of unauthorised practices being adopted by booking clerks (WR and SWR). Thus, training of staff was not receiving the requisite importance and consequently the operational efficiency of the system was compromised.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 18, + "text": "Report No.PA 18 of 2008 (Railways) \n 18\nRecommendations IR should ensure that training is imparted to all the concerned staff in a time bound manner. Updated user manual should be made available at all UTS locations. 1.10 Application controls Application controls ensure that the transactions are carried out according to the business rules of the organization. These controls contain validation checks to cover input, processing and output operations of the systems. Audit observed that a number of important validation controls for issue and cancellation of tickets, fares, definition of routes and issue of blank paper tickets were inadequate, data base had various deficiencies and the validation control for ticket rolls was inadequate as brought out below: 1.10.1 Inadequate validation control for tickets Audit observed that validation for issue of advance journey tickets, cancellation of non-suburban unreserved tickets and for issue of season tickets was deficient as shown below: 1.10.1.1Advance journey tickets As per Joint Procedure Order between Commercial and Accounts departments, the system was designed to issue tickets three days in advance (excluding the day of journey) in case of non-suburban stations only which were located beyond 200 kilometers. Results of test data revealed that the system allowed issue of advance journey tickets for non-suburban stations as well for distances less than 200 Kilometers which was not permissible as per JPO (ECoR, SER and SECR). 1.10.1.2Cancellation of unreserved tickets As per rules1 read with the Joint Procedure Order of Commercial and Accounting departments cancellation of non-suburban unreserved tickets is allowed up to three hours after departure of the last train, on designated day of journey, towards the destination for which ticket is issued. Audit observed that: ð* The system improperly allowed cancellation of non-suburban tickets even after three hours of departure of last train for the booked destination on that day (ECoR and SER). ð* This apart, the rule itself was prone to misuse and frauds in case of unreserved tickets issued for short destinations where a passenger could perform his journey in the morning and return to the ticket issuing station the same day and cancel the ticket (ECoR, SR, CR, SER, NER, ECR, SECR and NR). For instance, a ticket issued from Mumbai CST to Pune was valid up to three hours after the actual departure of the last train of the day for the destination station. While the distance between Mumbai to 1 Rule 213.5 of IRCA Coaching Tariff No. 26 Part I (Vol. I)", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 19, + "text": "Chapter 1 Unreserved Ticketing System in Indian Railways \n 19\nPune is 192 kilometers the travelling time is four hours approximately. There are a number of trains to commute between Mumbai and Pune everyday and the last train for Pune departs from Mumbai CST at 23.35 hours and as such the ticket could be cancelled up to 02.35 hours on next day. Hence the passenger could travel up to Pune and return back to Mumbai CST and could cancel the ticket for refund later in the day. The possibility of misuse or fraud has further increased since Railway Board has permitted (February 2007) refund of tickets issued through UTS on the day of journey at the ticket issuing station or at any of its cluster stations. Zones have been vested (October 2003) with the responsibility of defining cluster stations for every city/town/metro. ð* Further, instances were noticed in the database where the difference between journey date and cancellation date exceeded three days. Further, journey tickets issued for travel on the same day were shown as cancelled on days prior to the journey date in the computerised database (SR). 1.10.1.3Season tickets The system was designed to generate identity cards for persons seeking/ holding season tickets. The unique identity card number generated by the system is recorded on the season ticket so that misuse of season tickets is prevented. Passengers travelling on season tickets are required to carry the identity card issued and produce it to ticket checking staff when demanded. Various deficiencies existed in the issue of season tickets. Audit observed that: ð* The season tickets issued did not contain the identity card details of the holder in many cases. The columns earmarked for identity card number and name in the season ticket had irrelevant data. While the identity card number was shown as zero, the names were displayed as \u0018XYZ \u0019, \u0018WWW \u0019 etc. (SCR and NR) defeating the very purpose for which the identity cards were generated. ð* Further, even though season tickets were not to be issued to children below five years of age, the system permitted issue of season tickets to children under the age of five years (SCR). ð* As per extant rules, superfast surcharge should not be levied on season tickets issued for journeys on suburban trains. An analysis of data contained in the season ticket journal for the month of March 2007 in SCR indicated that superfast surcharge was collected even on season tickets issued for journeys on suburban trains. ð* In 9575 cases of identity cards issued to seasonal ticket holders in NR, the destination and originating stations were the same and the dates of issue and validity were also found to be the same raising questions on data integrity. Thus the validation controls for issue of advance journey tickets, cancellation of tickets and issue of season tickets were inadequate. The policy of allowing cancellation of non-suburban tickets up to three hours after the departure of", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 20, + "text": "Report No.PA 18 of 2008 (Railways) \n 20\nthe last train on the designated date of travel was prone to misuse in case of travel to short destinations. Recommendations IR should rectify the system and strengthen the validation controls on issue of advance journey tickets, cancellation of tickets and season tickets. IR may review its policy on cancellation of tickets issued for short destination journeys to prevent misuse. 1.10.2 Inadequate validation of fares and distances Audit observed that the validation of fares and distances was weak as shown below: ð* Differences existed in the fare chargeable for milk vendor season tickets for various destinations from Talegaon vis-à-vis the fares computed by the system thereby forcing the booking clerks to issue blank paper tickets (CR). Cases were noticed in ER, where tickets (including platform tickets) were issued with abnormal fares and the concessions given on Privilege Ticket Orders (PTOs) were incorrect. ð* There were differences in the distances recorded between stations in the route database as compared to the actual distances which led to undercharge / overcharge of fares. (SR, ER and WR). Differences in distance between pair of stations for the same route in UTS and in the PRS were seen in CR and ER. Similarly in ECoR, the distances entered in the system were incorrect. The distance indicated from Bhubaneswar to Howrah via CTC-KGP-TATA-BSP-NZM was 2527 kilometers instead of 2327 kilometers as correctly shown in PRS resulting in excess charge of Rs.10 per ticket generated by UTS. Similarly, distance from BBS to MFP via KGP-HWH is shown as 1039 kilometers instead of 1152 kilometers as shown in the PRS resulting in the fare collected being lower by Rs.14 per ticket. ð* Discrepancies were noticed in the distances between the same pair of stations resulting in irregular computation of fare. In Danapur division of ECR, it was found that the fare from DHN to LKR was Rs.69 while the fare from LKR to DHN was Rs.73. In a simulation exercise done by audit, the system calculated a fare of Rs.101 from New Delhi to Panipat for sleeper class ticket whereas it was Rs.103 from Panipat to New Delhi though the distance recorded in the system was same in both directions (NR). Thus, there were differences in the fares chargeable as per business rules and those charged by the system and distances adopted between stations were incorrect leading to incorrect levy of fares from passengers. Recommendation IR should immediately rectify the fares and distances adopted in the system so as to be in accordance with the business rules and to ensure correct levy of fares from passengers.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 21, + "text": "Chapter 1 Unreserved Ticketing System in Indian Railways \n 21\n1.10.3 Inadequate validation of routes and blank paper tickets Unreserved tickets could only be issued for stations which have pre-defined routes in the route database. Audit observed that ð* Several routes were not defined in the database and therefore the journey tickets could not be issued for many stations through the system (SR, NEFR, ECR, NR, CR, ECoR and SER). In NEFR, some of the important routes involving stations viz. Ledo, Jorhat Town, Tihu etc. were not defined at New Tinsukia location. Similarly in NR, at least 60, 44 and 44 destination stations/routes originating from Lucknow, Bareilly and Raibareilly respectively were not defined in database and tickets to these destinations were prepared manually. Similar deficiencies were also noticed at Garhmukteshwar, Ambala city, Jalandhar city and Jalandhar Cantonment stations. In CR, it was observed that tickets from Lokmanya Tilak Terminus station to stations such as Raxual, Saharsa, Motihari, Singruli, Adra, Ulubaria, Farrukhabad and Fatehgarh could not be issued from the system. Further, train No. 6734 was introduced in November 2006. Since its route was not defined in the system, tickets for Manmad to Tirupati could not be done through the system despite heavy load of passengers on that route. ð* Blank paper tickets were also issued for stations whose routes were not specified in the system. However, there was no provision in the software to validate the distance between two stations where route is not defined. Recording the distance was left to the manual discretion of operators, which could result in an incorrect levy of fares from passengers. In a simulation exercise done by audit in ECR, it was observed that while generating a second class blank paper ticket from Samastipur to Yeliyur -a station in Bangalore division, the system even accepted a distance of 10 kilometers and generated ticket valuing Rs.16. Similarly, the system accepted a distance of 50 kilometers with fare of Rs.24 while preparing a ticket in ordinary class from Danapur to Kottayam in Tiruvananthapuram division. ð* Validation checks for issue of blank paper tickets were inadequate (ECoR and SER). Blank paper tickets could also be issued in respect of destination stations already defined in the system. Thus, while several routes were not defined in the system preventing issue of tickets to destinations, the validation controls for issue of blank paper tickets were also inadequate. Recommendation IR should assess the completeness of master data on priority and incorporate all routes in the database. The control mechanism for issue of blank paper tickets may also be strengthened.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 22, + "text": "Report No.PA 18 of 2008 (Railways) \n 22\n1.10.4 Inaccuracies in database Master tables contain the basic data based on which the transactions in computerised system are processed. Information contained in the electronic databases contained several deficiencies as detailed below: ð* A large number of duplicate station names in master stations table were found (ECoR, CR, NER and NR). For example, Ahmadpur Junction in ECR was having two station codes as ADP and AMP. Dehri-on-Sone was also appearing two times in the database having station code as DOS and DEI in Mughalsarai and Delhi divisions respectively. Conversely, it was observed in ER, that two stations (Kallayi in SR and Kulpi in ER) had the same station code \u0018KUL \u0019. ð* Incorrect station codes such as \u001cAAAA \u001d were found under Delhi division. Further, Delhi station had an incorrect station code as \u001cBBBB \u001d instead of \u001cDLI \u001d. Various meaningless entries such as XXXXXX, AAAA, BBBB, etc were also found in the master station table (CR, ECR, NER, SR and NR). ð* Additions of destination stations in master database were not being done as and when the stations were operational (CR, ECoR and SER). ð* As per extant provisions in the codes, traffic earnings are to be apportioned amongst various zones on the basis of local and foreign traffic. Stations lying on other zonal railways (foreign traffic) were improperly marked as local stations which resulted in wrong apportionment of earnings among different zones. (ECR, CR, WCR, SWR, NR, and NWR). ð* Date of journey was recorded as \u0018Null \u0019 in 52 records of the database while particulars like Station from, station to, transaction time etc. were recorded in database, indicating that the data stored was incomplete. (SR). ð* Dummy concession codes allowing negative concessions of minus 50 per cent and minus 200 per cent were seen. Further, the minimum age for availing senior citizen concession was recorded as 12 years in the database (ECR and SECR). ð* A comparison of daily statement of cancelled tickets on 21 November 2005 generated at New Delhi Railway station and zonal level statement of earnings of the same day indicated variations. While the number of tickets cancelled was indicated as 417 in the station level statement of New Delhi, the zonal statement indicated that the number of tickets cancelled at New Delhi station was 418. Similarly, station level statement indicated that net number of passengers booked were 44,548 whereas, as per zonal level statement, the figure was 44,544. Thus, output generated by the system was not reliable. Railway administration accepted the discrepancies (NR). Thus, station names were duplicated with different station codes, stations were wrongly specified and the database contained various inconsistencies casting doubts on its reliability.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 23, + "text": "Chapter 1 Unreserved Ticketing System in Indian Railways \n 23\nRecommendation IR should rectify the inaccuracies in the database to enhance reliability of data and to render generation of meaningful reports. 1.10.5 Inadequate controls in maintaining ticket roll continuity The system provides for generation of ticket roll continuity statement for verification of continuity of rolls on a daily or monthly basis and for ensuring proper accounting of tickets. A review of continuity statements generated by the system in various zones indicated the controls were inadequate as detailed below: ð* There was no continuity in sequence of ticket numbers at various UTS locations (Guwahati, Katihar, New Tinsukia and Dimapur) in NEFR. The monthly continuity statement of Khurda Road Station of March 2007 in ECoR revealed that there was no continuity in ticket numbers in five ticket rolls. Even in SER, the number of tickets sold as depicted by the system did not tally with the number of tickets sold when calculated with reference to the ticket serial numbers indicating gaps in the ticket roll continuity. In SR also it was observed from continuity statement for 18 May 2007 of Calicut station that the commencing number of one row in the statement was the same as the closing number of previous row. Similarly, one ticket number was missing in the continuity statement for 11 April 2007 of Tirupathur Junction station. ð* The continuity report of 20 November 2005 generated at New Delhi Railway Station (NR) revealed that ticket numbers from 007126001 to 007126090 were shown as used by two different operators. In CR also the continuity statements were not generated correctly on various occasions (Wadi, Karjat and Manmad stations). Similarly in ER, the continuity statements were erroneously generated in Santipur and Katwa stations where the ticket roll numbers appeared twice and their utilisation did not tally with the manual records maintained at these stations (Roll nos 17917 and 17943 of Santipur and 51626 of Katwa). ð* Further, it was also seen that in many locations the ticket numbers were not pre-printed, tickets were incorrectly numbered, excess tickets were available in the ticket rolls and tickets were of poor quality and in torn condition (CR, SECR, NCR, SCR, NR, NER and WR). Thus, the system was deficient in controls to monitor and check any fraudulent use of pre printed ticket stationery. There was no provision in the system to check the continuity of ticket rolls. Recommendations IR may strengthen its monitoring mechanism on use of the pre-printed ticket stationery. Validation checks may be built in the system to highlight cases of discontinuity in ticket rolls.", + "extraction_method": "text" + }, + { + "document_id": "circulars__Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_name": "Unreserved Ticketing System Chapter (CAG PDF).pdf", + "document_path": "circulars/Unreserved Ticketing System Chapter (CAG PDF).pdf", + "doc_category": "circular", + "rule_type": "unreserved_ticketing", + "priority": 3, + "authority": "Comptroller and Auditor General of India", + "description": "Audit chapter on Unreserved Ticketing System", + "is_static": false, + "effective_year": null, + "page_number": 24, + "text": "Report No.PA 18 of 2008 (Railways) \n 24\n1.11 Conclusion Indian Railways has implemented the Unreserved Ticketing System in phases in all the zones to harness the potential of Information Technology. The arrangements for acquisition through CRIS were predominantly characterised by delays and the communication channels provided by BSNL were frequently interrupted by extensive link failures. Indian Railways, however, did not have any structured mechanism in place to obtain minimum guaranteed services and consequently implementation of Unreserved Ticketing System over Indian Railways was delayed and provision of incessant services was hampered. The decision of the Indian Railways to acquire dot matrix printers for the locations covered in earlier phases, despite being aware of its vulnerabilities, rendered the system susceptible to misuse. The system was not comprehensively developed to encompass all the business rules requiring frequent manual interventions and thereby enhancing security risk apart from inconveniencing the passengers. The system was operated in an inadequately controlled environment as both physical and logical access controls were deficient, change management controls were weak and disaster recovery and business continuity plans were not formulated. Validation controls for issue of season tickets and cancellation of tickets were inadequate and the facility of cancellation of tickets for short destinations was prone to misuse. Fares and distances were incorrectly adopted leading to incorrect levy of fares from passengers. Master data was incomplete and contained inaccuracies. The control mechanism on use of ticket rolls was also deficient and there was ample scope for improvement.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2013__REFUND RULES wef 1-Jul-13.pdf", + "document_name": "REFUND RULES wef 1-Jul-13.pdf", + "document_path": "circulars/2013/REFUND RULES wef 1-Jul-13.pdf", + "doc_category": "circular", + "rule_type": "refund", + "priority": 2, + "authority": "IRCTC / Railway Board", + "description": "Refund rules effective from 1 July 2013", + "is_static": false, + "effective_year": 2013, + "page_number": 1, + "text": "Refund Rules and TDR Filing w.e.f 01-JULY-2013 \n \nAuthority:- Railway Board letter No.TCII/2003/12/Refund Policy dated 14 Jun 2013 – The \nGazette Of India Notification Dated 07.06.2013. Refer Alert & Update section on irctc.co.in \n \n \nTicket Booking/cancellation Hours: 00.30 HRS to 23.30 HRS \n \nIRCTC Service Charges for I-Ticket (Service charge levied is not Refundable):- \n \n \nClass Service Charge \n \nSleeper Class/Second Class (SL/2S) Rs.80/- per ticket plus service Tax \n \nHigher Class Rs.120/- per ticket plus service Tax \n(1AC,2AC,3AC,CC,3E,FC,EC) \n \n \nIRCTC Service Charges for E-Ticket (Service charge levied is not Refundable):- \n \nClass Service Charge \n \nSleeper Class/Second Class (SL/2S) Rs.20/- per ticket plus service Tax \n \nHigher Class Rs.40/- per ticket plus service Tax \n(1AC,2AC,3AC,CC,3E,FC,EC) \n \n \nRefund Rules:- \n \nReservation Failed Transaction:- \n \nIf amount getting debited from customer account and ticket not issued, IRCTC will refund the entire Fare and \nIRCTC service charges electronically(as credit to the relevant credit /debit card account used for the \ntransaction), but the bank/card transaction charges are likely to be forfeited. \n \nIRCTC's payment reconciliation team works on a 24 x 7 basis, IRCTC offers no guarantees whatsoever for the \naccuracy or timeliness of the refunds reaching the Customers card/bank accounts. This is on account of the \nmultiplicity of organizations involved in processing of online transactions, the problems with Internet \ninfrastructure currently available and working days/holidays of financial institutions. \n \nCancellation before Chart Preparation:- \n \nAll refund will be processed as per Extant Railway Rules: \n \nA. Cancellation Charges for Confirmed Tickets:- \n \nThe amount deducted is based on the time of cancellation and the status of your ticket. \nDetailed explanations are given below:- \n \n(a) If the ticket is presented for cancel lation more than forty eight hours in advance of the \nscheduled departure of the train:-", + "extraction_method": "text" + }, + { + "document_id": "circulars__2013__REFUND RULES wef 1-Jul-13.pdf", + "document_name": "REFUND RULES wef 1-Jul-13.pdf", + "document_path": "circulars/2013/REFUND RULES wef 1-Jul-13.pdf", + "doc_category": "circular", + "rule_type": "refund", + "priority": 2, + "authority": "IRCTC / Railway Board", + "description": "Refund rules effective from 1 July 2013", + "is_static": false, + "effective_year": 2013, + "page_number": 2, + "text": "Class of your ticket Flat Cancellation charges per \n \n passenger \n \n \nAC First/Executive Class Rs.120 \n \n \nFirst Class/AC 2 Tier Rs.100 \n \n \nAC Chair Car/AC 3Tier/AC 3 Economy Rs.90 \n \n \n \nSleeper Class Rs.60 \n \n \nSecond Class Rs.30 \n \n \n \n \nIf the ticket is presented for cancellation 25%(twenty five) percent of fare subject \n \nbetween forty eight hours and upto six the minimum of the cancellation charge \n \nhours before the scheduled departure of referred to in clause A(a) \n \nthe train \n \n \nIf the ticket is presented for cancellation 50%(Fifty) percent of fare subject to a \n \nwithin six hours before the scheduled minimum of the cancellation charge \n \ndeparture of the train and upto two hours referred clause A(a) \n \n \nafter the actual departure of the train \n \nirrespective of distance \n \n \n \n \n \nNote: No refund shall be granted on reserved ticket if its surrendered for cancellation \nafter two hours of the actual departure of the train \n \nB. Cancellation Charges for Partially Confirmed:- \n \n \nThe amount deducted is based on the time of cancellation and the status of your \nticket. Detailed explanations are given below:- \n \n(a) If the ticket is presented for cancellation more than forty eight hours in advance of \nthe scheduled departure of the train:- \n \nClass of your ticket Flat Cancellation charges RAC/Waitlist \n per passenger in Rupees for Ticket clerkage \n confirmed passenger charge per \n passenger \n \nAC First/Executive Class Rs.120 Rs.30 \n \nFirst Class/AC 2 Tier Rs.100 Rs.30 \n \nAC Chair Car/AC 3Tier/AC 3 Rs.90 Rs.30 \nEconomy \nSleeper Class Rs.60 Rs.30 \n \nSecond Class Rs.30 Rs.30", + "extraction_method": "text" + }, + { + "document_id": "circulars__2013__REFUND RULES wef 1-Jul-13.pdf", + "document_name": "REFUND RULES wef 1-Jul-13.pdf", + "document_path": "circulars/2013/REFUND RULES wef 1-Jul-13.pdf", + "doc_category": "circular", + "rule_type": "refund", + "priority": 2, + "authority": "IRCTC / Railway Board", + "description": "Refund rules effective from 1 July 2013", + "is_static": false, + "effective_year": 2013, + "page_number": 3, + "text": "If the ticket is presented for If the ticket is presented for \n \ncancellation betw een forty eight hours cancellation within six hours before the \n \nand upto six hours before the scheduled departure of the train and \n \nscheduled departure of the train upto two hours after the actual \n \n departure of the train irrespective of \n \n distance \n \n25%(twenty five) percent of fare subject Some passenger All passengers \n \nthe minimum of the cancellation charge cancelled cancelled \n \nreferred to in clause B(a) for confirmed \n \npassenger \n \n50%(Fifty) \n \n \n percent of fare \n \n subject to a \n \n minimum of the Clerkage charge \n \n \ncancellation \n \n Rs.30 per passenger \n \n \ncharge referred \n \n for all passenger \n \n \n clause B(a) for including confirmed \n \n confirmed passengers \n \n passenger \n \n \n \nClerkage charge Rs.30 per passenger for Clerkage charge \n \nRAC/WAIT LIST Passenger Rs.30 per \n \n passenger for \n \n RAC/WAIT LIST \n \n Passenger \n \n \n \n \nNote: No refund shall be granted on Partially confirmed ticket against which none of the \npassengers has travelled, if it is surrendered /TDR filed two(2) Hours after actual departure of the \ntrain. \n \n \nC. Cancellation Charges for RAC/Waitlisted Tickets:- \n \nUpto three (3) Hours actual departure Clerkage charge Rs.30 per passenger of \ntrain \n \nNote: (1) Where confirmed reservation has been provided to RAC or Waitlisted ticket holder at any time \nupto final preparation of charts, such ticket shall be treated as confirmed/partially confirmed and \ncancellation charges shall be payable as applicable to confirmed/partially confirmed tickets. \n \n(2) No refund shall be granted on RAC/WAITLISTED TICKET against which none of the \npassengers has travelled, if it is surrendered /TDR filed three(3) Hours after actual departure of the train.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2013__REFUND RULES wef 1-Jul-13.pdf", + "document_name": "REFUND RULES wef 1-Jul-13.pdf", + "document_path": "circulars/2013/REFUND RULES wef 1-Jul-13.pdf", + "doc_category": "circular", + "rule_type": "refund", + "priority": 2, + "authority": "IRCTC / Railway Board", + "description": "Refund rules effective from 1 July 2013", + "is_static": false, + "effective_year": 2013, + "page_number": 4, + "text": "(D) Train Running More than Three hours Late:- \n \nFull refund is permissible if refund is obtained/online TDR filed before actual departure of the train. \nNo refund is admissible if ticket is cancelled/online TDR is filed after actual departure of the train. \n \n(E) Cancellation in case of trains cancelled:- \n \nI- Ticket - The Ticket can be cancelled upto 72 hrs after the scheduled departure of train at any \ncomputerized reservation counter \n \nE-Ticket – The Ticket can be cancelled online or TDR can be filed upto 72 hrs after the scheduled \ndeparture of train \n \n(F) TATKAL Tickets \n(i) Confirmed Ticket : No Refund \n(ii) RAC/WAITLISTED TICKET : \n Upto three (3) Hours actual departure of Clerkage charge Rs.30 per passenger \n train \n \n \nNote: (1) Where confirmed reservation has been provided to RAC or Waitlisted ticket holder at any time \nupto final preparation of charts, such ticket shall be treated as confirmed/partially confirmed and \ncancellation charges shall be payable as applicable to confirmed/partially confirmed tickets. \n \n(2) No refund shall be granted on RAC/WAITLISTED TICKET against which none of the \npassengers has travelled, if it is surrendered /TDR filed three(3) Hours after actual departure of the train. \n \n \n(iii) Partially Confirmed Ticket:- \n \nMore Than 6(six) hours before schedule Confirmed Ticket – No Refund \ndeparture of Train RAC/Waitlist Ticket - Clerkage charge \n Rs.30 per passenger \n \nWithin 6(six) hours before the scheduled ALL PASSENGER CANCELLED \ndeparture of the train or upto two hours Clerkage charge Rs.30 per passenger for \nof the actual departure of the train all passengers including confirmed \n passenger \n \n \n \nNote:- No refund shall be granted on Partially confirmed ticket against which none of the passengers \nhas travelled, if it is surrendered /TDR filed two(2) Hours after actual departure of the train. \n \n(G) Ticket booked in Premium Special Trains \n \n1.Cancellation of CNF/RAC ticket booked in Premium Special Trains is not allowed. However, ticket can \nbe cancelled only if the train is cancelled. Refund will be granted by PRS system as per extant Railway \nRefund Rules.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2013__REFUND RULES wef 1-Jul-13.pdf", + "document_name": "REFUND RULES wef 1-Jul-13.pdf", + "document_path": "circulars/2013/REFUND RULES wef 1-Jul-13.pdf", + "doc_category": "circular", + "rule_type": "refund", + "priority": 2, + "authority": "IRCTC / Railway Board", + "description": "Refund rules effective from 1 July 2013", + "is_static": false, + "effective_year": 2013, + "page_number": 5, + "text": "CANCELLATION OF E-TICKETS \n \n(1) E-Ticket can be cancelled online till preparation of charts and refund will be granted by PRS \nsystem as per extant Railway Refund Rules. \n \n(2) After preparation of charts, the user shall have to file online TDR for claiming refund . The \nrefund case will be decided by Railways. The TDR can be filed by the same user who books the ticket. \nAfter receipt of the refund amount from Railway, it shall be credited in the same account through which \nbooking was made through opted payment gateway. \n \n(3) In case of WAITLISTED E-Tickets on which status of ALL PASSENGERS are on waiting list \neven after preparation of charts, names of all passengers booked on that PNR shall be dropped from the \nreservation charts and refund amount shall be credited in the same account through which booking was \nmade through opted payment gateway. \n \n(4) In case of partial RAC/ WAITLISTED E -Tickets, the user can obtain online refund upto chart \npreparation. There after the user has to file online TDR if some of the passenger/s remains on RAC. \n \n(5) No refund shall be granted on confirmed E -Ticket if online TDR is filed two (2) Hours after \nactual departure of the train. \n \n(6) No refund shall be granted on partially confirmed E-Ticket against which none of the passengers \nhas travelled, if TDR is filed two (2) Hours after actual departure of the train. \n \n(7) No refund shall be granted on Partial RAC/WAITLISTED TICKET against which none of the \npassengers has travelled, if TDR is filed three (3) Hours after actual departure of the train. \n \n(8) No refund will be granted in case of train running more than three hours late if TDR is filled with \nthis reason after actual departure of the train. \n \n(9) In case of E-Ticket issued for travel of more than one passenger, some passengers have confirmed \nreservation and others are on RAC or Waiting list, then in case of passengers on RAC/ Waiting list not \ntravelling, A CERTIFICATE HAS TO BE OBTAINED FROM THE TTE(Ticket checking staff) to that \neffect and online TDR shall have to be filed within seventy two(72) hours after actual arrival of the train \nat passenger’s destination indicating the details of the certificate issued. The certificate shall be sent to \nGroup General Manager/IT, Indian Railway Catering and Tourism Corporation Ltd., Internet \nTicketing Centre, IRCA Building, State Entry Road, New Delhi – 110055 \n \n(10) The cases in which TDR are filed are decided by the Zonal Railway under whose jurisdiction the \ntrain destination falls. After receipt of the refund amount from the said Railway, refund amount will be \ncredited back to same account through which payment was made through opted payment Gateway. \n \n(11) If customer is not able to cancel through web interface before Chart Preparation, customers are \nrequested to send their request through offline cancellation the link is available left navigation under \nheading of My Transactions or the user has to send an email from the email ID to etickets@irctc.co.in \nfrom their registered e-mail id with IRCTC", + "extraction_method": "text" + }, + { + "document_id": "circulars__2013__REFUND RULES wef 1-Jul-13.pdf", + "document_name": "REFUND RULES wef 1-Jul-13.pdf", + "document_path": "circulars/2013/REFUND RULES wef 1-Jul-13.pdf", + "doc_category": "circular", + "rule_type": "refund", + "priority": 2, + "authority": "IRCTC / Railway Board", + "description": "Refund rules effective from 1 July 2013", + "is_static": false, + "effective_year": 2013, + "page_number": 6, + "text": "CANCELLATION OF I-TICKETS \n \n(1) The tickets cannot be cancelled online. \n \n(2) The tickets can be cancelled at any PRS counter. For the night trains leaving between 21.00 hours \nand 06.00 hours(actual departure) cancellation shall be admissible at the station within first two hours \nafter the opening of reservation office, in case no current counters are available at the station originating \nthe journey. \n \n(3) There will be no refund in cash at the PRS counter. IRCTC will credit the refund amount in the \nsame account through which booking was made through opted payment gateway. \n \n(4) In case TDR has to be obtained for claiming refund, it will be obtained from the Railway Station. \n \n(4) Prefer the claim for refund to the following address attaching the original copy of the Ticket Deposit \nReceipt and other documents/certificate etc., \n \nGroup General Manager/IT, Indian Railway Catering and Tourism Corporation Ltd., Internet \nTicketing Centre, IRCA Building, State Entry Road, New Delhi – 110055 \n \n(5) The cases in which TDR are filed are decided by the Zonal Railway under whose jurisdiction the TDR \nis issued. After receipt of the refund amount from the said Railway, refund amount will be credited back \nto same account through which payment was made through opted payment Gateway \n \nTDR Filing for Agent:- \n \nThe Authorized Agents of IRCTC cannot file TDRs online. They have to send a mail to IRCTC for filing \nTDR. The customers who have to claim refund against the tickets purchased through the Agents should \napproach to the concerned Agent for filing TDR. It should be kept in mind the Railways decide refund \ncases as per extent Railway Refund Rules. As such it should be ensure that the TDRs are filed within the \nprescribed time limits. \n \nWhenever Agents receive such requests from their customers, they are required to send a mail to IRCTC \nat nominated e-mail id, provided by IRCTC through their registered e-mail id containing following details \nwithin prescribed time. If any TDR request is received at other than nominated email id or from other than \nregistered e mail id, IRCTC shall not be entertain the same. \n \nPNR: Quota Tatkal/General \n \nTrain No. Journey Date \n \nPartly/Fully Confirmed \n \nSl No. Passenger Name Age Sex Reason for TDR \n \n1. \n \n2. \n \n3.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2013__REFUND RULES wef 1-Jul-13.pdf", + "document_name": "REFUND RULES wef 1-Jul-13.pdf", + "document_path": "circulars/2013/REFUND RULES wef 1-Jul-13.pdf", + "doc_category": "circular", + "rule_type": "refund", + "priority": 2, + "authority": "IRCTC / Railway Board", + "description": "Refund rules effective from 1 July 2013", + "is_static": false, + "effective_year": 2013, + "page_number": 7, + "text": "4. \n5. \n6. \n \n \n \nThe agent will obtain written request from the customer for refund for record purpose as proof that the \ncustomer has preferred claim for refund. \n \nThe cases in which TDR are filed are decided by the Zonal Railway under whose jurisdiction the train \ndestination falls. After receipt of the refund amount from the said Railway, refund amount will be credited \nback to same account of the Agent through which payment was made.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2015__CancellationRulesforIRCTCTrain.pdf", + "document_name": "CancellationRulesforIRCTCTrain.pdf", + "document_path": "circulars/2015/CancellationRulesforIRCTCTrain.pdf", + "doc_category": "circular", + "rule_type": "cancellation", + "priority": 2, + "authority": "IRCTC", + "description": "Cancellation rules applicable to IRCTC train tickets", + "is_static": false, + "effective_year": 2015, + "page_number": 1, + "text": "Cancellation and Refund Rules for IRCTC Trains \n \nE-Ticket booked for IRCTC Trains can be cancelled online and refund will be granted by the \nsystem as per IRCTC Refund Rules, as follows: \n1. Cancellation Charges for Confirmed Tickets \nThe amount deducted is based on the time of cancellation and the status of your ticket at \nthe time of cancellation. Detailed explanations are given below: \na) If a confirmed ticket is cancelled online more than forty-eight (48) hours in advance \nof the scheduled departure of the tra in, a minimum per passenger cancellation charges \nshall be deducted at the flat rate as below: \n \nClass of Your Ticket Flat Cancellation Charges per Passenger \nExecutive Class (EC) ₹240/- +GST \nAC Chair Car (CC) ₹180/- +GST \n \nb) If a confirmed ticket is cancelled online between forty -eight hours (48) and up to \ntwelve (12) hours before the scheduled departure of the train, cancellation charges \nwill be deducted as follows: \n \n25%(Twenty Five percent) of the fare subject to the minimum cancellation c harge \nreferred to in clause 1(a) plus GST applicable for all AC Classes \n \nc) If a confirmed ticket is cancelled online within twelve (12) hours and up to four hours \nbefore the scheduled departure of the train, cancellation charges will be deducted as \nfollows: \n \n50%(Fifty percent) of the fare subject to the minimum cancellation charge referred \nto in clause 1(a) ) plus GST applicable for all AC Classes \n \nd) No refund of fare shall be admissible on the ticket s having confirmed reservation in \ncase ticket is not cancelled online or TDR not filed online up to four hours before the \nscheduled departure of the train \n \n2. Cancellation Charges for Waitlisted Tickets \na) In case a wait -listed ticket is cancelled online , the r efund of fare shall be made after \ndeducting the cancellation charge of ₹ 20/- +GST per passenger, if the ticket is cancelled \nonline up to four hours before the Scheduled Departure of the Train. \n \nb) If all passengers on a ticket remain on waiting list after first charting , user need not \ncancel such tickets. Such tickets will be cancelled automatically through the system, and \nthe full refund will be credited back, without deducting any cancellation.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2015__CancellationRulesforIRCTCTrain.pdf", + "document_name": "CancellationRulesforIRCTCTrain.pdf", + "document_path": "circulars/2015/CancellationRulesforIRCTCTrain.pdf", + "doc_category": "circular", + "rule_type": "cancellation", + "priority": 2, + "authority": "IRCTC", + "description": "Cancellation rules applicable to IRCTC train tickets", + "is_static": false, + "effective_year": 2015, + "page_number": 2, + "text": "3. Cancellation Charges for Partially Confirmed Tickets \na) In case, on a party e -ticket or a family e -ticket issued for travel of more than one \npassenger, some passengers have confirmed reservation and others are on waiting list, \nfull refund of fare, less cancellation charge of ₹ 20/- +GST per passenger, shall b e \nadmissible for confirmed passengers also subject to the condition that the ticket shall be \ncancelled online or online TDR shall be filed for all the passengers up to four hours before \nthe Scheduled Departure of the Train. \n \nb) In case, on a party e -ticket or a family e -ticket issued for travel of more than one \npassenger, some passengers have confirmed reservation and others are on waiting list, \nfull refund of fare without deducting cancellation, shall be admissible for confirmed \npassengers also subject to the condition that the ticket shall be cancelled online or online \nTDR shall be filed for all the passengers after first charting and up to thirty minutes \nbefore the scheduled departure of the train. \n \nc) In case of party e-ticket or family e-ticket issued for travel of more than one passenger, \nsome passengers have confirmed reservation and others are on the list of waiting list, \nthen in case of passengers in waiting list not travelling, a certificate shall be obtained by \ntravelling passengers from the ticket checking staff to that effect and refund of fare shall \nbe processed online through TDR, indicating the details of the certificate issued by ticket \nchecking staff and the online TDR shall be filed up to seventy-two (72) hours of actual \narrival of the train at passengers' destination and the original certificate issued by ticket \nchecking staff shall be sent through post to Group General Manager/IT, Indian Railway \nCatering and Tourism Corporation Ltd., Internet Ticketing Centre, IRCA Building, State \nEntry Road, New Delhi – 110055 \n \n4. Cancellation Charges for Wait List Tickets Dropped from Charting \nIn case of wait-listed e-tickets on which all the passengers are on waiting list even after \npreparation of reservation chart, names of all such passengers booked on that Passenger \nName Record (PNR) will be dropped from the reservation chart and refund of full fare \nwill be credited back to the account from which booking transaction took place, without \ndeducting any cancellation charges. \n \n5. Cancellation Charges for Full Cancellation of Train (from originating station to \ndestination station) \nIn case of full cancellation of trains from source to destination , automatic full refund of \nfare on confirmed e -tickets will be directly credited back to the account from which \nbooking transaction took place, and online cancellation or filing of TDR is not required in \nsuch cases for use₹ \n6. Cancellation Charges for Partial Cancellation of Train \nIn case of partial train cancellation, train diverted, train short terminated etc., TDR is \nrequired to be filed online up to Seventy Two Hours of the Scheduled Departure of the \nTrain at Passenger’s Boarding Station.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2015__CancellationRulesforIRCTCTrain.pdf", + "document_name": "CancellationRulesforIRCTCTrain.pdf", + "document_path": "circulars/2015/CancellationRulesforIRCTCTrain.pdf", + "doc_category": "circular", + "rule_type": "cancellation", + "priority": 2, + "authority": "IRCTC", + "description": "Cancellation rules applicable to IRCTC train tickets", + "is_static": false, + "effective_year": 2015, + "page_number": 3, + "text": "7. Cancellation Charges for Train Running More than 3 Hours Late and Passenger not \ntravelled \nNo cancellation charge will be levied and full fare will be refunded back to all passengers \nholding fully or partially confirmed tickets , if the journey is not undertaken due to late \nrunning of the train by more than three hours of the scheduled departure of the train \nfrom the station commencing journey subject to the condition that: \n \ni. Train is running late by more than three hours at the passenger boarding station. \nii. TDR is filed online before the actual departure of the train, for availing full refund. \niii. All passengers booked on a PNR have not travelled. \n \nIn case the ticket is cancelled , or if the request for refund of fare is filed online after the \nactual departure of train, No refund of fare will be admissible. \n \n8. TDR filing for IRCTC Trains (Rules & Validations) \nS. No. TDR Filing Reasons Time Limit/Rules \n1 Train late more than three hours and \npassenger Not travelled \nUp to the actual departure time of the train \nat Boarding Station. \n2 Difference Of Fare In Case proper \nCoach Not Attached. (passenger has \nto travel in lower class) \nUp to 2 days (Excluding the day of issue of \nthe certificate) \n3 AC Failure Within 20 hours of actual arrival time of \nthe train at Passenger’s Destination \nStation. \n4 All Confirmed Passenger Not \nTravelled \nUp to 4 hours before the Schedule \nDeparture time of the train at Passenger’s \nBoarding Station. \n5 Train Diverted and Passenger Not \nTravelled \nUp to 72 hours from Schedule Departure of \nthe Train from Passenger's Boarding \nStation \n6 Train Diverted and Train not \ntouching Boarding Station \nUp to 72 hours from Schedule Departure \ntime of the train at Passenger's Boarding \nStation. \n7 Train Diverted and train not touching \nDestination Station \nUp to 72 hours from Schedule Departure \ntime of the train at Passenger's Boarding \nStation. \n9 Party Partially Confirm/Waitlist & \nWaitlisted Passengers Did Not Travel \nUp to 72 hours of actual Arrival Time of the \nTrain at Passenger’s Destination Station. \n10 Party Partially Confirmed/Waitlisted \nAnd All Passengers Did Not Travel. \nUp to 30 Minutes before the Schedule \nDeparture Time of the Train at Passenger's \nBoarding Station. \n11 Difference of Fare as Passenger \nTravelled in Lower Class \nUp to 2 days (Excluding the day of issue of \nthe certificate) \n12 Party Partially Travelled (Refund on \nPartially Used Ticket) \nUp to 72 hours from Schedule Departure \nTime of the Train at Passenger's Boarding \nStation.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2015__CancellationRulesforIRCTCTrain.pdf", + "document_name": "CancellationRulesforIRCTCTrain.pdf", + "document_path": "circulars/2015/CancellationRulesforIRCTCTrain.pdf", + "doc_category": "circular", + "rule_type": "cancellation", + "priority": 2, + "authority": "IRCTC", + "description": "Cancellation rules applicable to IRCTC train tickets", + "is_static": false, + "effective_year": 2015, + "page_number": 4, + "text": "Connecting Train ticket booking not allowed on IRCTC trains. As such no refund is applicable \non connecting journey tickets. \n \nExisting TDR filing rules may be found here: http://contents.irctc.co.in/en/Refundrule2015.pdf \n \n \n \n \n \n \n13 Passenger Not Travelled as \nReservation provided in Lower class \nWithin 3 Hours from the Actual Departure \nTime of the train at Passenger's Boarding \nStation \n14 Passenger Not travelled Due To \nCoach Damage \nWithin 3 Hours from the Actual Departure \nTime of the train at Passenger's Boarding \nStation \n15 Train Terminated Short of \nDestination \nTDR shall be filed up to 72 hours of the \nScheduled Arrival of the Train at \nPassenger’s Destination.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 1, + "text": "MINISTRY OF RAILWAYS \n(Railway Board) \n \nNOTIFICATION \n \nNew Delhi the 28th August, 2023 \n \nThe Railways (Opening for Public Carriage of Passengers) Rules, 2023 \n \nG.S.R. 633(E)- In exercise of the powers conferred by section 198 of the Railways Act, 1989 \n(24 of 1989), the Central Government hereby makes the following rules, namely:- \n \nCHAPTER I \nPRELIMINARY \n1. Short ti tle, commencement and application - (1) These rules may be called the \nRailways (Opening for Public Carriage of Passengers) Rules, 2023. \n(2) They shall come into force on the date of their publication in the Official Gazette. \n(3) They shall apply to Government railways and also to non-government railways. \n \n2. Definitions – In these rules, unless the context otherwise requires, - \n(a) “Act” means the Railways Act, 1989 (24 of 1989); \n(b) “Bridge Engineer” means the Chief Engineer, the Deputy Chief Engineer \n(bridges) or any other engineer responsible for the construction and design of \nbridges ; \n(c) “Commissioner” means the Chief Commissioner of Railway Safety or a \nCommissioner of Railway Safety appointed under section 5; \n(d) “Carriage” means the carriage of passengers or goods by a railway \nadministration; \n(e) “Form” means a form appended to these rules; \n(f) “General Manager” means,- \n(i) In case of a Government railway, the General Mana ger of a Zonal Railway \nappointed under section 4 and includes the Chief Administrative Officer, \nthe Chief Project Manager or any other officer, not below the rank of Under \nSecretary to the Government of India, who is the Head of the Department \nand to whom the powers of the General Manager have been delegated by \ngeneral or special order under section 28; and \n(ii) In the case of a non -Government railway, the person who is the Chief \nExecutive of that railway, by whatever name called and such other officer \nof that r ailway to whom the powers of the Chief Executive have been \ndelegated; \n(g) “General Rules” means the Indian Railways (Open Lines) General Rules, 1976, \nas amended by the Indian Railways (Open Lines) General Amendment Rule s, \n1991; \n(h) “Government railway” means a railway owned by the Central Government; \n(i) “Inspection Report” means the inspection report of the Commissioner given \nunder rule 18; \n(ia) “Important bridges” means those bridges having a linear waterway of 300 metres \nor a total waterway of 1000 sqm or more and those classified as important by the", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 2, + "text": "Chief Engineer or Chief Bridge Engineer, depending on considerations such as \ndepth of waterway, extent of river training works and maintenance problems;’; \n(j) ‘level crossing’ means an inter -section of a road w ith lines of rails at the same \nlevel; \n(ja) “Major bridges” means those bridges having a total linear waterway of 18 metres \nor more or having a clear opening of 12 linear metres or more in any one span; \n(jb) “Minor bridges” means those bridges which are n either “Important bridges” nor \n“Major bridges”;’ \n(k) “non-Government railway” means a railway other than a Government railway; \n(l) “passenger” means a person travelling with a valid pass or ticket; \n(m) “railway” means a railway, or any portion of a railway, for the pu blic carriage of \npassengers or goods, and includes – \n(1) All lands within the fences or other boundary marks indicating the limits of \nthe land appurtenant to a railway; \n(2) All lines of rails, sidings, yards, branches used for the purposes of, or in \nconnection with, a railway and includes bridges over which lines of rails \npasses; \n(3) All electric traction equipment, power supply and distribution installations \nused for the purposes of or in connection with, a railway; \n(4) All rolling stock, stations, offices, warehouses, wharvs, workshops, \nmanufactories, fixed plant and machinery, roads and streets, running rooms, \nrest houses, institutes, hospitals, waterworks and water supply installations, \nstaff dwellings and any other works constructed for the purpose of, or in \nconnection with, railway; \n(5) All vehicles which are used on any road for the purposes of traffic of a \nrailway and owned, hired or worked by a railway; and \n(6) All ferries, ships, boats and rafts which are used on any can al, river, lake or \nother navigable inland waters for the purposes of the traffic of railway and \nowned, hired or worked by a railway administration, but does not include – \n(A) A tramway wholly within a municipal area; and \n(B) Lines of rails built in any exhibition ground, fair park, or any other \n place solely for the purpose of recreation; \nExplanation- For the purpose of these rules, “railway” shall include newly \nbuilt railway lines, either as extension of an existing railway, or as double \nor multiple lines alongside an existing one, conversion of railway from one \ngauge to another, restoration of abandoned lines, the use of electric motive \npower or change of traction from Direct Current(DC) to Alternate \nCurrent(AC) on an existing line; \n(n) “railway administration”, in relation to- \n(a) A Government railway, means the Genera l Manager of the Zonal Railway; \nand \n(b) A non-Government railway, means the person who is the owner or lessee of \nthe railway or the person working the railway under an agreement and \nincludes the Chief Executive of that railway by whatever name called; \n(o) “railway servant” means any person employed by the Central Government or by \nany railway administration in connection with the service of any railway; \n(p) “rolling stock” includes locomotives, tender, carriages, wagons, rail -cars, \ncontainers, trucks, trolleys and vehicles of all kinds moving on rails;", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 3, + "text": "(q) “section”, means a section of the Act; \n(r) “Schedule” means a Schedule annexed to these rules; \n(s) “traffic” includes rolling stock of every description as well as passengers and \ngoods; \n(t) “Zonal Railway” means a Zonal railway consti tuted under section 3 and in the \ncase of a non -Government railway such division or section of that railway as the \nCentral Government may, in consultation with that railway, notify; \n(u) All other words and expressions used in these rules, but not defined shall have the \nsame meanings, respectively assigned to them in the Act and in the Indian \nRailways(Open Lines) General Rules, 1976. \n \nCHAPTER II \nPREPARATION FOR OPENING OF RAILWAYS \n \n3. Reference to the Commissioner - (1) Every Railway Administration shall ensure that \nthe railway line or a portion thereof to be opened for public carriage of passengers is \ncomplete in all respects as per the Indian Railway Standard Codes and Manuals of \npractice or as per the Codes and Manuals of Practice as specifically approved by \nCentral Government for that Railway and for such opening all the administrative \nformalities are complete and that the working of the railway is regulated by the Indian \nRailways (Open Lines) General Rules, 1976 or any other General Rule as approved by \nthe Central Government and notified in the Gazette of Indian. \n \n(2) The Chief Executive of the railway administration of a non -Government railway, \nbefore making a reference to the Commissioner under sub -rule(3) for inspection of any \nrailway, shall obtain a clearance from the Central Government that the railway which is \nsought to be opened has been constructed and maintained by that administration in \naccordance with the Indian Railways Standard Codes and Manuals of Practice and the \nworking of the railway is governed by the Indian Railways(Open Lines) General \nRules,1976. \n \n(3) Where the General manager of a Zonal Railway, or Chief Executive of a non - \nGovernment railway is of the opinion that any railway or part thereof is required to be \nopened for public carriage of passe ngers, he shall refer the matter to the Commissioner \nfor inspection and report on the safety of that railway. \nProviso: Provided that, the following matters are not required to be referred to the \nCommissioner, as specified in Form XVI A or Form XVI B, namely:- \n(a) c onstruction, rebuilding, modification and strengthening of foot -over-bridges and \nroad-over-bridges; \n(b) construction, rebuilding, regirdering and strengthening of minor bridges; \n(c) regirdering and strengthening of all existing bridges, other than minor bridges; \n(d) elimination of manned level crossing; \n(e) upgradation of Level crossing, including interlocking outside station limits; \n(f) introduction of Electric Traction; \n(g) work related to Dedicated Freight Corridor. \n(h) introduction of Do uble Distant Signalling alongwith corresponding changes at \nadjacent stations without yard remodelling;", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 4, + "text": "(i) introduction of new Intermediate Block Signaling, except in section with Slip \nSiding and Catch Siding, alongwith corresponding changes at adjacent s tations \nwithout yard remodelling; and \n(j) introduction of new Automatic Block Signaling, except in section with Slip Siding \nand Catch Siding, alongwith corresponding changes at adjacent s tations without \nyard remodeling. \n \n4. Supply of certain documents to Commissioner- (1) The General Manager of a Zonal \nRailway or the Chief Executive of the non-Government railway while making reference \nto the Commissioner for inspection under sub rule(2) of rule 3, shall furnish all relevant \ndocuments to the Commissioner one month before the date on which a railway line or a \nsection of a railway line is prop osed for opening by the railway from the following list \nof documents, namely:- \n(a) Tabulated details; \n(b) Index Plan and Section of railway; \n(c) Drawings of works; \n(d) List of questions and answers; \n(e) Certificates; \n(f) List of infringements of Maximum and Minimum Dimensions; \n(g) Working orders to be enforced at each station; and \n(h) Administrative note giving the salient features of the project. \n(2) The documents referred to in sub -rule (1) shall indicate the distances from the same \n“fixed point”, in kilometers and decimals up to two digits and the fixed point shall be \nclearly defined in a Note and on the Plan and Section sheets of the work documents. \n(3) The datum adopted shall be “Mean Sea Level” as fixed by the Survey of Indian and \nall heights shall be mentioned with reference to the datum in meters and decimals up to \ntwo digits. \n4A. Supply of documents to Principal Chief Engineer or Principal Chief Electrical \nEngineer or Principal Chief Signal and Telecommunication Engineer - For matters \nrelating to items (a) to (g) specified in proviso to sub -rule (3) of rule 3, documents \nmentioned in rule 4 as relevant to specific matter, shall be submitted to the Principal \nChief Engineer or Principal Chief El ectrical Engineer or Principal Chief Signal and \nTelecommunication Engineer of Zonal Railway by concerned Senior Administrative \nGrade officer, as the case may be.” \n4B. Supply of documents to General Manager - For matters relating to items (h) to (j) \nspecified in proviso to sub -rule (3) of rule 3 and documents mentioned in rule 4 as \nrelevant to specific matter, shall be submitted to the General Manager by concerned \nHigher Administrative Grade Officer of Zonal Railway, who shall provide the \ncertificate as specified in Form XVI B to the General Manager. \n5. Contents of documents to be supplied to Commissioner – The documents referred to \nin rule 4 shall contain the details as specified below:- \n(1) Tabulated details which shall consist of important characteristics of the railway or \na portion of railway to be opened for public carriage of passengers and in \nparticular include – \n(a) Curve abstract as specified in Form I; \n(b) Gradient abstract as specified in Form II;", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 5, + "text": "(c) Bridge abstract as specified in Form III; \n(d) Important bridges – particulars of waterway and construction as specified in \nForm IV; \n(e) Ballast and Permanent Way as specified in Form V; \n(f) Stations and station sites as specified in Form VI; \n(g) Station accommodation as specified in Form VII; \n(h) Station machinery as specified in Form VIII; \n(i) Level crossing abstract as specified in Form IX; \n(j) Brief particulars of traction installations as specified in Form X; \n(k) Power supply installation abstract as specified in Form XI; \n(l) Traction maintenance depot abstract as specified in Form XII; \n(m) Restricted Over Head Equipment clearances abstract as specified in Form \nXIII; and \n(n) Electrical crossing over railway track abstract as specified in For XIV. \n(2) Index Plan and Section sheet shall be prepared as laid dow n in paragraphs 443 to \n451 of the Indian Railways Code for the Engineering Department as reproduced \nin Schedule. \n(a) Completion drawings of bridges, with drawings showing each type of \ngirders used and giving the loadin g standard for which each is de signed, \nand (if called for by the Commissioner), details of the ca lculations of their \nstrength; \n(b) Completion drawings of tunnels if any; \n(c) Diagrammatic plans of station yards sh owing the gradients, the layout of \ntracks and particulars of turn out, block working and of any si gnals and \ninterlocking installed; \n(d) Implantation of diagrams of Over Head Equipment masts, if applicable. \n(3) List of Questions and Answers shall be prepared in terms of questions enlisted in \nForm XV. \n(4) Certificates of works shall comprise – \n(a) Certificate in Form XVI containing the comments on the following matters, \nnamely :- \n(i) Maximum and minimum dimensions; \n(ii) Strength of bridges; \n(iii) Number of engines on one span; \n(iv) Brake and communications; \n(v) Accommodation in coaches to cater for different categories of \npassengers; \n(vi) System of working; \n(vii) Electric traction equipment (only if applicable); and \n(viii) Types of rolling stock proposed along with list of restrictions. \n(5) List of infringements of maximum and minimum dimensions shall be prepared in \nForm XVII and shall show the gauge of the railway and items infringed and shall \ncontain full explanation for the infringement and the reference to the authority \nunder which the infringement is permitted or allowed. \n(6) Working orders to b e enforced at each station on the railway to be opened shall \nbe prepared in accordance with the rules provided in Chapter V of the General \nRules and shall specify any special conditions that are required to be met with. \n(7) Where it involves introduction of electric traction on the railway line the working \norders shall include traction working rules.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 6, + "text": "5A. Contents of documents to be supplied to the General Manager or Principal Chief \nEngineer or Principal Chief Electrical Engineer or Principal Chief Signal and \nTelecommunication Engineer of Zonal Railways - The documents referred to in rule \n4A shall contain the details as specified below- \n(1) tabulated details which shall consist of important characteristics of the railway or \na portion of railway to be opened for public carriage of passengers and in \nparticular include, – \n(a) gradient abstract as specified in Form II; \n(b) bridge abstract as specified in Form III; \n(c) ballast and permanent way as specified in Form V; \n(d) level crossing abstract as specified in Form IX; \n(e) brief particulars of traction installations as specified in Form X; \n(f) power supply installation abstract as specified in Form XI; \n(g) traction maintenance depot abstract as specified in Form XII; \n(h) restricted over head equipment clearances abstract as specified in Form \nXIII; and \n(i) electrical crossing over railway track abstract as specified in For XIV. \n(2) The Index Plan and Section sheet shall be prepared as laid down in paragraphs \n443 to 451 of the Indian Railways Code for the Engineering Department as \nmentioned below- \n(a) completion drawings of bridges, with drawings showing each type of \ngirders used and giving the loading standard for which each is designed, \nand (if called for by the P rincipal Chief Engineer, Zonal Railway ), details \nof the calculations of their strength; and \n(b) implantation of diagrams of over head equipment masts, if applicable. \n(3) The list of Questions and Answers shall be prepared in terms of questions enlisted \nin Form XV. \n(4) The certificates of works as per contents mentioned in Form ‘XVI A’ by Chief \nEngineer containing the comments on the following items applicable to specific \nmatter mentioned in proviso to rule 3, namely: - \n(i) maximum and minimum dimensions; \n(ii) strength of bridges; \n(iii) number of engines on one span; \n(iv) brake and communications; \n(v) accommodation in coaches to cater for different categories of passengers; \n(vi) system of working; \n(vii) electric traction equipment (only if applicable); and \n(viii) types of rolling stock proposed along with list of restrictions. \n(5) The list of infringements of maximum and minimum dimensions shall be \nprepared in Form XVII and shall show the gauge of the railway and items \ninfringed and shall contain full explanation for the infringement and the reference \nto the authority under which the infringement is permitted or allowed. \n(6) The working orders to be enforced at each station on the railway to be opened \nshall be prepared in accordance with the rules provided in Chapter V of the \nGeneral Rules and shall specify any special conditions that a re required to be met \nwith. \n(7) Where it involves introduction of electric traction on the railway line the working \norders shall include traction working rules.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 7, + "text": "CHAPER III \nDUTIES OF THE GENERAL MANAGER \n6. Deviation from or infringement of Standard Codes and Manuals of Practice to be \nnotified – (1) The General Manager shall ensure that the railway proposed to be opened \nis operationally fit in every respect before inspection by Commissioner. \n(2) The General Manager shall, while making the reference under rule 3, bring to the \nnotice of the Commissioner any deviation in design, material and construction of \nthe works, rolling stocks or appliances of the railway, instances in which \nMaximum and Minimum Dimensions have not been observed, or the bridges, \ntunnels are n ot capable of carrying the prescribed or standard load without \nexceeding the stress specified in the Indian Railways Standard Codes and Manuals \nof Practice. \n7. General Mana ger to make special arrangements –(1) The General Manager shall \nmake such arrangements as are necessary to facilitate the inspection by the \nCommissioner, of the railway, which is to be opened. \n(2) The General Manager shall be responsible to make such special arrangements as \nthe Commissioner may require for inspection and testing of Important or Major \nbridges and tunnels on the railway, which is to be opened. \n \n8. Supply of information to Commissioner – The General Manager shall supply all the \ninformation and give all the assistance in his power to the Commissioner and supply or \nprovide all instruments and apparatus required for making measurements, t esting of \nImportant or Major bridges and other installations. \n \n9. Dismantling of any work on request by Commissioner – (1) The General Manager \nshall, on receipt of a request made by the Commissioner , make arrangements to \ndismantle any structure on the railway to be opened, with a view to make complete \nexamination of the details or workmans hip of the structure, as quickly and completely \nas possible. \n(2) The Commissioner, while requesting the dismantling of the structure, shall be \nresponsible to see that such dismantling does not affect the utility or strength of the \nstructure, unless total dismantling is necessary for its proper inspection. \n10. General Manager to accompany Commissioner at inspecti on – (1) The General \nManager may accompany the Commissioner throughout the inspection. \n(2) If, for any unavoidable reason, it is not possible for the General Manager to \naccompany the commissioner, then the Chief Administrative Offi cer or the Chief \nEngineer (co -ordination) Construction, along with other concerned officers shall \naccompany the Commissioner during the period of inspection. \n(2A) The Divisional Railway Manager along with the concerned branch officers shall \nalso accompany the Commissioner during the entire period of inspection. \n(3) During the inspection of each portion or division of the railway, the engineer or \nofficer who is or was in immediate charge of that portion or division of the railway \nduring its construction may also be present. \n(4) An officer not below the rank of Assistant Engineer shall be made responsible for \nmaking arrangements for testing Important or Major bridges on the railway line.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 8, + "text": "CHAPTER IV \nDUTIES OF THECOMMISSIONER \n11. Commissioner to make full and complete examinatio n – (1) On receiving a \nreference under rule 3 from the General Manager of any railway for inspection of a \nrailway to be opened for public carriage of passengers, the Commissioner shall, with a \nview to determine whether it is fit to be so opened, enquire into all matters which \nappears to him relevant for the safety of public carriage of passengers and goods, on \nthat railway. \n(2) The Commissioner shall satisfy himself that – \n(a) the Indian Railway (Open Lines) General Rules, 1976 have been applied to \nthe railway or portion of a railway proposed to be opened; \n(b) the maximum and minimum dimensions have been observed; \n(c) the works, structures, rolling stocks and appliances belonging to, or \nworking on, the railway are designed properly or constructed in su ch \nmanner so as to guard the system against accident and failure. \n12. Provisions for handling traffic at stations –The Commissioner shall satisfy himself \nthat at every station on a railway proposed to be opened – \n(a) Adequate provisions have been made for handling of traffic of passengers and \ngoods; and \n(b) Arrangements have been made for easy access by road. \n13. Accommodation works – Where the accommodation works made under section 16 are \nto be inspected, the Commissioner shall ensure that such works are sufficient and \nsuitable for the purpose for which they are provided or constructed. \n14. Inspection of light railways – The Commissioner shall, while inspecting any light \nrailway to be opened for public carriage of passengers, take into consideration – \n(a) Speed limits which are specified with reference to narrow gauge of the line and \nthe kind of traffic proposed to be handled; \n(b) Standard of convenience of the passengers keeping in view the conditions in \nwhich the light railway shall be operated, and shall lay down the speed limits to \nbe observed and the kind of traffic the light railway may be allowed to handle. \n15. List of questions and answers – (1)The Commissioner shall take into consideration \nthe answers provided by the General Manager to the questions listed in the list of \nquestions and answers submitted in relation to them under sub -rule (4) of rule 5 and \nsatisfy himself that the points enumerated therein have been duly observed by the \nconcerned railway administration. \n(2) The Commissioner may, if he considers it necessary, modify the requirements \nspecified in answers in accordance with the circumstances of each case. \n16. Inspection of railway Important or Major bridges – (1) The Commissioner shall \nsatisfy himself that the railway’s important or major bridges and other elevated \nstructures of the railway proposed to be opened for public carriage of passengers are \ndesigned and constructed as to the loads specification specifi ed in the Indian Railways \nStandard Bridges Rules, 1964 with upto date Addendum and Corrigendum slips or \nlatest version and other relevant code, and that the loads specification and stress limits \nare not exceeded. \n(2) The Commissioner shall be responsible to see that under no circumstances the \nstresses specified in the Standard Codes of Practice for bridges are exceeded, \nunless the Central Government, by general or special order, specify different \nstresses or loads specification, for the reasons recorded therein, in a specific case.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 9, + "text": "(3) Where the Commissioner is satisfied that first class standards are not required in \nthe cases such as temporary bridges, railway worked at low speed or with small \naxle loads, he may recommend departure from the Indian Railway s Standard \nBridges Rules, 1964 with upto date Addendum and Corrigendum slips or latest \nversion and the St andard Codes of Practice on such conditions as he may deem \nfit, provided that the Commissioner shall forward with his report the calculations \nshowing that the opening of such bridges, railways or axle loads will not be \ndangerous to the public carriage of passengers and the railway servants. \n(4) Where any particular bridge is not up to t he standards mentioned in sub -rules (1) \nto (3), the Commissioner sh all submit the design of the bridge along with the \nstandard of loading to the Central Government along with his recommendations \nas to whether the bridge may be brought in use and if so, under what conditions. \n17. Procedure for inspection of Important or Major bridges – (1) The Commissioner shall \nexamine at least one Important or Major bridge of each different pattern or type and \nsatisfy himself about the adequacy with reference to safety of – \n(a) the general design of the bridge; \n(b) designs of different parts or portions of the bridge, \n(c) the construction and erection of the whole structure of the bridge; \n(d) girder spans and their bedding at all four supports; and \n(e) type and design of bearings in regard to pre-stressed bridges. \n(2) Whether the Commissioner feels that it is necessary for the purpose of inspection \nand to see whether any riveting or bolting has been properly and efficiently \nexecuted, he may order the cutting out any rivets or opening of bolts and may also \norder the dismantling of any part of the structure of th e bridge for more detailed \nexamination. \n(3) If the Commissioner considers it necessary, in addition to the certificate of a \nBridge Engineer employed for the purpose, he can call for the load deflection test \nunder the loads for which the bridge is designed and where this is not possible \nunder the heaviest loads available. \n(4) (a) When making card deflection test, the test cards are to be placed at right \nangles to the centre line of the track, in order to record oscillation and the \nrecording pencil point sh ould be as fine as possible and the load deflection test \nmay also be carried out by any other suitable method or latest technology \navailable for this purpose, apart from card deflection test. \n(b) When central deflection is measured, the allowance shall be made for the \ndeflection, if any, of the abutments or piers. \n(5) In order to record the static deflection, the test shall be carried out at dead slow \nspeed and at the maximum permissible speed of the section and the speed shall be \ncarefully measured by stopwatch or by some automatic means. \n(6) The Bridge Engineer shall submit actual deflection cards to the Commissioner \ntogether with a statement of deflections and oscillations in Form XVIII. \n(7) The deflection of the girder shall be worked out theoreticall y and shall be shown \nin column 12 of Form XVIII to enable a comparison being made with the \nobserved deflection. \n(8) In addition to the load deflection test, the Commissioner may, require stress \nrecorder test to be carried out on any bridge girder, if resu lts of load deflection \ntests are not satisfactory. \n(9) (a) The stress recorder test shall be carried out with a stress recorder of approved \ntype. \n(b) The tests loads and speeds shall be as specified for load deflection tests.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 10, + "text": "(c) The tests shall be take n, on the chords or flanges at mid span and on such \nweb and floor members as the Commissioner shall specify. \n(d) If a sufficient number of instruments are available, these tests shall be made \nsimultaneously. \n(10) The stress recorder diagrams together wit h calculations showing how the \nmaximum stress under the design load with full impact (including dead load \nstresses) is deduced from the measured stress shall be submitted by Bridge \nEngineer to the Commissioner who shall, before sanctioning the opening of t he \nbridge, satisfy himself that the stresses in the girders shall not exceed those \nspecified in the Indian Railway Standard Steel Bridge Code, 1962 with upto date \nAddendum and Corrigendum slips or latest version and other relevant codes. \n(11) If the Commissioner is satisfied that the girder has been properly designed for the \nwork it is intended to perform, then, bridge girders are not required to be tested. \n(12) New steel girders and steel -concrete composite girders of standard designs need \nnot be te sted if those girders were inspected at the time of their manufacture by \nthe Research, Design and Standards Organisation or any other inspecting agency \nengaged by Chief Bridge Engineer of concerned railway, and a certificate of \nsatisfactory erection includ ing the seating of the bearings and field riveting or \nbolting has been given: \nProvided that the new concrete bridges need not be tested if load testing is not \nrequired to be conducted as per provisions of Indian Railway Standard Concrete \nBridge Code, 1997 with upto date Addendum and Corrigendum slips or latest \nversion and other relevant codes. \n(13) The Commissioner may decide that the second hand plate girders are not required \nto be tested if he is satisfied that,- \n(i) the girder is strong enough for the work it is intended to perform; and \n(ii) the responsible officer of the concerned railway has certified that the \ncondition of the material and workmanship are such that the use of the \ngirder for the specified loading shall not involve stresses in excess of those \npermitted in the Indian Railway Standard Steel Bridge Code, 1962 with \nupto date Addendum and Corrigendum slips or latest version and other \nrelevant codes. \n(14) The Commissioner may have test of any number of spans made and may have a \nspan tested any number of times and at any speeds as he considers necessary, up \nto the maximum permissible speed of the section of the railway. \n(15) The load deflection test may be carried out for non -standard bridge girders which \nare fabricated or constructed for the first time (need not be tested, if girder is \nalready under use in some other bridge over Indian Railways and given \nsatisfactory performance) and results of such tests shall be supplied to \nCommissioner. \n(16) The Commissioner may examine any non -standard br idge girders, which is \nfabricated or constructed for the first time. \n(17) The Commissioner shall be supplied with a certificate from the engineer (not \nbelow the rank of Junior Administrative Grade) responsible for design and \nconstruction of the bridge to the effect that welds have been designed in \naccordance with the Indian Railway Standard Welded Bridge Code, 2001 with \nupto date Addendum and Corrigendum slips or latest version and other relevant \ncodes and executed to the satisfaction of the said engineer. \n(18) If radiographic examination of the welds is specified in the drawing or procedure \nsheet or is required to be done in accordance with the provisions of the Indian", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 11, + "text": "Railway Standard Welded Bridge Code, 2001 with upto date Addendum and \nCorrigendum slips or latest version and other relevant codes, the results of such \nexamination shall be annexed to the certificate.” \n \nCHAPTER V \n \nTHE INSPECTION REPORT \n \n18. Contents of Inspection Report – (1) The inspection Report of the Commissioner shall \nspecify that – \n(a) He has made a careful inspection of the railway and the rolling stock that may be \nused thereon; \n(b) The moving and fixed dimensions as laid down have not been infringed; \n(c) The structure of lines of rails, strength of bridges, general structural character of \nthe works and the size of, and maximum gross load upon the axles of any rolling \nstock, comply with the requirements laid down; and \n(d) In his opinion, the railway can be opened for the public carriage of passengers \nwithout any danger to the public using it. \n(2) The Inspection Report shall be clear and concise and shall deal with all matters \nwhich are required to be considered, particularly whether the railway line is \ndesigned for standard loading and the instances of deviation or infringement of \nMaximum and Minimum Dimensions. \n19. Documents accompanying Inspection Report – The following documents shall \naccompany the Inspection Report namely :- \n(i) Index Plan and Section of railways; \n(ii) Tabulated details in Forms I to DIV; \n(iii) List of Question and Answers in Form XV; \n(iv) Certificate by the General Manager of the concerned railway in Form XVI; \n(v) List of infringements of Maximum and Minimum Dimensions I Form XVII; \n(vi) Results of the bridge test in Form XVIII; \nExplanation- When sanction is required for the initiation of electric traction on a line \nalready opened for passenger traffic, the documents specified in items (j), (k), (l), (m) \nand (n) of sub-rule (1), item (d) of sub -rule(2) and item (a)(vii) of sub-rule (4) of rule 5 \nshall be forwarded to the Commissioner. \n \n20. Submission of Report to Central Government – In respect of every reference made \nto him under sub-rule (3) of rule 3, the Commissioner shall submit an Inspection Report \nto the Central Government. \n \nCHAPTER VI \nSANCTION TO OPEN RAILWAY FOR PUBLIC \nCARRIAGE OF PASSANGERS \n \n21. Sanction of opening of railway (1) The Central Government may, after considering \nthe Inspection Report of the Commissioner, modify or cancel the sancti on given under \nrule 22(1) subject to such co nditions, alterations or relaxations as ma y be considered \nnecessary.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 12, + "text": "(2) While modifying the opening of any railway, the Central Government shall give due \nconsideration to the suggestions or conditions subject to which the Commissioner \nhas opened the railway. \n(3) Where the Commissioner has not recommended the opening of any railway or has \nproposed to cancel the sanction already given, the Central Government shall \nconfirm or modify the recommendation of Commissioner as necessary and shall \ndirect the Ra ilway A dministration concerned to remove the defects or \nshortcomings reported by the Commissioner. \n(4) Where the defects or shortcomings are such that they cannot be removed unless \nthe railway or a portion thereof is dismantled, then the Central Governmen t shall \norder the closing of the railway forthwith for the public carriage of the \npassengers. \n(5) A railway line, which is closed for the public carriage of passengers under section \n25, shall not be reopened unless it is duly inspected by the Commissioner in \naccordance with the provisions of Chapter IV of these rules and the \nCommissioner recommends the reopening of such railway line. \n(6) The actual date of openin g of a new r ailway line or a section or portion of such \nline for passenger traffic shall be no tified by concerned General Manager, after \nconsulting the Central Government, by notification in the Official Gazette, and in \nthe local news papers of the areas through which the railway line passes. \n “Explanation: In these chapters new lines of railway shall include extensions of \nexisting railways, new double, treble or other running lines laid alongside existing \nlines and conversion from one gauges to another”. \n(7) For Introduction of Electric Traction:- \n(a) 25kv ac charging of section for railway electrification work for existing \nlines or new lines or gauge conversion lines or doubling lines or Multiple \nlines and energisation of any high tension installation in this regard shall be \ndone with the approval of E lectrical Inspector as provided under the \nElectricity Act, 2003; \n(b) the competent authority to grant sanction to open the section with electric \ntraction for above mentioned works shall be Principal Chief Electrical \nEngineer of Zonal Railway, with no further delegation.” \n \n22. Opening of Railways by Co mmissioner- The Commissioner, after inspection, may \nunder Section 28 sanction the opening for pub lic carriage of passengers of new lines of \nRailway within the respective circles subject to the conditions as the Commissioner \nmay impose. \n \n22A. Deviation from Schedule of Dimensions - The Commissioner may, under section 28, \nallow any deviation from the maximum and minimum dimensions of Indian Railways \nSchedule of Dimensions, subject to any limit specified therein, wit hin the respective \ncircles with such conditions as the Commissioner may impose. \n \n23. Sanction to use locomotive engines and rolling stock on new lines -(1) The \nCommissioner may sanction the use of locomotive engines, rolling stock, or any other \nmotive power under section 27 which is already running on any Zonal railway, or any \ndivision or section of any non -Government railway, or on any new lines in accordance \nwith the provision of the Indian Railways (Open Lines) General Rules, 1976 or orders \non the subject issued by the Central Government from time to time.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 13, + "text": "(2) Before according sanction under sub -section (1), the C ommissioner shall \nascertain that the application of the Indian Railways (Open Lines) General Rules, \n1976 by the concerned railway administration which operates the line has been \npreviously sanctioned and notified in the Official Gazette. \n \nCHAPTER VII \n \nOPENING OF BRDIGES, MINOR WORKS, \nDIVERSIONS AND USE OF NEW TYPES OF \nROLLING STOCK ON EXISTING RAILWAYS \n \n24. Notice of construction of deviation lines, etc. – (1) Where it is proposed, on the \nrailway which has been opened after inspection, to construct any deviation lines, \nstations, junctions or crossings on the level, or to make any addition, alteration or \nreconstruction materially affecting the characte r of any work and such work forms part \nof, or is directly connected with the working of that railway, except work mentioned in \nproviso to rule 3, the railway administration concerned shall give notice to that effect to \nthe Commissioner. \n(2) Before any such work, the execution of which may affect the running of trains \ncarrying passengers, is put in hand, the concerned railway administration shall \nfurnish to the Commissioner for his approval drawings or particulars of the work \nand of any temporary arrangements necessary for carrying it out. \n(3) Every temporary deviation line irrespective of its length and any permanent \ndiversion less than 2 kilometers in length, where no new station is involved, shall \nbe treated as new minor works. \n(4) In case of an accident, temporary diversions may be opened under section 24 after \na railway servant in-charge of the work of the concerned railway certifies that the \nuse of such diversion will not be attended with danger to passengers or to the \nrailway servants. \n(5) Where the use of temporary diversion is likely to be extended to more than 3 \ndays, the Commissioner shall, if he consider s it necessary, take the earliest \npossible opportunity of inspecting it.” \n \n25. Power of Commissioner to open minor works – (1) The Commissioner may, without \nprevious notice, sanction the opening of any minor work for passenger traffic, except \nwork mentioned in proviso to rule 3, if he is satisfied, either with or without ins pection, \nthat the provisions of clauses (b), (c) and (d) of sub section (1) of section 22 have been \nduly fulfilled. \n(2) Works so opened without inspection, should ordinarily be inspected at the earliest \npossible date, but in case of works of a minor character, the Commissioner of \nRailway Safety will exerci se his discretion as to the necessity of carrying out a \nsubsequent inspection. \n(3) The authority for opening any work , except work mentioned in proviso to rule 3, \nshall be communicated in writing by the Commissioner to the concerned railway \nadministration and a record of all works so authorized during each year, with \nparticulars of the prior or subsequent inspection, if made, shall be maintained by \nthe Commissioner. \n \n25A. Opening of works specified under sub-rule (3) of rule 3,- \n(1) For items:", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 14, + "text": "(a) construction, rebuilding, modification and strengthening of foot -over-\nbridges and road-over-bridges; \n(b) construction, rebuilding, regirdering and strengthening of minor bridges; \n(c) regirdering and strengthening of all existing bridges, other than minor \nbridges; \n(d) elimination of manned level crossing; \n(e) upgradation of level crossing and diversion of roads at level crossings, \nthe Com petent A uthority to grant sanction to execute and open works shall be \nPrincipal Chief Engineer of zonal railway, with no further delegation. \nNote: For sub -rule (1), the Principal Chief Engineer shall be the Competent \nAuthority to grant sanction for works affecting running lines carrying passenger’s \ntrains. \n \n(2) For interlocking of level crossing , the competent authority to grant sanction to \nopen works shall be Principal Chief Signal and Telecommunication Engineer of \nzonal railway, with no further delegation.” \n(3) For items,- \n(a) introduction of Double Distant Signalling alongwith corresponding changes \nat adjacent stations without yard remodelling; \n(b) introduction of new Intermediate Block Signaling, except in section with \nSlip Siding and Catch Siding, alongwith corresponding changes at adjacent \nstations without yard remodelling; and \n(c) introduction of new Automatic Block Signaling, except in section with Slip \nSiding and Catch Siding, alongwith corresponding changes at adjacent \nstations without yard remodeling, \nthe Competent Authority to grant sanction to open works shall be the General \nManager of Zonal Railway, with no further delegation. \n \nNote-The General Manager or Principal Chief Signal and Telecommunication \nEngineer of the Zonal Railway, as the case may be, may sanction the opening of \nworks for passenger traffic under sub -rules (2) and (3) of rule 25A, if he is \nsatisfied, either with or without inspection and works so opened without \ninspection, should ordinarily be inspected at the earliest possible date, but in case \nof works of a minor types, the General Manager or Principal Chief Signal and \nTelecommunication Engineer of Zonal Railway , as the case may be, shall \nexercise his discretion as to the necessity of carrying out a subsequent inspection. \n \n26. Infringements of Maximum and Minimum Dimensions - No infringement of the \nMaximum and Minimum Dimensions shall be permitted without the prior sanction of \nthe Commissioner or of the Central Government. \n27. Opening of new or strengthened bridges – (1) No railway important or major bridge \nshall be erected or opened to traffic, without the sanction of the Commissioner even \nthough it is able to carry the loads without exceeding the str esses prescribed in the \nrelevant Codes of Practice or in the absence of any such reference, the design criteria \napproved by the Central Government.”; \n(2) No load shall be imposed on any railway important or major bridge which would \ncause in any member thereof stresses greater than those specified in sub -rule (1), \nwithout the sanction of the Commissioner. \n(3) Closure of an existing important or major bridge shall require the sanction of the \nCommissioner.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 15, + "text": "(4) No Railway minor bridge shall be erected or opened to traffic and no railway \nbridge (important or major and minor) shall be reopened to traffic, after \nregirdering and strengthening, without the sanction of the Principal Chief \nEngineer of Zonal Railway even though it is able to carry the loads without \nexceeding the stresses prescribed in the relevant Codes of Practice or in the \nabsence of any such reference, the design criteria approved by the Central \nGovernment. \n(5) No load shall be imposed on any railway bridge defi ned in sub -rule (4) which \nwould cause in any member thereof stresses greater than those specified in sub -\nrule (4), without the sanction of the Principal Chief Engineer of Zonal Railway. \n(6) Closure of an existing minor bridge shall require the sanction of the Principal \nChief Engineer of Zonal Railway.” \n \n28. Introduction of New types of locomotives or rolling stock:- \n \n(1) The Research, Design and Standards Organisation shall apply, for introduction of \nnew types of locomotives or rolling stock different from those already running on \nany section or division of railway administrations for use by any railway \nadministration, to the Central Government through the Commissioner. \nExplanation: For the purposes of this sub -rule, any increase in sanctioned \nmaximum speed of existing locomotives or rolling stock beyond the maximum \nspeed sanctioned by Railway Board for similar type stock alrea dy running in the \nsame category (Locomotives or Trainset including Electric Multiple Unit, \nMainline Electric Multiple Unit or Coaches or Wagons or Track Machine or \nCranes or Over Head Equipments Inspection Cars or any other category), shall be \ntreated as introduction of new types of locomotives or rolling stock.” \n(2) The application under sub-rule (1) shall be accompanied by— \n(a) such diagrams as may be necessary to give full particulars of the axle loads, \nwheel spacing, length over buffers and other principal dime nsions of the \nlocomotive or rolling stock for which sanction is required; \n(b) provisional speed certificate or final speed certificate, as the case may be, \nissued by the Research, Design and Standards Organisation; and \n(c) the maximum number of motive power units or the maximum number of \ndiesel or electric multiple units proposed to be coupled together for multiple \noperation shall be specifically mentioned. \n(3) The application shall be scrutinised by the Commissioner and his \nrecommendations thereon shall be submitted t o the Central Government for its \norders. \n(4) No new type of locomotive or rolling stock which would cause stresses exceeding \nthose specified in the IRS Bridge Rules, 1964 , or the Standard Codes of Practice, \nor in the absence of any such reference, the design c riteria approved by the \nCentral Government for existing structures or excessive stresses in track shall be \ninducted until the sanction of the Central Government has been received through \nthe Commissioner for doing so.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 16, + "text": "(5) The Commissioner may, for permitting n ew designs of locomotives or rolling \nstock, require oscillation trials to be conducted and call for the records for his \nscrutiny. \n(6) A locomotive or rolling stock shall be considered new, if it is different from those \nalready running on any section or division of railway administration: \n Explanation: A locomotive or rolling stock having larger principal dimensions \n(>5%) or more infringements or higher maximum design axle load (>2%) or \nhigher maximum design track loading density (>2%) or different basic bogie \ndesign or new design of braking system other than currently in use over Indian \nRailways or different kind of operation or different system of operation and \ncontrol over the rolling stock or with proposed maximum speed more than the \nmaximum speed of those similar type stocks already running in the same category \n(Locomotives or Trainset including Electric Multiple Unit, Mainline Electric \nMultiple Unit or Coaches or Wagons or Track Machine or Cranes or Over Head \nEquipments Inspection Cars or any other ca tegory), shall be regarded as new \nrolling stock. Any other rolling stock shall be termed as “Derived” stock. \n(6A) Sanction for introduction of a locomotive or rolling stock which is not considered \nnew and termed as ‘Derived’, as per the criteria mentioned in sub-rule (6) of rule \n28, shall be accorded by Director General, Research, Design and Standards \nOrganisation and while issuing sanction for such ‘Derived’ locomotive or rolling \nstock, inclusion of conditions issued by Central Government in sanction lett er of \nsimilar type, in same category, of locomotive or rolling stock, shall be duly \nconsidered. Head of concerned design directorate of Research, Design and \nStandards Organisation shall apply, for introduction of ‘Derived’ locomotives or \nrolling stock for use by any railway administration, to Director General, \nResearch, Design and Standards Organisation and the application shall be \naccompanied by- \n(a) such diagrams as may be necessary to give full particulars of the axle loads, \nwheel spacing, length over buffer s and other principal dimensions of the \nlocomotive or rolling stock for which sanction is required; \n(b) provisional speed certificate or final speed certificate, as the case may be, \nissued by the Research, Design and Standards Organisation; \n(c) the oscillation trial reports and records \n(d) the maximum number of motive power units or the maximum number of \ndiesel or electric multiple units proposed to be coupled together for multiple \noperation shall be specifically mentioned.” \n(7) In case of any difference of opinion in the Research, Design and Standards \nOrganisation, whether or not any change or modification is to be regarded as a \nnew rolling stock, the Research, Design and Standards Organisation shall, \nthrough the Commissioner, refer the matter to the Central Government fo r final \ndecision thereon. \n \n28A. Use of new types of locomotives or rolling stock by railway administration- \n(1) The General Manager of a Government railway may sanction the use of any \nlocomotive or rolling stock already introduced by the Central Government or \nDirector General, Research, Design and Standards Organisation under the \nprovisions of rule 28, on any section or division of railway under his control.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 17, + "text": "Provided that the railway administration other than the Government railway shall \nrequire the approval of the Central Government through the Commissioner for \nuse of any locomotive or rolling stock already introduced on Government railway \nby the Central Government/DG RDSO under the provisions of rule 28, on any \nsection of railway under its control. \n(2) The proposal for sanction of the General Manager of a Government railway under \nsub-rule (1) shall be accompanied by- \n(i) such diagrams as may be necessary to give full particulars of the axle loads, \nwheel spacing, length over buffers and other principal dimen sions of the \nrolling stock for which sanction is required; \n(ii) the provisional speed certificate or final speed certificate, as the case may \nbe, issued by the Research, Design and Standards Organization; \n(iii) the sanction of the Central Government or Director Gen eral, Research, \nDesign and Standards Organisation for introduction of the locomotives or \nrolling stock; \n(iv) the calculations and stress sheets showing- \n(a) the conclusions arrived at; \n(b) the external forces on which the stress calculations are based; \n(c) the stresses which will be produced in the various bridges over which \nthe proposed locomotive or rolling stock will run; and \n(d) the effects which the said locomotive or rolling stock will have on \nvarious structures or tracks as compared with those caused by \nlocomotive or rolling stock already in use, or allowed by the existing \nGovernment orders: \n Provided that the calculations and stress sheets under this clause must \nshow as to what allowance has been made for any secondary or \ndeformation stresses in addition to the primary stresses caused by \nexternal forces and what relief of stress, if any, has been included; \n(v) the cost of modification to signalling and telecommunication installations \nnecessitated by the use, if any, of chopper or thyristor control systems; \n(vi) an approximate estimate of the cost of such improvements in existing \nstructures or track as the use of the proposed locomotive or rolling stock is \nlikely to render necessary on the concerned railway, whether immediately \nor in the near future; and \n(vii) a certificate signed by the Chief Engineer, the Chief Mechanical Engineer \nand the Chief Electrical Engineer (for electric stock) of the concerned \nrailway in the following Performa, namely:— \n \nCERTIFICATE \nCertified that it is safe to run -------------------(particulars of locomotive or rolling stock \nproposed to run) not exceeding --------------------units (in the case of locomotive) coupled \ntogether on the section --------- (station) to --------- (station) from ------------(km) to -------(km) \nof the -------------- Railway at a maximum speed of ------------(km/h) against a maximum speed", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 18, + "text": "of -------------(km/h) certified by Research, Design and Standards Organization, subject to the \nfollowing speed restrictions and conditions:— \n(a) Speed restrictions: — \nSl. \nNo. \nFrom km to \nkm \nNature of speed \nrestriction \nBrief Reason for restriction \n \n \n(b) Special Conditions— \n1 ….. \n2 ….. \n3 ….. \n4 ….. \n \nTo be signed by— \n1. The Chief Mechanical Engineer….. 2. The Chief Engineer…… \n3. The Chief Electrical Engineer….. 4. The Chief Signalling and \nTelecommunications Engineer….. \n5. The Chief Operating Manager….. \nNote 1. — The Chief Operating Manager and the Chief Signalling and Telecommunications \nEngineer should be associated when the increase in the speed of a locomotive or rolling stock is \ncontemplated over the maximum sanctioned speed for a specific category of train (passenger or \ngoods) over a particular section of the railway. \nNote 2.— Over the railways where both the shop maintenance and open line maintenance of \nelectric locos and electrical multiple unit rolling stock are under the control of the electrical \ndepartment only, the Chief Electrical Engineer, otherwise the Chief Mechanical Engineer shall \nalso sign. \nNote 3.— When Motive power with chopper control is to be used, the Chief Electrical Engineer \nand the Chief Signalling and Telecommunication Engineer shall sign this certificate. \n___________________________________________________________________ \n(3) The Certificate referred to in clause (vii) of sub -rule (2) shall indicate — (a) \nclearly that the speed certified does not exceed the limits laid down by the \nResearch, Designs and Standards Organisation; and (b) Specifically the maximum \nnumber of motive power units proposed to be coupled together for multiple \noperation. \n(4) The General Manager of the Government railway shall communicate the sanction \nto the Commissioner for his information ten days in advance of the actual use of \nlocomotive or rolling stock over the railway. \n(4A) If infrastructure and operating conditions, f or a new or derived locomotive or \nrolling stock, as specified in the Provisional or Final Speed Certificate issued by \nResearch, Design s and Standards Organisation, are same as that for any other \nlocomotive or rolling stock already running on the Railway, p rocess mentioned in \nsub-rule (2) for sanction of General Manager shall not require to be followed:", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 19, + "text": "Provided that instead, in such cases, only a notification (which will be considered \nat par with the sanction) shall be issued by the General Manager that pe rmission \nis given for use of this locomotive or rolling stock on the Railway on the same \ninfrastructure and operating conditions as already notified for such locomotive or \nrolling stock and this notification shall be sent to the Commissioner for his \ninformation ten days in advance of the actual use of locomotive or rolling stock \nover the railway. \n(5) The provisions of this rule shall, mutatis mutandis, apply to every proposal of a \nrailway administration other than Government railway for seeking approval of the \nCentral Government through the Commissioner, for the use of any locomotive or \nrolling stock already introduced on Indian railway by the Central Government or \nDirector General, Research, Design and Standards Organisation under the \nprovisions of rule 28, on any section of railway under its control. \n28B. Introduction of new passenger carrying trains or change in speed of existing passenger \ncarrying trains. —A railway administration may introduce a new passenger carrying train or \nallow any change in speed of existing passenger carrying train in accordance with the instructions \nissued by the Central Government in this regard, from time to time: \nProvided that a railway administration shall require the approval of the Central Government \nthrough the Commissioner, at the first introduction of a new passenger carrying train above 130 \nkilometer per hour or first increase in speed of existing passenger carrying train a bove \n130 kilometer per hour in a section of such railway. \n29. Testing of bridges - Before sanctioning the open of new important or major bridges or \nthe running of heavier loads over existing bridges, the Commissioner may require load \ndeflection or stress recorder test to be carried out as specified in Chapter IV and tests on \npre stress concrete girder or composite girder bridge may also be carried out and the \nPrincipal Chief Engineer of Zonal Railway may also follow the above practice for \nsanction to execute and open bridges as defined in rule 25A.” \n30. Use of new types of Block Instruments – (1) A railway administration, which desires \nto use a new type of block instrument, or main Signaling instrument, which is not an \napproved type, shall apply for sanction to the Commissioner. \n(2) The application under sub-rule (1) must be accompanied by – \n(i) a list of the requirements which the instrument fulfils, together with the results of the \nfield trial conducted by the railway concerned; \n(ii) a certificate from the Chi ef Signaling and Telecommunications Engineer in the \nform given below: \nCERTIFICATE \n \nCertified that it is safe to use (particulars of the equipment) at the station/ on the section \nof the railway, with the following precautions: \n1. \n2. \n3. \n4. Etc. \n(Sd/---- \nThe Chief Signaling and Telecommunications Engineer.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 20, + "text": "Note- The application should be scrutinized by the Commissioner, who if satisfied, will \ncommunicate his sanction to the concerned railway. In case he is not fully satisfied, he \nwill give his comments and recommendations for suitable further action. \n(iii) A statement whether the equipment complies with the specifications approved by \nthe Central Government. \n(iv) A statement giving comments on the performance of the equipment as a result of \nbench trials conducted by Research, Designs and Standards Organization. \n(v) The circuit diagrams and other relevant diagrams and explanations, as may be \nnecessary, to give full particul ars of the principles of operat ion and safety features \nincorporated. \n(vi) A copy of the instructions approved by the Chief Operating Manager, to be issued \nfor the operation of the equipment by the operating staff, including those instructions \nfor working under abnormal or failure conditions; \n \nCHAPTER VIII \n \nREQUIREMENTS AND RECOMMENDATIONS FOR \nSIGNALING AND INTERLOCKING INSTALLATIONS \n \n31. Signals – (1)The number of signals provided and the height of such signals shall be \nlimited to the extent to the actual necessity for safety and traffic purposes. \n(2) The distance between the Distant/Warner and the first stop signal ahead shall be \nsuch that a train approaching the former at the highest authorized speed with due \nallowance for weight, braking power, gradient and sighting distance can be \nstopped before passing the latter. \n(3) The subsidiary signals shall be readily distinguishable from the running signals. \n(4) Where a signal or its back light is not visible to the railway servant operating the \nsignals, the aspect of the signal and the condition of the light shall be repeated at \nthe place of operation. \n(5) It is desirable that the signaling at all block stations and interlocked level \ncrossings in the same section shall conform to the same standard and type. \n(6) Signals shall be so designed as to give the most restrictive aspect in the event of \nfailure of any part of the mechanism, which operates them. \n(7) The location and type of signals shall be in accordance with the provisions \ncontained in Chapter 7 of the Signal Engineering Manual, Part I and Chapter III \nof the Indian Railways Open Lines) General Rules, 1976. \n32. Points – (1) The points shall be so located that movements over them shall be within \nthe view of the cabin or the location from which they are worked unless and approved \nalternative arrangement for proving clearance of point zone is provided.” \n(2) The points, locks and bars shall not be worked by wire but by rodding or by \npower operation. \n(3) Spring points shall not be used. \n(4) Movable crossings and movable diamond crossings on passenger lines shall be \nprovided with complete facing point equipment of approved type. \n(5) The requirements of points as stipulated in Chap ter 7 of the Sign al Engineering \nManual, shall be followed. \n33. Interlocking - (1) Signal and interlocking apparatus and installations shall be in \naccordance with Chapter 7 of the Signal Engineering Manual.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 21, + "text": "(2) Apparatus provided for operation and control of signals, points, etc., shall be \ninterlocked and arranged to comply with the essentials of interlocking and other \nrequirements as laid down in Chapter 7 of the Signal Engineering Manual. \n(3) The operation of the signaling gears may be from the lever frame or a panel with \nindividual operation of points, signals and other functions or a panel providing \noperation of route setting type or any other approved means in accordance with \nthe provisions of Chapter 7 and Chapter 12 of the Signal Engineering Manual. \n(4) When a signal is controlled by more than one agency, it shall be possible for \nevery such controlling agency to replace the signal to “ON” position. \n(5) The Station Master shall be p rovided with interlocked mechanical or electrical \ncontrol of the Home and Last Stop Signals except where the conditions stipulated \nin the Signal Engineering Manual, are fulfilled. \n \n(6) Standards of signaling and interlocking shall be arrange complying wit h the \nrequirements of the Signal Engineering Manual. \n34. Siding and trap points – (1) Sidings shall be arranged in such a manner that shunting \noperations upon them shall involve the least possible use of, or obstruction, to running \nlines. \n(2) Trap points shall be provided upon goods lines and sidings at their junctions with \npassenger lines, with the points normally set against the passenger lines and \ninterlocked with the signals. \n(3) Bay and loop platforms line and refuge loops shall be isolated from main through \nlines. \n35. Junctions –Bars or other approved devices shall be provided in order to define the \nfouling points of junctions, loops, siding connections, crossings and the like. \n36. Provision for isolation at stations –(1) The speed of trains running through s tations \nshall be governed by the General Rules for all open lines administered by the railway \nadministrations, both Government and the non -Government railways and shall be \nsubject also to the restrictions relating to standards of interlocking prescribed in the \nSignal Engineering Manual. \n(2) At no station at which isolation has not been provided through running trains \nshall be permitted unless the conditions laid down in the second paragraph of rule \n4.11 of the General Rules are complied with. \n(3) At any s tation where there is a speed restriction for through running trains \ndifferent from neighbouring stations, a speed restriction board should be erected \nat the first approach signal or where no signals are provide, at full braking \ndistance outside the first facing point. \n(4) In order to maintain safety for through running, points for trap sidings must not \nbe inserted in the main line or through line, except under approved Special \nInstructions in accordance with the Signal Engineering Manual Part I. \n(5) All passenger running lines shall be isolated from all goods lines or siding \nconnected thereto. \n(6) All goods running lines may be isolated from all sidings connected thereto. \n(7) It is not necessary to isolate one goods receiving line from another \n(8) Isolation may be accomplished by – \n(a) Connection to another line or ling siding; \n(b) The provision of short dead endsiding; or \n(c) the provision of trap.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 22, + "text": "Note- \n(i) Whichever may be the method for isolation, a starter signal shall be provided, \nexcept when omitted under approved special instructions. \n(ii) When a trap is provided, the trap switch should be located with the heel of the \nswitch in rear of the fouling mark and preferably on the straight. The switch \nshould be in the rail away from the line to be protected. \n(9) The various methods of isolation are illustrated in the diagrams given in \nAppendix A attached to these rules and the following instructions shall apply to \ntheir use in the case of running lines, namely :- \n Method A: This method shall apply to cases in which the line on which the train \nwill run when the points are set for isolation of the through line, is kept clear for \nthe adequate distance prescribed in Rule 3.40 of the Indian Railways (Open \nLines) General Rules, 1976. \n Method B: When a short dead end siding is provided, it shall not ordinarily be \nlong enough to permit of vehicles being stabled thereon. To obtain the adequate \ndistance prescribed under rule 3.40 of the General Rules the points of the dead \nend siding shall be set for the across over and against the siding, before a train is \nadmitted on a line trapped by this method. Where it is necessary for the short \ndead end siding to be extended for the purpose of stabling vehicles, the above rule \nshall apply, unless a trap is provided on the dead end siding at a distance of not \nless than 180 meters (120 meters in case of stations provided with multi aspect \nsignaling) from the starter signal where provided or from points leading to the \nmain or through line. No train shall be admitted on the running line unless the \ntrap is set and locked against vehicles occupying the further part of the dead end \nsiding. \nMethod C: When a trap is used, a train must not be admitted on to the trapped \nline unless the trap has been closed, so that the train wi ll not be derailed if the \ndriver over shoots the trap. \n(10) When Method A cannot be used, and for any reason it is not convenient to use \nMethod B or Method C and to provide adequate distance by setting the points of \nthe short dead end siding or trap for the cross over and against the siding or trap, a \nsand hump of approved design should be used as a substitute for adequate \ndistance as provided in rule 3.40(4) of the Indian Railways (Open Lines) General \nRules, 1976. In that case the length of the siding sh ould be at least one rail length \nand formation should be made up for a short distance beyond the hump. \n \n37. General- (1) The requirements and regulation of Block Instruments shall be in \naccordance with section of Chapter 18 of the Indian Railways Signal Engine ering \nManual. \n(2) The requirements of Centralised Traffic Control (CTC) or Traffic management \nsystem shall be in accordance with section 4 of Chapter 13 of the Indian Railways \nSignal Engineering Manual.\"", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 23, + "text": "CHAPTER IX \n \nRULES FOR THE DESIGN AND INSPECTION OF \nEQUIPMENT FOR ELECTRIC TRACTION \n \n38. Designs of electric installations – (1) The design of all electrical installations, namely, \ntransmission and distribution lines, substation, switching stations, Over Head \nEquipment, etc. shall be ac cording to approved standards laid down by the Central \nGovernment and the Central Electrical Authority Regulation 2010 or any other relevant \nstatutory rules for the time being in force. Wherever, any departure from accepted \nnorms becomes necessary, approval of the Central Government shall be obtained. \n(2)(a) Adequate protective arrangements shall be made to ensure that the public cannot \ncome in contact with the electric equipment on line within the railway premises. \n(b) Suitable protective screens shall be provided where live conductors pass under or \nover bridges. \n(3) The structures supporting overhead equipment shall be designed in accordance \nwith the relevant Indian Standards. The wind pressure to be adopted in such cases \nshall be generally in accordance with Indian Standard 875 (part -3)-2015 Wind \nLoads on Buildings and Structures-2015 except when a higher value is prescribed \nby the State Government, which should be ascertained by a reference to the State \nGovernment, unless a notification on the subject in connection with the electric \ninstallation other than the electr ic traction on railways is already issued by the \nState Government. \n(4) When the distribution system involves overhead wires carried on steel structures \nincluding bridges and roofs and a return circuit via running rails or earth, all such \nstructures, masts and associated tracks shall be effectively earthed and bonded or \nother precautions taken to ensure that contact with the steel work of the structure \nwill not be dangerous to the public and the railway staff. In AC traction earthing \nand bonding shall be as per the approved Code for Bonding and Earthing. \n(5) Earthing arrangements at power supply installations shall strictly conform to the \nIndian Electricity Rules, 1956 and accepted Codes of Practice for Bonding and \nEarthing for AC traction. \n(6) No earth wi re shall cross any tack. Where struc tures to be connected to an \nearthwire are located on opposite sides of a track, separate wire runs shall be used \nfor connecting the structures. In complicated areas, structures may be connected \nto individual earthing stations. \n(7) When over head lines transmitting electric power (other than lines forming part of \nthe railway traction equipment) have to be carried across railway track, the details \nof the equipment provided in connection with such lines must be designed wit h \nthe object of minimizing danger in the event of breakage and in accordance with \nthe regulations for the Electrical Crossing, 1987. These details must be approved \nof the Electrical Inspector to the Government of India (EIG). \nNote-The Principal Chief Electrical Engineer of a Zonal Railway functions as the \nElectrical Inspector to the Government of India. \n(8) Lighting arresters of standard or approved types shall be provided wherever they \nare necessary. \n(9) All component parts of the equipment which carry live conductors shall be \nprovided with devices approved by the Electrical Inspector to the Government of \nIndia to prevent unauthorized persons climbing them. Anti -climbing device shall", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 24, + "text": "also be provided, wherever necessary, on structures c arrying high -tension \nequipment within railway premises. \n(10) On both sides of roads at level crossings, height gauges of suitable design shall be \nprovided to ensure that no part of any road vehicle or its load shall come in \ncontact with overhead equipment. \n(11) Warning notices shall be erected in conspicuous positions at level crossings and \nthe like indicating to the existence of live electrical equipment. \n39. Display of caution boards and notices – The following caution board and notices \nwritten in English, Hindi and the regional language shall be displayed at the various \nlocations indicated below :- \n(a) “Treatment for electric shock” boards, giving instructions for treatment of electric \nshock at all railway stations signaling cabins, Offices of the Station Manager, the \nAssistant Station Managers, Senior Sectional Engineers ( Permanent Way), the \nSenor Sectional Engineer (Works, The Senior Sectional Engineer (Signal), Over \nHead Equipment Maintenance depots , Over Head Equipment Inspection Car \nSheds, substations, switching station cubicles, loco sheds and the like. \n(b) General ‘Caution notices’ regarding danger of high voltage traction wires for \npublic at various entrances to railway stations and for staff at pro minent places at \neach station, particularly on stanchions or pillars supporting platform roof. \n(c) “25KV cautions Boards” shall be affixed on to the screen erected on foot over \nand road over bridges. \n(d) “Danger” boards on level crossing height gauges. \n(e) “Engine stop” boards, at termination of Over Head Equipment in the sections to \nbe energized. \n(f) “Caution-Unwired turn out” boards ahead of all unwired turn outs or crossovers \ntaking off from wired tracks. \n(g) “Warning” boards for neutral sections. \n(h) Boards for “Switching on” and “Switching off” of power at neutral sections. \n(i) “Danger boards to be installed on Over Head Equipment near watering stations, if \nany. \n(j) “25kV or 2x25kV caution” boards at substations and switching stations. \n(k) “Caution” notic es on all diesel, Electric and ste am locos, which work on the \nenergized section, including those owned by private parties. \n(l) “Caution” boards at such signal posts where protective screening cannot be \nprovided for signal and telecommunication staff. \n40. Protection of private property against indu ctive effects of AC traction - Under \n25kV or 2x25kV traction, there is a heavy induction on all metallic structures and \nconductors in the vicinity of track. Inductive effects show themselves on any overhead \nconductor, such as metallic clot hes lies, power lines, and the like belonging to private \nparties running parallel and close to the electrified tracks. Wide publicity shall be given \nto the effects of the induction, so th at special precautions may be taken by private \nparties concerned against the possibil ity of electric shocks from conductors running in \ntheir premises. \n \n41. Approval of energization of High Tension installations- \n(1) Application shall be submitted at least a fortnight before energization to the Chief \nElectrical Engineer and the Electrical Inspector of the concerned railways for the \nfollowing :-", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 25, + "text": "(a) Formal approval, if not already received to the design and layout of all high \nvoltage equipment including traction sub -stations, transmission lines, 25kV \nor 2x25kV feeders, switching stations, booster stations, etc; \n(b) Approval for energization of High Tension installations mentioned above \nincluding Over Head Equipment ; \n(c) The application should be accompanied by documents as prescribed in \nVolume II(Part-I) of the Manual of AC Traction Maintenance and \nOperation, 1994 (sub-paragraph 2 of paragraph 21007) \n(2) On receipt of an application under sub -rule(1), the Electrical Inspector shall \nscrutinize and inspect the design and installations in respect of th e following, \nnamely :- \n(a) The layout and design for substations, Over Head Equipment and other \ninstallations for compliance with The Electricity Act 2003 and the rules \nmade thereunder; \n(b) Inspection of the completed installations, either personally or by deputiz ing \nhis officers for compliance with the safety requirements. \n(3) After conducting the inspection under sub -rule (2), the Inspector shall covey his \napproval for the energization of 25kV or 2x25kV feeder lines from traction sub -\nstation to feeding posts, switchi ng stations, booster transformer stations and \nAuxiliary transformer stations, subject to such directions as he may consider \nnecessary. \n42. Submission of application to Principal Chief Electrical Engineer An application shall \nbe submitted to the Principal Chief Electrical Engineer of Zonal Railway with all \nrelevant documents and certificates and notifications mentioned in paragraph 21008 \nand sub-paragraph 2 of paragraph 21009 of the Manual of AC Traction Maintenance \nand Operation, 1994, Volume II (Part I) alongwith the approval of the Electrical \nInspector to the Government of India for energization. \n43. Procedure for a energization of traction installations – (1)(i) After obtaining the \nsanction of the Electrical Inspector to the Government of India for energization under \nrule 41, the sub -station should be commissioned sufficiently in advance of the \nenergization of Over Head Equipment. \n(ii) Before energization of the sub -station, full communication facilities should be \navailable and power supply authorities should be ready to give power supply. \n(iii) On the appointed day necessary clearance certificate should be obtained from the \nSenior Divisional Electrical Engineer (Construction) and others who had been \nhitherto working in the sub -station premises to the effect that their staff had been \nwithdrawn and the substation could be energized. \n(iv) After final measuring of the whole installation and check on the satisfactory \noperation of all equipments including protective relays, the traction sub stations \nand other installation may be energized. \n(2) In addition to giving wide publicity through newspapers and other media, the \nStation Master shall – \n(i) Warn all passengers about the danger of 25kV or 2x25kV over Head \nEquipment and not allow them to ride on tops of coaches; \n(ii) Advise all diesel and steam engine drivers not to climb on engines when they \nare under the Over Head Equipment; \n(iii) Warn all members of the staff engaged in watering not to climb on the \ncarriages without power being made off and obtaini ng order of the \nconcerned controlling authority.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 26, + "text": "(3) Energization of Over Head Equipment shall be progressively undertaken starting \nwith 25/2x25KV feeders from the sub -stations to the feeding posts, bus bars of \nthe feeding posts followed by one sub sector after another. \n(4) Before running electric rolling stock on the newly electrified section a \nconfirmatory field test for the proper operation of the protective relays shall be \nconducted. \n(5) (i) The inspection of the entire section shall be carried out by means of an Over \nHead Equipment Inspection Car or by any other suitable me ans by the Principal \nChief Electrical Engineer of Zonal Railway. \n(ii) A responsible officer preferably the Chief Project Manager or the Chief \nElectrical Engineer (Construction) and Senior Administrative Grade officer \nof Electrical Department should accomp any the Principal Chief Electrical \nEngineer of Zonal Railway throughout the inspection. \n(iii) The engineers who had been in charge of the section during construction, \nthe Divisional Railway Manager concerned Divisional Officers should also \nbe present. \n(iv) During inspection particular attention shall be paid to the safety and \noperational aspects of the train movements and to see that staff are in \npossession of statutory rule books, instructions books, registers, forms etc. \nand the Transportation, Electric al, Permanent Way and Signaling and \nTelecommunications staff are fully acquainted with the duties to be carried \nout after A.C traction is introduced. \n(6) Subject to the inspection being satisfactory an “all concerned message” may be \nissued by the Principal Chief Electrical Engineer of Zonal Railway \ncommunicating his sanction for the introduction of commercial services under \nelectric traction. \n(7) The signaling and telecommunication requirements in 25 KV 50 Hz AC \nelectrified sections shall be in accorda nce with the provisions of Chapter 22 of \nIndian Railways Engineering Manual and Telecommunication Manual for 25 KV \n50 Hz AC Traction. \nNote- A Catechism dealing with the requirements of signaling and \nTelecommunication installations for 25 KV 50 Hz AC electr ified sections are \nenlisted as Appendices B and C to these rules.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 27, + "text": "SCHEDULE \n(See rule 5(2)) \n \nParagraphs 443 to 451 of the Indian Railways Code for the Engineering Department as \nmodified from time to time \n \n443. Plans, Sections and Design for Works – A set of plans and sections for a project \nshould consist of:- \n \n(i) General Map of the country traversed by the project scale about 25 km to 1 cm \n(ii) Index Map, scale about 2.5 km to 1 cm. \n(iii) Index Plan and Sections. \n(iv) Detailed Plans and Sections. \n(v) Plans and Cross Section. \n(vi) Plans of Station Yards. \n(vii) Detailed Drawings of Structures. \n(viii) Plans of Junction Arrangements. \n \n444. As exceptions to this rule, Index Plans and Sections and plans of stations may be \nlonger than 1200 mm if necessary, to enable all the information to be shown on one sheet. In \nsuch cases, however, the width of 840 mm should still be kept to, and the length in excess \nwhich however should not exceed 1020 mm should be folded so as not to project beyond the \nedges of the other sheet. \n A Catalogue of maps published by the Survey of India is obtainable from the \nDirector, Map Publication Survey of India, Hathibarkala Estate, Post Box No.28, Dehradun -\n248000. \n2. The latest information on availability of maps and aerial p hotographs of the region \nwould be available from the concerned Regional Director of Survey of India. \n \n445. Throughout each set of plans and sections the kilomet erage should be reckoned from \nthe same fixed point. This fixed point should, if practicable, be at that end which is in the \ndirection of the nearest set port with which the line is in through communication by rail, and \nshould be clearly defined on the Index Plan and section and on at least the first and last sheets \nof the Detailed Plans and section. If the line takes off from an existing railway station the \nzero point should be fixed at the centre of the existing station yard, and when it ends at an \nexisting station the end of the survey should be taken as the centre of that station. Each sheet \nshould be plotted in the direction of the through kilometerage so that the kilometerage may be \nread from left to right.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 28, + "text": "FORM I \n[See rule 5(1) (a)] \nCURVE ABSTRACT \n \nSECTION: LAKSHMIKANT PUR-KULPI STATION GUAGE:1.676 m \n \nLENGTH: 9.19 km \n \nDegree of curvature and \nradius \nNumber of each Length in kilometer of \nprimary curve \n1 2 3 \n1. 4.00 Degree \n(Radius 437.5M) \n1 0.49KM \n2. 3.00 Degree \n(Radius 583.33M) \n3 1.13KM \n3. 2.00 Degree \n(Radius 875M) \n2 1.30KM \nTotal 6 2.92KM \n \n Ratio of Curved Length to Total Length of line 31.97%", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 29, + "text": "FORM II \n[See rule 5(1) (a)] \nGRADIENT ABSTRACT \n \nSECTION: LAKSHMIKANT PUR-KULPI STATION GUAGE:1.676 m \n \nLENGTH: 9.19 km \n \nGradient(compensated) \nand radius \nNumber of each Length in km Percentage to total \nlength of line \n1 2 3 4 \n1 in 100 or I percent - - - \n1 in 101 to 1 in 150 - - - \n1 in 151 to 1 in 200 - - - \n1 in 201 to 1 in 300 1 0.51 5.55% \n1 in 301 to 1 in 400 2 .64 6.96% \n1 in 401 to 1 in 500 2 1.00 10.88% \n1 in 501 to 1 in 1000 1 1.10 11.97% \n1 in 1001 to Level 9 5.94 64.64% \nTOTAL 15 9.19 km \n \nSteepes Compensated Grade 1 in 3000(FALL) \nLongest Continuous length of steepest Grade 5.51km \nFollowed by: LEVEL for 0.10 km", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 30, + "text": "FORM III \n[See rule 5(1) (c)] \nGRADIENT ABSTRACT \n \nSECTION: LAKSHMIKANT PUR-KULPI STATION GUAGE:1.676 m \nLENGTH: 9.19 km \nClass of Bridge Clear span in \nmetre \nTotal Number of \nSpans \nWater Way in \nlineal metre \nLoading standard \nfor which designed \nReference to type \nplan in case of \nGirder Bridges \n1 2 3 4 5 6 \n1. Steel Girder (Riveted) - - - - - \n2. Steel Girder Welded 30.50 2 61.00 M.B.G. Loading Drawing No. B.A-\n1123 to B.A-1124 \n3. P.S.C Girder - - - - - \n4. Composite Girder - - - - - \n5. RC/PSC/SLAB/BOX \n \n- - - - - \n(I) R.C.C Slab 5.00 1 6.00 - \nM.B.G.Loading \n- \n(II) R.C.C Slab 3.05 2 6.10 -do- \n(III) R.C.C Slab 2.00 9 16.00 -do- \n(IV) R.C.C Slab 1.83 2 6.66 -do- \n(V) R.C.C Box 3.05 2 6.10 -do- \n(VI) R.C.C Box 2.90 3 8.70 -do- \n6. Arches - - - - \n(Major Bridges) 2 61.00 \n(Minor Bridges) 19 47.56 \nTotal 21 108.56 \nWaterway per km : Major Bridge : 5.64m \n : Major Bridge : 5.17 m \n : Total : 11.18 m", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 31, + "text": "Note: 1. “Major Bridges are those having a total water way of 18 lineal metres or upwards or having a clear opening of 12 \nlineal metres or upwards in anyone span. \n 2.The particulars furnished above are only for illustration \n \n \n \n \n \nFORM II \n[See rule 5(1) (d)] \nIMPORTANT BRIDGES \nBridges having a total waterway of 300 linear \nmetres or 1000 sq. metres or upward \nSECTION: GAUGE: 1.676 m \nLENGTH: kms \n \nName \nof \nRiver \nKilomete\nrage \nDrainage \narea \nSq. km. \nRise of \nordinary \nflood above \nlow water \nNumber of \neach Metre \nStop of \nbed per \nKm. \nMetre \nMean \nvelocity \nin flood \nper \nsecond \nMetre \nSectional \narea in \nflood Sq. \nMetre. \nDischar\nge per \nSecond \nCub \nMetre \nSpan Height of \nunderside of \ngirder \nAvera\nge \ndepth \nof \nfounda\ntions \nbelow \nLow \nwater \nlevel \n Metre No\n. \nAbove \nlow \nwater \nMetre \nAbove \nflood \nlevel \nMetre \n \n1 2 3 4 5 6 7 8 9 10 11 12 13", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 32, + "text": "FORM V \n[See rule5 (1) (e)] \nBALLAST AND PERMANENT WAY: \n \nSection…………… RAILWAY…………. \n \nLength: 8.78 km GUAGE 1.676 m \n \n1. The permanent way consists of 52 kg/90UT new rails of ‘Indigenous Make’ 13 M long (partly on \nsingle rail and partly on 3 -Rail Welded Panels) laid on concrete sleepers with the density of M+7 \n(1540 sleepers per km) and 50 mm stone ballast wit h minimum cushion of 250 mm under the \nsleepers. \n2. All the turnouts to be negotiated by passenger trains are of I in 12 (curved switch) elsewhere 1 in \n8.5 Certified that Tested and approved P. Way materials have been used in this section. \n \nNote: A brief description to be given of the rails, fastenings, sleepers and ballast provided. Details \nof dimensions of the rails, fishplates etc. should not be given in the case of the standard section. It \nshould be stated whether any of the material is second hand and if s o, its approximate age should \nbe give. \nIn case of new rails and fish plates manufactured in India, the name of the producer should be \ngiven. If they are imported, the name of the country of origin should be indicated. \nA certificate should also be submitted by the Chief Engineer/Engineer -in-Chief that the materials \nare of tested and approved quality and comply with the accepted specification.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 33, + "text": "FORM VI \n \n[See rule 5(1) (f)] \nSTATION AND STATION SITES \n \nSECTION: LAKSHMIKANT PUR-KULPI RAILWAY \n \nLENGTH:9.19 km GUAGE: 1.676 m \n \n \nName of Station Class \nE=Engine \nChanging \nX=Crossing \nF=Flag \nKilometerages \nfrom fixed point \nDistance Apart Clear length \nof Crossing \nloop \nRemarks \n sites Crossing Engine \nchanging \n \n1 2 3 4 5 6 7 8 \nLAKSHMIKANTPUR X 61.48 km \n(fromSealdah) \n5.35km 686.00M & \n700.00M \n \nUDAYRAMPUR Halt 66.83 \n(fromSealdah) \n3.54km \nKULPI Halt 70.67 \n(fromSealdah) \n \n \nNote:- These should ordinarily agree with the kilometerage figured on kilometer posts and telegraph posts.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 34, + "text": "FORM VII \n \n[See rule 5(1) (g)] \nSTATION ACCOMODATION \n \nSECTION: LAKSHMIKANT PUR-KULPI RAILWAY \n \nLENGTH:9.19 km GUAGE: 1.676 m \n \nName of stations Station Building Goods \nShed \nPassenger Platforms Goods \nPlatfor\nm \nLength \nWater Supply for \nPassengers \n Station \nOffices \nWaitin\ng \nRoom \nWaiting \nHall \n(2nd \nCl.) \nToilet\ns \n Length Height \nabove Rail \n \n Sq.m Sq.m Sq.m Nos Sq.m m m m \nLAKSHMIKANT\nPUR \n50.00 - 50.00 - 65 (P1)237.74\nm \n(P2)274.40\nm \nH.L.(Com\nmon) \nH.L.(Com\nmon) \nNil Hand Tube well on both \nthe Platforms 300/200 mm \ndiaDeepTubewell with \n50,000 Gallons Capacity \nO.H Tank \nUDAYRAMPUR 9.30 - 9.30 - - 213.36 m -do- Nil One tubewell with hand \nPump at Station \nKULPI 26.10 - 29.67 - - 275.00 m -do- Nil One Hand Tubewell on \nPlatform \nNOTE: (1) In case existing accommodation is to be utilized, indicate so by(a) \n (2) The particulars shown above are illustrative.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 35, + "text": "FORM VIII \n \n[See rule 5(1)(h)] \nSTATION MACHINERY \n \nSECTION: LAKSHMIKANT PUR-KULPI RAILWAY \n \nLENGTH:9.19 km GUAGE: 1.676 m \n \nNames of \nStation \nInter-\nlocked \nInterlocki\nng \nNon-\ninterlock\ned \nSIGNALS Type of \nBlock \nworking in \nuse \nWeigh \nBridge \nNo. & \nCapacit\ny \n Isolated Warners/\nDistant \nOuters Home Starters Advance \nStarter \n \n1 2 3 4 5 6 7 8 9 10 11 \nLAKSHMIKA\nNTPUR \nYes - - Yes - Yes Yes Yes Single line \nBlock \nInstrument \nNil \nUDAYRAMPU\nR \nNo Yes - - Halt Nil \nKULPI No Yes - - One Train \nonly \nWorking \nSystem \nNil \n \nNOTE: The particulars furnished in this form are illustrative.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 36, + "text": "FORM IX \n[See rule 5(1)(i)] \nLEVEL CROSSING ABSTRACT \n \nSECTION: RAILWAY \n \nLENGTH: GUAGE: 1.676M \n \nNo of \ncrossi\nng \nLocatio\nn \nKilome\ntres \nClass \nas \nprescri\nbed in \nthe \nperma\nnent \nway \nmanual \nLen\ngth \nof \nthe \nGua\nrd \nRail \nWid\nth \nof \nthe \nGat\nes \nat \nrigh\nt \nangl\ne to \nthe \ncent\nre \nline \nof \nRoa\nd \nDista\nnce \nof \nGate \nPosts \nfrom \ncentre \nline \nof \nneare\nst \ntrack \nWick\net \nGate \nprovi\nded \nor not \nLeng\nth of \nstrai\nght \nporti\non of \nroad \noutsi\nde \nGate\ns \nAngl\ne of \nXing \nbetw\neen \nGates \nRadius \nof \ncentre \nline of \nroad on \napproa\nches \nwithin \n(50M) \nof the \ncentre \nlines of \ntrack \nInterloc\nking of \ngates \nwith \nsignals \nor \nprovisio\nn of \ntelepho\nne etc. \nagainst \ntrains \nrunning \nthrough \ncorssing \nGradi\nent of \nRoad \nway(a\n) \nbetwe\nen \ngates(\nb) out \nside \ngates \nWidth \nof \nmetall\ning \nbetwe\nen \ngates \nDista\nnce \nof \ngate \nlodge \nfrom \n(i) \ncentre \nof the \nneare\nst \ntrack \n(ii) \nedge \nof \nroad \nmetal \nWheth\ner \nroad \ntraffic \nhas \nbeen \nwarne\nd \nabout \nthe \nproxi\nmity \nof \nlevel \ncrossi\nng \nProvisi\non of \nrumble \nstrip/sp\need \nbreaker \n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 37, + "text": "FORM X \n[See rule 5(1)(j)] \nBRIEF PARTICULARS OF TRACTION INSTALLATION \n \nSECTION: Tundla-Delhi NORTHERN RAILWAY \n \nLENGTH: 292 RKM GUAGE: 1.676 m \n \n1. Total track kms electrified section – 650 \n2. Brief particulars of traction system:- \n \nThe type of Over Head Equipment installed on main line of the sectio n is of the simple \npolygonal with swive lling brackets having tensions in the conductors regulated \nautomatically. The tension in the catenary and contact wire is kept as 1000 kgf each. The \ncontact wire has been given a presage of 103mm for a span of 72m (suitably reduced for \nsmaller spans). On secondary lines and yards the Ov er Head Equipment is of fixed ty pe and \nunregulated. The contact wire is grooved hard drawn copper with 107 sq. mm cross section \nsupported by means of copper droppers from catenary which is standard (19.210mm) with \n65mm cross section made up of cadmium copper having 80% conductivity. The maximum \nwind pressure for design of masts and foundation has been taken ---------------- kg/sqm. \nMaximum span adopted on main lines is 63m. The Over Head Equipment has been de signed \nfor a maximum speed of 160 km/h. \n \nNote: The entry in the said space may be filled by time to time. \n \nThe power supply is taken from Uttar Pradesh Sta te Electricity Board at a single point viz. \nAlight from where railways own transmission lines are run for feeding the sub -stations \nlocated at Hatras, Khurja and Sahibabad and at each of the sub -stations two power \ntransformers 12.5 MVA, 132/25 KV are insta lled, one of them acting as standby. Standard \narrangement of having neutral section 41m in length has been provided between two sub -\nstations for separation of phases. From sectioning and isolating facilities sub sectioning and \nparalleling stations have been provided. All the switching operation at power supply stations \nare remote controlled from a single remote control centre located at Tundla. The Remote \nControl Centre or Supervisory Control and Data Acquisition system has been provided by --\n----------------------------- (Manufacturer) and is of ----------------- Type (Microprocessor or \nPersonal Computer based). The same will be commissioned by ------------- (Target Date, if \nnot commissioned at the time of making application to Commissioner of Railway Safety) \nNote: The Railway will provide suitable information as per sample. \n \nChief Project Manager or OR Chief Electrical Engineer (Construction) \n \nChief Electrical Engineer Open Line Railway” \n(In-charge of Project)", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 38, + "text": "FORM XI \n[See clause (k) of sub-rule (1) of rule 5] \n \nPOWER SUPPLY INSTALLATION ABSTRACT \n \nSECTION: …………. RAILWAY: \n \nLENGTH: ….…KM GUAGE: 1.676 m \n \nSl. No. Type of Switching Stations Total \nNos. \nLocation and Nearest \nRailway Stations \nRemarks \n(1) (2) (3) (4) (5) \n1 Traction substation and feeding \nstations \n3 \n2 Sectioning and paralleling stations 3 \n3 Sub-sectioning and paralleling \nstations \n14 \n4 Sub-sectioning stations Nil \n5 LT Supply transformer stations 23 (List to be attached) \n \n \n \nChief Project Manager or OR Chief Electrical Engineer(Construction) \nChief Electrical Engineer Open Line Railway \n \n (In-charge of Project)", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 39, + "text": "FORM XII \n[See clause (l) of sub-rule (1) of rule 5] \n \nTRACTION MAINTENANCE DEPOT ABSTRACT \n \n \nSECTION: …….….. RAILWAY: \n \nLENGTH:……KM GUAGE: 1.676 m \n \nSl. \nNo. \nLocation Name of the nearest Railway \nstations and distance therefrom \nWhether with OHE \nmaintenance car (tower \nwagon provided or not \nRemarks \n(1) (2) (3) (4) (5) \n1 Km 1370/15-\n16 \nHathras 2.0 kms \ntowards Delhi \nYes - \n2 Km 1454/7-8 Sakur Basti \n 1.5 km towards Delhi \nNo - \n \n \nChief Project Manager or OR Chief Electrical Engineer(Construction) \nChief Electrical Engineer Open Line Railway \n \n (In-charge of Project)", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 40, + "text": "FORM XIII \n[See clause (m) of sub-rule (1) of rule 5] \n \nRESTRICTED OVER HEAD EQUIPMENT CLEARANCES ABSTRACT \n \nSECTION: ….. RAILWAY: \n \nLENGTH: KM GUAGE: 1.676 m \nA. Overline Structures \n \nS. \nNo. \nLocati\non of \nOverli\nne \nStructu\nre \nType of \nStructure \nClearance \nfrom R.L. \nto Bottom \nof \nStructure \nHeight of \nContact wire \nbelow the \nstructure \nWhether \nCatenary is \nanchored or \nFreely \nRunning \nBelow/Abov\ne the \nStructure \nMinimum \nStatic \nClearance \nbetween 25 \nKV Live Parts \n& Earth \nRemarks \n(1) (2) (3) (4) (5) (6) (7) (8) \nB. Location of OHE where specified (2.0m) working clearance are not available \n \nS.No Location Type of nearest earthed part Actual distance \nbetween live part \nand earth \nRemarks \n(1) (2) (3) (4) (5) \n1 Km. 1172/3-4 \nUp line \nOHE structure at location \n1172/5-6 On line \n1.85 m \n \n \nChief Project Manager or OR Chief Electrical Engineer(Construction) \nChief Electrical Engineer Open Line Railway \n \n (In-charge of Project)", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 41, + "text": "FORM XIV \n[See clause (n) of sub-rule (1) of rule 5] \n \nELECTRICAL CROSSING OVER RAILWAY TRACKS ABSTRACT \n \nSECTION:….….. RAILWAY: \n \nLENGTH:….KM GUAGE: 1.676 m \n \nS.N\no. \nLocati\non \nBrief Tech. \nParticulars \nIncluding \nvoltage \nWhether with \nGuards OR \nw/o Guards \nOwned by Whether \nclearance as per \nthe regulation \nfor Electrical \nCrossing \navailable \nRemarks \n(1) (2) (3) (4) (5) (6) (7) \n1 1321/3\n-4 \nThree phase \nsingle circuit \nw/o guards Uttar Pradesh \nState \nElectricity \nBoard \nNo Relaxation \ngiven in terms \nof cl. 22 of the \nregulation. The \nheight of lowest \nconductor from \nRail level is \n11.4M \n2 1327/1\n3/14 \nDouble circuit \nthree phase 11 \nKV inside \nstation area \nWith guards Aligarh \nElectric \nSupply \nYes \n \n \nChief Project Manager or OR Chief Electrical Engineer(Construction) \nChief Electrical Engineer Open Line Railway \n(In-charge of Project)", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 42, + "text": "FORM XV \n[See rule 5(1)(3)] \nLIST OF QUESTIONS AND ANSWERS \nSECTION \nLength in km \n \nSl. \nNo. \n(1) \nQuestions \n(2) \nAnswers \n(3) \n Formation Earthwork \n1 Are there any sections of the line over which special \nprecautions to ensure safe working are necessary, owing \nto sharp curves or steep grades? \n \n2 What widths of formation have been adopted: \n(a) In bank, \n(b) In cutting (exclusive of side drains)? \n \n3 Have any special precautions been taken against slips in \ncutting and embankments? \n \n4 Are side drains to the formation and catch water drains \nabove the side slopes, provided for all cuttings? \n \n5 Are trolley refuges necessary in any long cuttings, and if \nso, have they been provided at suitable intervals? \n \n TUNNELS \n6 Are there any tunnels not fully lines? \n7 Do any portions of the sides or roof of any tunnel infringe \nmaximum and minimum dimensions? \n \n8 Have adequate facilities been provided to enable \nworkmen to escape from an approaching train without \ndifficulty? \n \n9 Have the tunnels been properly ventilated? \n BRIDGES \n10 Are the bridges/elevated structures designed in \naccordance with the provisions contained in Bridge Rules, \nhaving regard to the standards of loading which they are \nintended to carry? Full particulars should be appended of \nany case of departure from the requirements? \n \n11 Has due care been taken to provide sufficient waterway to \nguard against scour? \n \n12 Are free board and vertical clearance under bridge \nprovided according to bridge sub structure code? If not,", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 43, + "text": "quote sanction number with date. \n13 Has due notice been taken of Railway affected works in \nthe catchment of the waterways and all necessary \nsafeguards provided for washaways and breaches due to \nbreaching of tanks/bunds? \n \n14 Have the waterways provided been formally approved by \nthe Local Government? \n \n15 Have sufficient head -way been provided for crafts plying \nor likely to ply, on navigable waters? \n \n16 Are there any bridges intended for use by the public? \n(a) If so, in the case of a road or pathway clear of the \ntrack, have adequate handrails or parapets been provided? \n(b) Or in the case of a passage common with the track, \nhave suitable gates across the roadway, and signals for \ntrains been provided? \n \n17 Are long bridges provided with adequate facilities to \nenable workmen to stand clear of an approaching train \nwithout difficulty? \n \n18 Have trolley refuges been provided if necessary? \n19 Are the wooden sleepers, adequately protected from fire? \n20 Are all girder bridges provided with guardrails< Are there \nany bridges where it is necessary to provide guard rails \nbut these are not yet provided? \n \n21 Has information of the nature and depth of the fo undation \nand hidden work in bridges, culverts and other structures \nlikely to be exposed to scour, been recorded on the \nstructures, themselves? \n \n22 Have surplusing arrangements been made for canals \ncrossing track? \n \n23 Have completion drawings of all important bridges and \nother structure been prepared? \nDo these contain all information regarding foundations \nand other hidden work as actually executed< where are \nthey recorded? \n \n LAND BOUNDARIES AND FENCING \n24 Have the boundaries of the Railway land been properly \ndefined by suitable marks, which can readily be found \nand identified? \n \n25 Have complete and accurate land plans been prepared and \ndo they bear the signature of the responsible Civil and", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 44, + "text": "Railway Officer concerned? \nWhere are they recorded? \n LEVEL CROSSINGS \n26 Has the Local Government approved the sitting and \nclassification of the level crossings? \n \n27 Have all level crossings been constructed in accordance \nwith the Standard Specifications for level crossings (vide \nChapter IX of P.Way Manual ) according to the class of \ncrossing? \n \n KILOMETER AND GRADIENT POSTS \n28 Are proper Kilometer and gradient posts provided? \n(a) Are the telegraph posts numbered, and \n(b) can the figures be read with ease from passing trains \nand trolleys? \n \n29 From which fixed point has the Kilomet erage been \nreckoned? \n \n BALLAST AND PERMANET WAY \n30 Is the ballast provided of good quality and sufficient in \nquality for the traffic anticipated? Is there any departure \nfrom permanent way Manual? \n \n31 Is the permanent ways properly laid, complete with \nfastenings, and is it suitable for the proposed speed & \nloads? \n \n32 Are there any especially sharp curves at which checkrails \nare considered necessary? Have they been provided at all \nsuch curves? \n \n33 Are the curves laid out with transition curves at each end? \n34 Have all curves been adequately super elevated for the \nspeeds in force? Is the super -elevation to be given to each \ncurve indicated at site? \n \n STATION FACILITIES \n35 Have Maximum and Minimum Dimensi ons in station \nyards been observed? \n \n36 Has su itable accommodation for passengers been \nprovided at all stations? \n \n37 Have latrines been provided on platforms and are they \nproperly situated, constructed and lighted? \n \n38 Are there proper arrangements for supplying drinking \nwater? \n \n39 Is foot over bridges or sub -ways for crossing the line", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 45, + "text": "provided where necessary? \nAre any landings provided \nAre the rise and tread of steps properly proportioned? \nIf the total height of steps exceeds 4.57 metres , it is \nusually desirable that there should be an intermediates \nlanding not less than 1.22 metres I length. \n40 Are the name s of statio ns shown both in Hindi and \nEnglish and in vernacular language, in large and distinct \nletters in conspicuous positions so as to be seen readily by \npassengers in the trains both during day and night? \n \n41 Are clocks provided at all block stations? \n SIGNALLING AND \nTRELECOMMUNCATION/BLOCK WORKING \n \n42 Have the requirements and recommendations for \nsignaling and interlocking, and the catechism for \nsignaling and interlocking installations vide Chapter VII \nof these rules, and the appendix thereto, being fully \ncomplied with, according to the class of signali ng and \ninterlocking installed? If not, in what respect do the \narrangements provided fall short of them? \n \n43 Have the requirements and recommendations for \nsignaling and telecommunication installations in \naccordance with the instructions issued for the \ninstallations of S&T equipment in 25KV 50Hz electrified \nsections been complied with? If not, in what respect the \narrangements provided fall short of them? \n \n STATION WORKING \n44 Is provision made, whether by trap points or other means, \nto prevent, vehicles standing on sidings, from fouling any \nrunning line? \n \n45 Are there any stations situated on a steeper grade than 1 in \n400? If, so what special safety devices are adopted and/or \nspecial rules enforced at those Stations? \n \n46 What safety sidings are provided? \nAre they suitable? \nAre any others necessary? \nNote1: No station should be constructed nor should any \nsiding join a passenger line on a steeper gradient than 1 in \n260, except where it is unavoidable, and then only with \nthe previous sanction of the Railway Board obtained", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 46, + "text": "through the Commissioner of Railway Safety, when a slip \nsiding or other arrangements is made, sufficient to prevent \naccidents. \n@Note2: At any station situated in the immediate \nneightbouthood of an incline steeper than 1 in 80 falling \ntowards the station and 1 in 100 falling away from the \nstation, a catch siding in the former case, and a slip siding \nin the latter case, should be provided, if necessary, in a \nsuitable position. The take off points to a catch siding or a \nslip siding should normal ly be set and locked for the \nsiding, except where required to be trailed through. \n“For the purpose of the footnotes marked 1 and 2 the \ndefinition of a station yard as given in item 2 of Chapter \nII of Schedule of Dimensions shall apply”. \n47 Are station yards so arranged that shunting past junctions \nor level crossings may be avoided as far as possible? \n \n48 Are shunting necks for goods working provided in large \nyards, where shunting operations cannot otherwise be \ncarried on without interfering with incoming trains? \n \n ROLLING STOCK \n49 Is the following information noted in a conspicuous \nposition on each vehicle? \n(i) Passenger Carriages - The maximum number of \npassenger intended to be carried in each compartment of \nevery description of carriage? \n(ii) Goods wagons - The tare weight of the empty \nwagon(including wheels, axles and axle boxes and \nsprings) and the maximum load, in tones, which the \nwagon is constructed to carry? \n \n50 Are means for communications between passengers and \nthe guard, provided in all trains carrying passengers? \n \n51 Have all engines and tenders, and all vehicles intended to \nrun on passenger trains been fitted with the vacuum/air \nbrake? \n \n52 Are all locomotive & motor coaches provided with: \n(a) Cattle guards \n(b) High power headlights \n(c) Other prescribed safety equipments. \nNote: This information should be in the vernacular \nlanguage as well as in English and Hindi.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 47, + "text": "Except in the case of complete o r partial failure of \nvaccume, trains carrying passengers may run without \nsuch means of communic ation, only in accordance with \ngeneral Rule 4.18. \n FACILITIES FOR BOOKING \n53 Are suitable arrangements made at all stations for the \nbooking of passengers? \n \n54 Are suitable weighing machines provided at all stations \nopen for goods/parcel booking? \n \n55 Are time and fare t ables placed in a convenient position \nfor inspection by the public at each station? Are these \ndocuments clearly exhibited in Hindi & English and also \nthe vernacular language of the district? \n \n56 Is a copy of the general rules for regulating the working \nof the railway available for inspection at every station? \n \n57 Is every station provided with station diagram, station \nworking orders, coaching and goods tariffs, and all other \nnecessary manual or instructions, forms and registers for \nthe work of the station? \n \n58 Do the working orders provided suitably for all special \nconditions met with at each station? \n \n ELECTRICAL \n59 Have the Rules for the Design and Inspection of \nequipment for Electric Traction (Vide Chapter IX of these \nrules) been individually and fully complied with? \nIf not, where and in what respect, do the arrangements \nprovided fall short of them? \nGENERAL \nWhat provision of Medical First Aid equipment has been \nmade for use in the event of accident?", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 48, + "text": "FORM XVI \n[See rule5(4)] \nCERTIFICATES TO BE GIVEN BY GENERAL MANAGER \n \nI do hereby certify:- \n \n \n(i) that the Maximum Dimensions for railway in Indian have in every case been worked to, with \nthe exceptions detailed in the statement herewith annexed \n \nAlso, that the Standard Dimensions will be observed in future, and that no work or structure \ninfringing the Standard Dimensions will hereafter be permitted without the sanction of the \nCentral Government. \n(ii) that each bridge is of such design, dimensions and construction as will enable it to bear the \ndead load of the structure itself (with flooring, roadway, permanent way etc. complete), and in \naddition thereto, the equivalents of the live loads specified in the rules prescribing Standards of \nthe Design and loading for Railway bridges, without exceeding the maximum permissible stress \non the available material in any member or portion of the structure. \n \n(iii) that more than two engines shall not under any circumstances be allowed at one time on the \nsame track of one span of any bridge. \n \n(iv) that every coaching vehicle constructed or procured for the use of the railway in mail and \npassenger trains is, and shall be provided with vacuum/air brake and effective means of \ncommunication between passengers, guard and driver. \nNote: This item of certificate is not necessary for those light lines on which the use of vacuum or \nair brake has not been insisted upon. \n \n(v) that one compartment or such number of berth or seats, as the railway administration may \nthink fit, of a second class carriage of every train carrying passengers shall be reserved for the \nexclusive use of females. \n \n(vi) that the railway shall be worked on the system known as Absolute Block System in \naccordance with the regulations prescribed in section Chap ter VIII of the General Rules for \nRailways in Indian. \n \nNote: In the statement showing the cases in which the Maximum and Minimum dimensions have \nbeen infringed full details for each case must be given, in the form attached (Form XVII) with \nexplanation of the necessity for such infringements and a reference to the authority under which \nit was permitted. If there have been no infringements of the Maximum and Minimum", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 49, + "text": "Dimensions the words, “with the exception detailed in the statement herewith annexed”, should \nbe omitted or stuck out. \n \n(vii)#that the electric tract ion equipment can be used for the public carriage of passengers \nwithout danger to the public and that the rules for design and inspection of equipment for electric \ntraction of Chapter VIII of these rules) have been complied with. \n(viii) That the signaling and telecommunication equipment have been installed in accordance \nwith the approved instructions and they are safe for passing traffic. \n \n(ix) that ………….. has been delegated to accompany the Commissioner of Railways Safety on \nhis inspection and all informat ion supplied or engagements entered into by him shall bear my \nauthority. \n \n#Note: to be included only where applicable. \n \n \n[Sd/-………………………] \nThe General Manager", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 50, + "text": "FORM XVI A \n[See rule 4A] \nCERTIFICATES TO BE GIVEN BY CONCERNED SENIOR ADMINISTRATIVE \nGRADE OFFICER \nI do hereby certify:- \n \n(i) that the Maximum Dimensions for railway in India have in every case been worked to, \nwith the exceptions detailed in the statement herewith annexed \nAlso, that the Standard Dimensions will be observed in future, and that n o work or \nstructure infringing the Standard Dimensions will hereafter be permitted without the \nsanction of the Central Government. \n(ii) that each bridge is of such design, dimensions and construction as will enable it to bear the \ndead load of the structur e itself (with flooring, roadway, permanent way etc. complete), \nand in addition thereto, the equivalents of the live loads specified in the rules prescribing \nStandards of the Design and loading for Railway bridges, without exceeding the maximum \npermissible stress on the available material in any member or portion of the structure. \n(iii) that more than two engines shall not under any circumstances be allowed at one time on \nthe same track of one span of any bridge. \n(iv) that every coaching vehicle construct ed or procured for the use of the railway in mail and \npassenger trains is, and shall be provided with vacuum/air brake and effective means of \ncommunication between passengers, guard and driver. \n Note: This item of certificate is not necessary for those lig ht lines on which the use of \nvacuum or air brake has not been insisted upon. \n(v) that one compartment or such number of berth or seats, as the railway administration may \nthink fit, of a second class carriage of every train carrying passengers shall be res erved for \nthe exclusive use of females. \n(vi) that the railway shall be worked on the system known as Absolute Block System in \naccordance with the regulations prescribed in section Chapter VIII of the General Rules for \nRailways in India. \n Note: In the state ment showing the cases in which the Maximum and Minimum \ndimensions have been infringed full details for each case must be given, in the form \nattached (Form XVII) with explanation of the necessity for such infringements and a \nreference to the authority unde r which it was permitted. If there have been no \ninfringements of the Maximum and Minimum Dimensions the words, “with the exception \ndetailed in the statement herewith annexed”, should be omitted or stuck out. \n(vii) That the signaling and telecommunication equipment have been installed in accordance \nwith the approved instructions and they are safe for passing traffic. \n(viii) that ………….. has been delegated to accompany the Commissioner of Railway Safety \nPrincipal Chief Engineer or Principal Chief Electrical E ngineer or Principal Chief Signal \nand Telecommunication Engineer on his inspection and all information supplied or \nengagements entered into by him shall bear my authority. \n \n \n[Sd/-………………] \nCONCERNED SENIOR ADMINISTRATIVE GRADE OFFICER", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 51, + "text": "FORM XVI B \n[See items (h) to (j) specified in proviso to sub-rule (3) of rule 3 and rule 4B] \n \nCERTIFICATE TO BE GIVEN BY HIGHER ADMINISTRATIVE GRADE OFFICER \n \nI do hereby certify:- \n \n(i) that the Maximum Dimensions for railway in India have in every case been worked \nto, with the exceptions detailed in the statement herewith annexed and also, that the \nStandard Dimensions will be observed in future, and that no work or structure \ninfringing the Standard Dimensions will hereafter be permitted without the sanction \nof the Central Government. \n \n(ii) that every coaching vehicle constructed or procured for the use of the railway in mail \nand passenger trains is, and shall be provided with vacuum or air brake and effective \nmeans of communication between passengers, guard and driver. \n \nNote: T his item of certificate is not necessary for those light lines on which the use of \nvacuum or air brake has not been insisted upon. \n \n(iii) that the railway shall be worked on the system known as Absolute Block System or \nAutomatic Block System in accordance with the regulations prescribed in section \nChapter VIII or Chapter IX of the General Rules for Railways in India. \n \nNote: In the statement showing the cases in which the Maximum and Minimum dimensions \nhave been infringed full details for each case must be g iven, in the form attached (Form \nXVII) with explanation of the necessity for such infringements and a reference to the \nAuthority under which it was permitted. If there have been no infringements of the \nMaximum and Minimum Dimensions the words, “with the ex ception detailed in the \nstatement herewith annexed”, should be omitted or stuck out. \n \n(iv) that the signaling and telecommunication equipment have been installed in \naccordance with the approved instructions and they are safe for passing traffic. \n(v) that ………….. has been delegated to accompany the General Manager on his \ninspection and all information supplied or engagements entered into by him shall \nbear my authority. \n \n[Sd/-………………] \nHigher Administrative Grade Officer", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 52, + "text": "FORM XVII \n[See rule 5(5)] \nINFRINGEMENT OF MAXIMUM AND MINIMUM DIMENSIONS \n \n \nSECTION RAILWAY \n \nLENGTH \n GUAGE:1.676M \n \n \nSl. \nNo. \nLocation Name of \nStructures \nwhich \ninfringe \nPrescribed \nmaximum and \nMinimum \nDimensions \nExisting \nActual \nDimensio\nn \nAmount of \ninfringeme\nnt \nParticular of \nsanction to \ninfringemen\nt & \nRemarks \n Division \nand \nSection \nKilomet\nerage \n Chapter/\nItem \nMaximu\nm & \nMinimu\nm", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 53, + "text": "FORM XVIII \n[See rule 17(6) and 17(7)] \nDEFLECTIN TESTS OF BRIDGES \n \nSECTION: Date of Tests…………………………… RAILWAY \n \nLENGTH: Description of Test Load(Including Engine No.)……………….. GUAGE:1.676M \n \n \nBridg\ne \nNumb\ner \nKilomete\nrage \nMaterial \nof girders \nClear \nSpan \nbetween \nbearing \nplates \nOverall \nDepth of \ngirders \nSpeed \nof \ntrain \nTest \nLoad \nEUDL \nDeflecti\non in \nM.M \nDesign \nload \nDUDL \nfor B.M \nRation \nof \nDesign \nload \nB.M to \ntest load \nB.M \nReduced \nDeflection \nunder \ndesign \nload(for \nSlow \nspeed \ntests)=(8x\n10) \nTheoretic\nal(calcula\nted) \ndeflection \n(approx.) \nunder \ndesigned \nload \n1 2 3 4 5 6 7 8 9 10 11 12", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 54, + "text": "APPENDIX A \n[See rule 36(9)] \nDIAGRAM ILLUSRATIN METHODS OF \nPROVIDING ISOLATION", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 55, + "text": "APPENDIX B \n[See rule 43(7)] \nCATECHISM FOR SIGNALLING AND \nINTERLOCKING INSTALLATIONS \n \nINSPECTION AT THE SIGNALS: \n \n \n(1) Are all running signals controlling trains placed in such a position and at such a height abo ve rail \nlevel so that they can be clearly seen by Drivers in sufficient time and be readily distinguished by \nnigh or by day from the subsidiary signals? \n \n(2) Are all signals constructed so that their normal position is at “ON” or most restrictive and th at \nthey stand at or return to this position in case of failure of any part of the signals or their connections? \nNote: This paragraph does not apply to automatic signals, the normal position of which is “OFF” \n \n(3) Do all signals come fully “OFF” when worked and return freely to the “ON” position? \n \n(4) In the case of slotted or controlled signals, can the signals be freely returned to danger by either of \nthe controlling agencies? \nNote: This paragraph does not apply where signals are controlled by key transmitter s or similar form \nof control. \n \n(5) Are signal counter weights, where possible, fixed out of reach? \n \n(6) Is the facing side of the arms of all semaphore Sign als (incl uding miniature and disc signals) \npainted the same colour as the light exhibited in the “ON” position? \nNote: This paragraph does not apply to calling on signals. \n \n(7) Are signals not in use fixed at “ON” and distinguished by having two crossed bars attached to \nthem each bar being not less than one 1 meter long and 100 millimetres wide? \n(8) Are all signals of standard type and do th ey comply with the requirements as laid down in the \nGeneral Rules and have they been passed by the Sighting Committee? \n \n(9) (i)Are all fixed signals, the front light of which cannot be seen from the point from which t hey are \nworked, provide with a small white back light not larger than is actually necessary and visible only \nwhen the signal is at “NO”? Also is the fixed green light of every Warner, which is used by it, \nprovided with a white back light? (ii) Do all the d istant signals in Multiple Aspect area show two \nback lights in the “ON” position and no light in any other position or where electric lighting of distant \nsignals is provided, it shows at least one back light in the ‘ON’ position?", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 56, + "text": "Note: Colour light signals need not be provided with back lights since these are provided with visual \nindicator. \n \n(10) Do miniature and dwarf signals, used to control shunting show the same front and back light, as \nare prescribed for running signals and are the lenses small enough to make them distinguishable from \nrunning signals? \n \n(11) Are signal lamp brackets fixed on the posts, and is suitable provisi ons made for lighting and \ncleaning lamps? \n \n(12) If any signal is placed at more than 180m away from the facing points it controls, is arrangement \nmade to keep the points locked until the train has passed them? \n \n(13) Are all signal arms placed on the left -hand side of the post as seen by the Driver of approaching \ntrains to which the signals refer? \n \n(14) Are all signal posts placed on t he left-hand side of the track of approaching trains to which they \nrefer? If placed otherwise, for what reason? \n \n(15) Where two or more lines diverge, are the signals fixed on a bracket post or on separate doll posts \ncarried on a signal bridge? \n \n(16) Where two or more lines converge, are the signals fixed on altogether separate posts or on \nseparate doll posts carried on a signal bridge? \n \n(17) Are bracket and bridge signals arranged so that each signal from left to right, from the point of \nview of approachin g trains applies to each corresponding line from left to right, and are they \ndistinguished by “grouping” and by making the more important signals higher than those of lesser \nimportance? \nNote: The highest arm must always refer to the straight line. \n \n(18) In the case of two or more signals referring to parallel lines, are they arranged in transverse line \nas nearly as circumstances allow? \n \n(19) Does any case occur of more than one signal referring to trains moving in the same direction \nbeing placed on the same post, other than Warner, shunt or calling on signals? \n(20)(a) Are Warner Signals fixed 1.5 to 2m’s below a stop arm or fixed green light? \n(b) Are “Co -acting” or “Calling on” signals placed not less than 2.5 m below the Samaphore arm \nabove?", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 57, + "text": "(21) Are Warner Signals, which are un-worked, secured in the “ON” position? \n \n(22) Are arrangements made to render it impossible for the Warner arm to be taken off independently \nof the stop arm above it and when the st op arm returns to danger, the Warner if “OFF” au tomatically \nreturns to danger? \n \n(23) At diverging junction, is one Warner Signal only provided applying to the through line? \n \n(24)(a) Do all signal lights show red in the “ON” position, Or yellow/double yellow in the case of \nDistant signals, or no light in the case of Calling on Signals? \n \n(b) Do all running signal lights show Green in the “OFF” position in two aspect signaling sections \nand yellow double yellow/green in multi aspect signaling sections? \n \n(25) Are signals where necessary effectively guyed? \n \nII. INSPECTION AT THE POINTS: \n \n1. Is the locking of facing points such that the points cannot be or become unlo cked while a train is \npassing over them ?i.e. \n(a) are lock bars provided of the length exceeding the greatest distance between any two adjace nt \naxles likely to be used on t he line or alternatively is the point or lock lever electrically controlled by \ntrack Circuits? \n(b) in the case of key locks, are the locks either under the train and therefore inaccessible; or if not \nplace under the train, is th e arrangement such that the key is used to release the signals and that it \ncannot be brought back to the points until such signals have been put to the “ON” position?. \n \n2. Is the arrangement such that the operation of the facing point lock depends on the c orrect operation \nof the lock bar where use d, and is it impossible for the lock bar to be forced over while a train is \npassing over it? \n \n3. Are the locks of a substantial patter n and make? Are they fixed in such a manner as to ensure the \nnecessary rigidity and are key sufficiently large and strong to minimize the chance of their being \nmislaid or broken? \n \n4. Do key locks fitted to facing points on passenger running lines lock both switches? \n \n5. Are switches adjusted to come tight against stock rails? Does the insertion of a 5mm obstruction \npiece between the switch and stock rails 150 mm from the toe of the switch prevent the points being", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 58, + "text": "locked and prevent the relevant signal from being taken “OFF” the giving of which is preceded by the \nlocking of the points. \n \n6. Do facing point lock plungers clear the stretcher blade when the points are unbolted and in the \nevent of there being an obstruction at the points, it is impossible for the point lock plunger to enter \nthe stretcher blade and for the point lock lever to be forced into its normal or reverse position? \n \n7. Are all facing points fitted with a gauge tie plate where steel sleepers are not provided at the toe of \nthe switches, and are they provided with split stretcher bars or other fitting giving equal security? \n \n8. Are all point locks and detectors securely fixed? \n \n9.(a) Are detectors fitted to all facing points and do they efficiently detected with both switches the \nsignals controlling the movement of trains over them? \n(b) IN cases where the lock and switches a re actuated by the same lever, do they detected the locking \nmechanism as well as switches? \n \n10. Are trailing points on passenger running lines used in the facing direction for shunting \nmovements which are not fitted with facing points locks detected with the relative shunt signals? \n \n11. Is it possible for any detector slide to enter a notch other than that intended for it? \n \n12. Do point indicators show the prescribed indications i.e. while for the straight and green for the \nturn out in both directions and where fitted to trap points or to derails where these are still in use, red \nin both directions when the trap is open or the derail is on the line; and green in both directions when \nthe trap is closed or the derail is off the line. \n \n13. Where the point indi cators of the directional type have been provided, has this been done under \napproved special instruction? \n \nIII. INSPECTION ON THE TRACK: \n1. Are all through lines isolated from each other, from other running lines and from all sidings? \n \n2. Are running lines isolated from all sidings and goods lines, either by- \n(a) trapping into dead ends taking off the sidings or goods lines; or \n(b) derailing switches, or derails placed on the lines giving access from the sidings or goods lines, to \nthe running lines? \n \nNote: The use of derails is now obsolete. Existing ones may, however, continue to be used but when \nthey require replacement, trap points should be substituted.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 59, + "text": "1. Are dead ends traps, derailing switches or derails where these are still in use, so locked as to \nprevent any possibility of the running line being fouled for which signals have been taken off? \n \n2. Are the dead end traps, derailing switches or derails where these are still in use, fitted with \nindicators, or are they protected by signals? \n \n3. Are these dead end traps, derailing switches or derails where these are still in use, placed in such a \nposition as to ensure that any vehicles that may be derailed by them shall not foul any running line? \n \n4.(i) Are all points worked by rodding within a distance of 320 m from the lever operating them or in \ncase of facing points on a passenger running line operated and locked by the same lever within a \ndistance of 180 m? \n(ii) If the distance are greater than those are specified above, are they within 460 m and 275 m \nrespectively, and are a stroke of not less than 200 mm provided at the lever tail? \n \n5. Is the rodding efficiently laid and properly compensated where necessary and mans for adjustment \nprovided? \n \n6. Are all signal connections efficiently installed and means for adjustment provided? \n \n \n \n \nIV INSPECTIN IN THE CABIN OR AT THE LEVER \nFRAME WHERE THERE IS NO CABIN \n \n1. Is the signal cabin provided with the following essentials?:- \n(a) A clock in cabins where train movements are registered. \n(b) A diagram correctly representing the arrangements of the points and signals worked from the \ncabin in their normal position and the number of the points and signals? \n(c) Lights so arranged as not to be mistaken for running signals or interfere with their sighting? \n \n1. Is There sufficient space in the cabin to allow the cabin man or operator freedom of movements for \nmanipulating the levers or other apparatus in the cabin? \n \n2. Is the gear leading off from the cabin or frame securely fixed? \n \n3. Are the levers painted with distinguishing colours and in addition to its own number does \neach lever bear the number of the levers, which must proceed it, and in the proper order?", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 60, + "text": "4. Is the cabin so located and built as to enable the cabin man to have the best possible view of \nall points and signals, the working of which he is responsible for and also for all movements under \nhis control? \n \n5. Are all signals, which are not visible form the cabin or frame electrically repeated? If so, does \nthe repeater repeat the light as well as the arm? \n \n6. Have instructions for working been issued to the staff and included in the Railway Working \nInstructions, and are they correct and sufficient? \n \n7. is the Station Master provided with interlocked mechanical or electrical control of the Home and \nLast Stop Signals?", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 61, + "text": "V . TEST TO BE MADE IN THE LEVER CABIN OR AT THE LEVER FRAME: \n \nNote: It is essential that the interlocking of all signals with the points must be so effected as to ensure \nthe following conditions, which may be tested fr om the cabin or frame by pulling over the levers for \neach combination allowed by the locking table and checking the security of each such combination \nby attempting to infringe it. \n \n1. Is it possible to take off conflicting signal sat the same time? \n \n2. Is it possible to take off a signal until – \n(a) all points on the running line including overlap are correctly set and the facing points locked? \n(b) all points, giving access to the running line from sidings and goods lines, are set against the \nrunning line? \n(c) Level Crossing gates, if included in or controlled by the interlocking, are locked across the \nroadway? \n(d) a signal lever, when operated locks or back locks as necessary, the levers operating the points and \ngate locks referred to in this paragraph? \n \n3. When all signals are “ON” are all points, which would be locked by the taking off of such signals, \nfree for shunting purposes? \n \n4. Is it possible to take off a Warner Signal until all the relative stop signals in advance have first \nbeen taken off and when off does it back lock such signals? \n \n5. Does the locking in the frame correspond with that shown in the approved locking table? \n \n6. Is the locking strong, durable and accurate, i.e. can an tappet enter a notch other than that for which \nit is intended, or can the locking be forced? \n \n7. Does the locking in the lever frame act on the commencement of the movement of the lever in case \nof direct locking type of lever frames and pressing the catch handle in case of catch handle/DW type \nof lever frame? \n \n8. Is release locking not effective before the completion of the movement of the lever?", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 62, + "text": "B. ADDITIONAL CATCHISM FOR POWER \nOPERATED POINTS AND SIGNALS \n \nNote:- These rules must be followed in conjunction with those laid down in the catechism for \nsignaling and interlocking installations so far as they are applicable to power working. \n \nI SIGNALS: \n \n1. Is the mechanism case weather proof and protected from unauthorized interference? \n \n2. Do the indication contacts close if the arm is more than +or -5 degrees from “ON” or “OFF” \nposition? \n \n3. Is the signal and hold off mechanism so constructed, that in the even t of a failure, the signal shall \ngo to the “ON” position? \n \n4. With the exception of motor commutators, etc .is a surface leakage distance of not less than 6mm \nprovided between any exposed metallic part of the mechanism carrying current and any other \nmetallic part thereof? \n \nThe following regulations shall apply to colour light signals only. \n \n5. Are the signals so bright as to cause confusion in reading at night? \n \n6. When lamps are operated at normal voltage, is the range(on a straight track) of signals used to \ngovern high-speed trains, not less than 200m on a clear day with a bright sun at or near its zenith? \n \n7. Are the signals so bright as to cause confusion in reading at night? \n \n8. Does the signal give a distinct indication to drivers when approaching or stopped at a signal? \n \nII. POINTS: \n \n1. Is the switch operating mechanism of substantial design securely fixed and protected from \nunauthorized interference? \n \n2. Is the mechanism provided with means for emergency operation in the event of a failure? \n \n3. Does the use of the Crank handle or other apparatus for emergency operation disconnect the power \nsupply to the motor and prevent clearance of signal for which such points are required to be set.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 63, + "text": "4. With the exception of motor commutators, is there a surface leakage distance of not less than 6mm \nprovided between any exposed metallic part carrying current and any other metallic part of the \nmechanism? \n \n5. Is the mec hanism so constructed that it can be stopped reversed or obstructed at any point of its \nmovement without damage? \n \n6. Is the mechanism so constructed that it cannot give a “Normal” or “Reverse” indication, unless the \nclosed switch be within 5mm of the stock rail and in the case of facing points the switches are \nproperly locked? \n \n7. In order to prevent the movement of points while a train is passing over them, are points provided \nwith track circuit locking?” \n \n8. Where the movements of trains over the points are not within easy visibility of the cabin, is \noccupation of the section between the stop signals leading over the points and the fouling point ahead \nof such points, electrically indicated in the cabin? \n \nIII CABIN AN DLEVER FRAME: \n \n1. In the case of power interlocking frames, is the lever frame mechanism completely enclosed with \nremovable covers giving free access to all parts and provision made for securing such covers against \nunauthorized opening? \n \n2. Have all exposed metallic par ts carrying current, not less than 6mm surface leakage distance \nbetween them and any other metallic part of the mechanism? \n \n3. Are the levers operating power worked points provided with “Normal” and “Reverse” indication \nlocks, adapted directly to prevent t he full movement of the lever, unless the point mechanism has \nmade the required movement and the points are in a position corresponding to that of the lever and in \ncase of facing points unless they are securely locked? \nNote:- This test need not apply where approved alternative electric locking is provided. \n \n4. Are levers operating power worked signals provided with “Normal” indication locks, adopted \ndirectly to prevent the full return movement of the lever to the normal posit ion, unless the arm has \nreturned to the “ON” position? \nNote:- This test need not apply to a mechanical l ever frame, if the signal is re peated at the place of \noperation through an arm and light repeater.", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 64, + "text": "5. Are all electric locks mechanically replaced to the locking position? \n \n6. Is all the wiring between different parts of the apparatus made with suitably insulated wire and \nefficiently protected? \n \n7. Is the lever frame properly earthed and are efficient safeguards provided to prevent injury to the \noperator, in the event of a short circuit or other similar circumstances? \n \nIV CABLES AND CIRCUITS: \n \n1. Do all main cables terminate in properly sealed or locked boxes? \n \n2. Are circuits controlling the operating and indication of signals so arranged, that as far as \npracticable, a cross connection or a short circuit on any of the wires, cannot give a false “Clear” \nindication? \n \n3. Are circuits controlling the operation and indication of points so arranged that, as far as \npracticable, a cross connection or a short circuit, cannot operate the switch, or give a false indication \nof the position of the points? \n \n4. Is the battery or power supply for line circuits, as far as practicable, arranged at the end of the \ncircuit farthest from the operated unit? \n \n5. (a) Are all main track circuits as far as practicable so arranged as to provide the best protection \nagainst broken rails, points crossings, etc.? \n(b) Are the adjacent track circuits staggered in polarity? \n \n6. Are sidings and junctions tracks circuited up to the fouling mark or sidings derailing where this is \ntill in use? \n \n7. Are hand worked switches, in or leading to automatic signaling territory, equipped with a circuit \ncontroller operated by the normally closed switch. \n8. Are such switches electrically locked by the approaching track circuits to prevent their movement \nin the face of an approaching train?", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 65, + "text": "APPENDIX-C \n[See rule 43(7)] \nCATECHISM FOR SIGNALLING AND \nTELECOMMUNICATION INSTALLATIONS FOR 25KV 50HZ, \nSINGLE PHASE ACT ELECTRIFIED SECTIONS \n \nSECTION-I – SIGNALS: \n \n1. Are the signals located in accordance with the approved instructions as per Manual of Instructions \nfor installation of Signalling and Telecommunications Equipment in 25KV, 50HZ AC electrified \nsections? \n2. Have the protective iron screens as required for signals/fittings within 2m of live conductor/parts \nbeen provided and earthed? \n3. Where it is not possible to provide protective iron screens, has a caution board been provided on the \nsignal posts in accordance with the approved instructions? \nHas the “Signal Sighting Committee” certified that the driver’s view of the signal is clear? \n5. Have only multi aspect signals been used in colour light signaling area? \n6. Is the AC power supply arrangement for the colour light signals of a type approved for Railway \nElectrified areas? \nSECTION-II – POINTS: \nHave the rodding transmission of points and other apparatus been insulated as per the approved \ninstruction? \nSECTION-III- ELECTRICAL SIGNALLING EQUIPMENT: \n1. Does the design of signaling equipment and the circuits used in Railway Electrified areas provided \nfor a safety factor of 1.5 against AC interference. \n2. Has it been ensured that the signaling equipment not suitable for Railway Electrified areas on \nexternal circuits like banner type indicators, Luminous indicators, telephone type relays, electrical \nlever locks, rotary key transmitter, DC neutral polar relays, 250 ohms DC neutral line relays and door \ncoils of IRS block Instrument etc. have not been used? \n3. Has it been ensured that all stick relay have at least 4 front and 4 back contacts and their pick up \ntransfer time is not less than 300 milli seconds? \nSECTION-IV- CABLING AND WIRING OF CIRCUITS: \n1. Have all telephone circuits, except cabin to cabin and cabin to ASM circuits, which may be retained \non signaling cable, been transferred to separate underground telecommunication cable? \n2. Have all overhead wire circuits been shifted or cabled as per the approved instructions? \n3. Has it been checked that the voltage induced due to parallelism in the telecommunication cable \nunder normal and short circuit conditions are within safe limits (Limits specified by the Consulting \nCommittee of International Telegraph and Telephones)? \n4. Has it been ensured that the earth return circuits are not retained and have been replaced by metallic \nreturn circuits except the block circuits?", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 66, + "text": "5. Has the principle of double cutting been used for all external signaling circuits? \n6. Have the external circuits and batteries been isolated from internal circuits and batteries? \n7. Has it been ensured that the induced voltages in the length of inter cabin telephone circuits in \nsignaling cables does not exceed 60 V? \nSECTION-V – BATTERIES: \n1. Has it been ensured that power supply for internal and external circuits and for each block \ninstrument are isolated? \n2. Has it been ensured that the battery for signaling equipment is separate from the battery for \ntelecommunication equipment? \nSECTION-VI- EARTHING: \n1. Have the lever frames and other equipment been earthe d in accordance with the approved \ninstruction? \n2. Has it been checked that no earthing pipe is less than 3 m away from any other earthing pipe? \n3. Has it been tested that the earth resistance does not exceed 10 ohms for the signaling \nequipment and 1 ohm for telecommunication copper cable earth? \n4. Has the screening of the telecommunication cable terminated at the sectionalizing points and \nrepeater stations been earthed in accordance with approved instruction? \n \nSECTION-VII TRACK CIRCUITS: \n1. Has it been ensured that track circuits are of approved type? \n2. Have measurements of DC tray currents been taken before installations of DC single rail track \ncircuits and whether these are within permissible limits? \n3. Has the longitudinal and transverse bonding in track circuited areas been provided as per the \napproved instruction? \n4. Have the DC single rail track circuits of closed type been installed in accordance with the approved \ninstructions? \n5. Have the protective measures like surge discharges (intervals off discharge) been provided on track \ncircuits, where required, as per the approved instructions? \n \n \n \nSECTION VIII- EMERGENCY CONTROL: \nHave emergency control telephone post been provided at correct regula r intervals along the track in \nelectrified areas as per the approved instruction? \n \nSECTION-IX- BLOCK INSTRUMENTS: \n1. Are the block instruments installed of a type approved for use in AC electrified sections? \n2. Have block filters for single and double line block instruments been provided in accordance with \nthe approved instructions? \n3. Are the filter units of a approved design?", + "extraction_method": "text" + }, + { + "document_id": "circulars__2023__2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_name": "2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "document_path": "circulars/2023/2023_11_23 Final_after_CORRIGENDUM_Signal dte amendment.pdf", + "doc_category": "circular", + "rule_type": "signalling_rules", + "priority": 2, + "authority": "Railway Board (Signal Directorate)", + "description": "Corrigendum amending signalling-related operational rules", + "is_static": false, + "effective_year": 2023, + "page_number": 67, + "text": "4. Have the line terminals of block filters been painted red to caution the maintenance staff against \nhigh voltages? \n5. Where a blo ck section falls between an electrified and non -electrified section, has it been ensured \nthat block filters have been provided for block instruments at either ends of such block section? \n6. Have the block telephones been provided on a separate pair of cond uctors in accordance with the \napproved instructions? \n7. Have the block circuits been provided on underground cables as per the approved instructions? \n8. Have position polarised relays of SGE block instruments been provided in accordance with the \napproved instructions? \n9. Have the block release and advance starter control of block instrument been provided in accordance \nwith the approved circuit? \n10. Has it been ensured that the circuits from non electrified section approaching and electrified \nsection and vice versa been cabled for a length of 1 km beyond the electrified section. \n \nSECTION-X- GENERAL SAFETY: \n \n1. Has the chart on method of treating electric shock been displayed in cabins and relay rooms, etc.? \n2. Has the rubber matting been provided in relay roo ms, repeater stations and cable huts etc. as per the \napproved instructions? \n3. Have special instructions been issued to the personnel that the accessible parts of t he installation \nand apparatus in the repeater stations and cable huts, connected to the telecom cable are likely to attain \nan induced voltage of 150 V AC under 5 normal working conditions and have such parts of \ninstallation and apparatus suitably marked to indicate this? \n4. Have the metallic cabinets/covers/frames of telecommunication equipme nts provided in railway \nelectrified areas been earthed properly? \n5. Are the protective devices installed on telephones provided at grid stations, 25 KV sub stations and \nswitching posts as per the approved instructions? \n6. Are the tools used by maintenance staff properly insulted. \n \n[No. 70/WDO/ORI/RO/1/Vol.IX] \nROOP NARAYAN SUNKAR, Member Infrastructure and Ex-Officio Secy. \nNote: The principal rules were published in the Gazette of I ndia, Extraordinary, Part II, Section 3, \nSub-section (i) vide number G.S.R. 625(E), dated the 21 st July, 2000 and was last amended \nvide number G.S.R. 633(E), dated the 28th August, 2023.", + "extraction_method": "text" + } +] \ No newline at end of file