pred_label
stringclasses 2
values | pred_label_prob
float64 0.5
1
| wiki_prob
float64 0.25
1
| text
stringlengths 76
983k
| source
stringlengths 40
45
|
|---|---|---|---|---|
__label__wiki
| 0.718473
| 0.718473
|
A View from the Ridge: El... A View from the Ridge: Elbows at the ready to bag a Brexit bargain
A View from the Ridge: Elbows at the ready to bag a Brexit bargain
by Sophy Ridge Published November 23, 2018 Published Nov 23, 2018
THE clock is ticking and the pressure to get a good deal is intense. Essential weapons include sharp elbows, a laser focus and an ability to cut through rubbish offers dressed up as the bargain of the century.
I’m not talking about Black Friday — the biggest shopping day of the year — but rather the Prime Minister’s quest to fix a decent Brexit divorce deal by the end of the week. And if she’s to avoid buyer’s remorse, Theresa May will need all the steely determination of a top-class bargain hunter.
Yesterday we finally got a glimpse of what the draft deal for the future relationship with the EU would look like. New elements include a specific reference to ending free movement, a determination to use technological solutions to solve the Irish border problem and a continuing role for the European Court of Justice in the interpretation of EU law.
Every choice has a consequence. Just like your Christmas shopping, if you go big on presents for Auntie Mabel, you’ll have to cut back what you give to Uncle Stuart.
Theresa May’s biggest red line is on immigration — free movement of people must end after Brexit. Her challenge has always been trying to negotiate an agreement that ends free movement and does as little economic damage as possible at the same time.
The prime minister will travel to a summit on Sunday to try to get the plan signed off by EU leaders. Some of them (most notably Spain) have already intimated they don’t like what they have seen so far.
When she returns to the UK, she faces an even tougher battle to sell her plan to MPs. Brexiteers, Remainers and — perhaps most of all — the DUP, are all deeply suspicious that they are about to be hung out to dry and that Mrs May has prioritised other people as she hunts for a deal.
Speaking on the steps of Downing Street yesterday, the PM said: ‘This is the right deal for the UK. It delivers on the vote of the referendum… That deal is within our grasp and I’m determined to deliver it.’ Last week when I interviewed her on Sophy Ridge on Sunday, she told me: ‘Nothing is agreed until everything is agreed.’
The prime minister may believe a deal is within her grasp, but like the hottest Black Friday bargains, it can be snatched from her fingers at the last minute.
Theory that only works if we keep it a secret…
Crash: A man leaves Lehman’s in 2008
Last week I suggested in this column there was only one way that Theresa May’s fragile Brexit deal could pass the House of Commons: MPs vote it down the first time. The markets crash, businesses wail and politicians start to panic. When it’s put to parliament for the second time, it goes through.
Well, the government must be full of Metro readers because the idea is quickly gaining credence.
The so-called TARP theory (Troubled Asset Relief Program) — named after the US scheme to bail out banks after the 2008 crash — was reported in The Sunday Times and on ITV, and was speculated on by George Osborne’s former adviser. It was first suggested to me by a former cabinet minister, who is extremely plugged in to the ways of Westminster.
There’s only one problem, though. The more the idea is talked about, the less likely it is that it will happen.
In order for the TARP scenario to work, the markets need to crash after MPs vote down the Brexit deal because they’re scared of leaving the EU without an agreement.
However, if the markets are expecting MPs to vote for the deal the second time around, they won’t be frightened by the prospect of no deal, and so they won’t crash.
Which would be, er, a bit of a problem…
Live show is summit special
Just me and EU: Mrs May with Jean-Claude Juncker this week PICTURE: AFP
How do you top a show which features live studio interviews with both the prime minister and the leader of the opposition? Last week on Sophy Ridge on Sunday, I interviewed Theresa May for 20 minutes as she tried to sell her plan to the country (and her own MPs).
Changing leader now, she argued, would only risk delaying or frustrating Brexit. Jeremy Corbyn insisted Labour would vote down the PM’s deal and that a second referendum was an ‘option for the future’ but not for now.
I’m travelling to Brussels for a live Sky broadcast from that critical EU summit. Join me on Sunday at 9am.
@sophyridgesky
|
cc/2021-04/en_middle_0021.json.gz/line1921
|
__label__wiki
| 0.691419
| 0.691419
|
Orlando City SC part ways with head coach Jason Kreis
June 15, 20184:03PM EDT
Nick RosanoSenior Editor
Follow@ nicholasrosano
Orlando City SC have parted ways with head coach Jason Kreis, the club announced Friday.
The move comes amid an ongoing six-game losing streak for the Lions, who posted a 21-29-14 record under Kreis and are 6-8-1 this season.
Assistant coach Bobby Murphy will lead the team while the club searches for a new head coach.
"This is a very difficult decision to take, but sometimes in sports we must make tough decisions with the best future of the organization in mind,” Orlando City SC CEO Alex Leitao said in a team statement. “I have enormous respect for Jason and the work his team did in Orlando. He arrived in a difficult moment and is leaving with a legacy of respect and professionalism. Now is the time to look forward, keep our heads high and continue pushing toward the many goals we set this season."
Assistant coaches CJ Brown and Miles Joseph have also left Orlando by mutual consent.
Kreis joined Orlando in July 2016, halfway through the club's second year in Major League Soccer, posting a 5-6-4 record after he took over from Adrian Heath. In 2017, they went 10-15-9, finishing 10th place in the Eastern Conference.
Though 2018 started promisingly for the Lions as they rattled off a six-game win streak following an 0-2-1 start, but the team has since dropped home results to Eastern Conference rivals Atlanta and Chicago, and on Wednesday lost 3-0 in a trip to the struggling Montreal Impact.
|
cc/2021-04/en_middle_0021.json.gz/line1926
|
__label__cc
| 0.636799
| 0.363201
|
Republicans say CBO is biased when scoring new CMS pay models
Virgil Dickson
Republican lawmakers believe that the Congressional Budget Office may be biased when evaluating experiments developed by the CMS Innovation Center, an agency created by the Affordable Care Act to test new methods of paying for value in medicine.
“It hurts me and members of this committee to express concerns about the objectivity of the Congressional Budget Office,” House Budget Committee Chairman Tom Price (R-Ga.) said at hearing Wednesday.
The hearing was called to discuss how exactly the CBO finds that the Innovation Center's experiments will save money.
Lawmakers say they are concerned that models may actually increase Medicare costs and reduce quality of patient care. Those concerns grew after the Innovation Center (also known as CMMI) began to mandate involvement in some of its experiments such as the Comprehensive Care for Joint Replacement Model and the proposed Part B drug model.
The Republican critics said they feel they have few legislative options to void or alter the demonstrations. “Unfortunately, under its current analysis, the Congressional Budget Office tells us that any altering of CMMI's demonstration activities would result in a substantial loss in savings,” Price said.
Some lawmakers have gone as far as saying the CBO's perceived biased cost assessments prevent them from suggesting laws to repeal CMMI related proposals, such as such as the proposed Part B pay model, because they know those bills won't get passed if the CBO doesn't report they will save costs.
Price and other lawmakers said they felt CBO's current stance on the Innovation Center's activities appears to make them bias towards the Obama administration. That's a strange comment considering that by criticizing the CBO, Republicans are rejecting Keith Hall, the director of the office who was handpicked by the GOP. Hall served as staff economist for former President George W. Bush.
“Savings assumptions favor CMMI,” Price said. “It is this reasoning – that the executive branch is more effective at legislating than the Congress – that is so concerning.”
During the hearing, Mark Hadley, deputy director of the CBO dismissed the claims of bias and noted that all the agency does is present the facts.
The Affordable Care Act appropriated $10 billion to support CMMI activities initiated from fiscal year 2011 to 2019.
Over 4.7 million Medicare, Medicaid, and CHIP beneficiaries receive care furnished by more than 61,000 providers participating in Innovation Center models, according to the CMS.
Verma: CMS tried to 'infuse' free-market competition across healthcare during Trump era
|
cc/2021-04/en_middle_0021.json.gz/line1928
|
__label__wiki
| 0.732904
| 0.732904
|
Best-bets for Sept. 7: A Halsey triumph
SATURDAY NIGHT LIVE -- "Halsey" Episode 1758 -- Pictured: Musical guest Halsey performs on Saturday, February 9, 2019 -- (Photo by: Will Heath/NBC)
1) “Saturday Night Live,” 11:29 p.m., NBC. As a first-time host, Halsey reflected on when she was a Jersey girl named Ashley Frangipane, watching “SNL” every week. Now, at 24, she’s a mono-named star – and an impressive one. As music guest(shown here) in this rerun, Halsey had some Gaga-esque moments, offering visual and vocal splendor. And as host, she blended into sketches well. It was a night that had a so-so start, then soared, including some clever satires of politicians with blackface pasts. Read more…
By Mike Hughes / September 5, 2019
1) “Saturday Night Live,” 11:29 p.m., NBC. As a first-time host, Halsey reflected on when she was a Jersey girl named Ashley Frangipane, watching “SNL” every week. Now, at 24, she’s a mono-named star – and an impressive one. As music guest(shown here) in this rerun, Halsey had some Gaga-esque moments, offering visual and vocal splendor. And as host, she blended into sketches well. It was a night that had a so-so start, then soared, including some clever satires of politicians with blackface pasts.
2) “Bull,” 8 p.m., CBS. Viewers were jolted in the season-opener, when tech-whiz Cable McCory suddenly died off-camera in a bridge collapse. This reruns one of the follow-up episodes: The team joins a civil suit against a bank that funded the terrorists who caused the collapse. (In real life, Annabella Attanasio, who played Cable, wanted to leave to direct a movie. The producers, including her father Paul Attanasio, an Oscar nominee for writing “Quiz Show” and “Donnie Brasco,” agreed.)
3) “America’s Got Talent,” 8 p.m., NBC. Here’s a quick rerun of Wednesday’s episode, giving us half of the 10 finalists. A dozen acts performed on Tuesday; the next night, four advanced … and viewers voted on which of the other eight to save. The same thing will happen next Tuesday and Wednesday.
4) “WOW: Women of Wrestling” season-opener, 8 p.m. ET, AXS, rerunning at 10 and midnight. You want subtlety? Then it’s best not to catch something that features Jungle Grrrl and Havok, The Monster of Madness. We’re told that Jessie Jones is from Kentucky (as proven by the fact tthat she says “y’all”) and The Beast is “from the darkest depths of your mind.” They collide loudly and violently. Last season reruns from noon to 8 p.m. ET, with “New Japan Pro Wrestling” at 9, rerunning at 11 p.m. and 1 a.m.
5) “Maigret,” 7-9 p.m. ET, Ovation. This is why we have cable – to deliver extremes.The four “Maigret” movies (which started last Saturday) are the precise opposite of WOW. Subtle and stylish, they adapt Georges Simenon’s novels; Rowan Atkinson sets his comic brilliance aside and becomes Jules Maigret, solving crimes in mid-’50s France. Tonight, an agitated man keep calling, saying he’s being stalked.
Valerie Harper: Some fun memories coming
Week’s best-bets for Sept. 9: A grand music tour
|
cc/2021-04/en_middle_0021.json.gz/line1930
|
__label__wiki
| 0.565058
| 0.565058
|
Happiness Corner
Travel & RV Living
Integrative Hospital Care: Medicine Embraces Holistic Modalities
Dec 30, 2020 07:30AM ● By Marlaina Donato
andrea piacquadio/Pexels
Thirty years ago, hospital patients were treated for symptoms based on the Western medical model, and holistic modalities were excluded, largely due to a lack of reliable scientific studies. More recently, because of promising research, the traditional template is expanding. The Academic Consortium for Integrative Medicine & Health encompasses 75 university health centers and health systems that offer integrative approaches—a remarkable seven-fold increase in 21 years. America’s top hospitals, including the Memorial Sloan Kettering Cancer Center, the Mayo Clinic, the Duke University Medical Center and the Yale New Haven Hospital, now offer therapies such as acupuncture, reiki, homeopathy, touch therapy, yoga, clinical aromatherapy and chiropractic.
According to a report in Advances in Medical Education and Practice, nearly half of Americans receiving medical care use alternative medicine (although 80 percent don’t inform their doctors) and physicians agree on the importance of further research and training in such modalities. A 2017 University of California survey published in the Journal of Alternative and Complementary Medicine found that hospital patients of all ages were willing to pay out of pocket for healthier food, therapeutic massage and energy work.
Disease: The Big Picture
“Research has repeatedly shown that even with full medical access and optimal medical treatments, a population’s health improves by only about 15 to 20 percent. The rest comes from lifestyle, environment and the social and personal determinants of health. Even factors like emotional health, what you feel is your purpose in life and what motivates you to be healthy plays a role,” says physician Wayne Jonas, in Alexandria, Virginia, a clinical professor of family medicine at Georgetown University and former director of the World Health Organization Center for Traditional Medicine. As executive director of Samueli Integrative Health Programs, which aims to make integrative health regular and routine, Jonas emphasizes that patients become healthier and medical costs are reduced when they are engaged in the healing process.
For Jonas, the shift toward integrative health care has become most evident during the current opioid crisis and the search for non-pharmacological approaches like acupuncture and therapeutic massage therapy for pain management. “The evidence body for many of these approaches has grown tremendously over just the past five years, and has shown a spotlight on what works and what doesn’t. These approaches are now recommended in national guidelines as mainstream for chronic pain.”
Denise Millstine, integrative physician and internal medicine specialist at Mayo Clinic in Arizona, concurs: “The opiate crisis is an example of the need to broaden our clinical toolbox to incorporate care strategies that are less risky. I believe this change has been multifactorial, based on patient demand and more awareness of the importance of lifestyle management.”
Patient demand is also fueled by a desire to avoid medication side effects. In 1998, the Journal of the American Medical Association reported that 106,000 hospital deaths take place each year from adverse reactions to prescription drugs. With more than half of Americans already taking a pharmaceutical drug, and three being the average, adverse side effects can easily mount in a hospital setting.
hush naidoo/Unsplash.com
For Millstine, integrative medicine offers many solutions. “We might recommend the best medication or provide cutting-edge therapies, but without considering stress management, resilience, movement and what people ingest, it’s hard to get optimal results. Integrative medicine expanded my approach to include nutrition, exercise, mind-body (connection), spirituality and other medical philosophies like Traditional Chinese Medicine (TCM) in the patient’s therapeutic plan.”
Whole-Patient Cancer Care
A 2016 meta-analysis by Taipei Medical University published in the journal PLOS ONE concluded that certain applications of acupuncture reduce pain and opioid use on the first day after surgery.
Acupuncture—an ancient modality based on the concept of energy meridians in the body—is also offered in many major hospitals to offset the side effects of chemotherapy and radiation.
Acupuncture treatments at the Mayo Clinic are given in a calming atmosphere of soft lighting and music, and performed by trained doctors, as well as licensed acupuncturists with a firm TCM foundation.
Integrative health care addresses the emotions that accompany a cancer diagnosis, and patients undergoing conventional treatment now have access to not only acupuncture but therapeutic massage, meditation, movement therapy, clinical aromatherapy, herbal applications, biofeedback and yoga. Millstine says of theMayo Clinic, “We have oncology-trained massage providers who are comfortable with what is and what isn’t safe after someone has had a cancer diagnosis and/or treatment.”
Jonas highlights that when given under the supervision of a doctor and with conventional cancer care, complementary therapies may help people to manage cancer symptoms, boost overall well-being, better handle side effects of treatment and reduce the risk of cancer recurrence. “Integrative cancer care can help by activating one’s ability to heal and feel better physically and emotionally,” he says. “Lectures on nutrition, yoga classes and support groups for cancer patients are now common.”
The Urban Zen Integrative Therapy Program, launched by American fashion designer Donna Karan in 2009 after her husband died from cancer, partners with heavy hitters such as the American Cancer Society and the Beth Israel Medical Center, in New York City. In many hospital settings, Urban Zen is creating “Zen dens”, calming nooks where staff can discuss cases with colleagues, take a break for self-care or talk to their patients in a nurturing environment. Urban Zen’s dedication to healthcare integration is international and promotes therapeutic applications of reiki, essential oil therapy, nutrition and other contemplative care.
Energy Medicine Goes Mainstream
“Alternative therapies are no longer considered ‘alternative’ when conventional medicine adopts them—for example, using calcium and vitamin D supplements, which are a standard consideration,” says Millstine. “With high-deductible plans, many patients are accustomed to paying out of pocket for care, thus making payment for alternative providers possibly more palatable.”
Reiki, a Japanese form of energy medicine once considered alternative, is now offered at major hospitals like Yale New Haven, where it’s given free of charge to cancer patients. Many hospitals are also offering classes in energy work to families of patients, hospital staff and the community.
“A medical doctor introduced me to the practice when my grandmother was diagnosed with lung cancer,” says Denise Baron, a Philadelphia-based reiki practitioner who works with referrals from clients and wellness professionals. “A hospital does not hire me directly, but the staff know I am available. I’ve worked on patients post-surgery, during and after births, people with cancer and people in hospice. I would say 96 percent of clients walk away with a deep experience of peace, harmony and lower stress levels.” Most recently, she has seen an increase in nurses asking for support during stressful times, with many wanting to learn how to practice reiki themselves.
brien/AdobeStock.com
According to a 2017 study published in the Journal of Evidence-Based Complementary and Alternative Medicine, reiki is more effective than a placebo and activates the parasympathetic nervous system via the vagus nerve. Results include lower blood pressure and less anxiety and depression. Other research shows that the modality also reduces nausea, improves appetite and lessens fatigue.
Holistic Nursing’s Role
Collaborating with physicians and holistic practitioners, nurses play a key role in integrative hospital care. “We all work together to facilitate the client towards a higher level of well-being. Each profession brings something to the table,” says Margaret Erickson, in Cedar Park, Texas, CEO of the American Holistic Nurses Credentialing Corporation.
The nurse’s role in a patient’s healing journey is an intimate one, and holistic nurses ensure that the whole patient is tended to. “The roots of holistic nursing, grounded in holism, were verbalized over 150 years ago by Florence Nightingale,” says Erickson. “She believed in the mind-body-spirit-emotion connections and that all aspects need to be nurtured in order for people to heal.”
Due to increased demand, more nursing schools are creating educational programs grounded in holistic philosophy, she says. “What makes a nurse holistic is not the skills or alternative therapies she/he/they do, but rather how they show up in their interactions with others. They value and recognize that they are gifted with sharing a person’s most vulnerable moments, and that this shared space is sacred.”
Some holistic nurses may use healing therapies such as guided imagery, aromatherapy, energy work, bodywork, deep breathing, mindfulness and meditation to help both their clients and other healthcare providers.
Those in the field of integrative medicine agree that the future of medicine is now. “People are becoming more self-aware and taking responsibility for their health and life. Consciousness is growing [by] leaps and bounds,” says Baron.
Jonas, drawing on 40 years of experience, agrees. “By working as partners with our patients to help find the care that works for them, we can help them achieve better health and quality of life.”
Marlaina Donato is the author of several books and a composer.
In-Print, Healing Ways Feature National Content January 2021
Level 1 Meditation Class on Chakras and Auras
FREE: No-Pain Optimal Alignment, Healthier / Less-Pain ...In Seconds!
6:30pm · Donald W. Kipp, LLC, DBA: Body-Awareness Wellness
Radical Forgiveness Game - Rewrite Your Story
Qigong Movement Thursdays
6:00pm · Chi Wellness, The Center of Qigong
February Heart-Centered Living issue
Due date: Mon, Jan 11. Call 303-770-1981 or email us for more info at [email protected]
eBlasts and eMail newsletters get your message out instantly!
Email News Exclusives with Social Media pushes $50; ask us about it today! Group Emails bimonthly: $25. 303-770-1981 or [email protected]
Nurses Stand Up Against Climate Change
Mile High Natural Awakenings
Receive the Good News Email Newsletter and/or Free Digital Magazine Subscription
Try Foot Reflexology After Heart Surgery
Nature's Rite
Journeys for Conscious Living
Journey Within
Chi Wellness, The Center of Qigong
|
cc/2021-04/en_middle_0021.json.gz/line1931
|
__label__cc
| 0.521755
| 0.478245
|
In the 1980s, the US imposed a 100% tariff on virtually all Japanese electronics and forced Tokyo to sign a one-sided trade deal that reserved much of its domestic semiconductor sector for American companies.
The events at Capitol Hill provided the perfect excuse for Twitter and other social media companies to advance the agenda of their benefactors in the permanent government of the United States
Soft Power Politics
The Silicon Valley giant suspended the account after detecting suspicious activity originating in Virginia, home of the CIA and numerous other three-letter agencies.
The Spin War
Silencing Survivors
“Jenin, Jenin” documents a deadly Israeli assault on a Palestinian refugee camp that left hundreds of civilians dead and over fifteen hundred wounded, and its release has caused an uproar in Israeli society.
Behind the Headline
Unpacking the Aftermath of Trump’s Coup Attempt With Brian Becker
Dan Cohen is joined by Brian Becker, a longtime activist and host of The Socialist Program, to discuss the January 6 insurrection at the Capitol, the conspiracy showing it was actually a coup attempt, what some on the left have gotten wrong, and how to resist the rising fascist drift.
Escaping the Singularity: Why Artificial Intelligence Will Not Save the Planet
The National Artificial Intelligence Initiative Act became law on the first day of 2021, opening a backdoor to America’s largest corporations to shield their commercial interests behind the full might of the US government.
“A Problem from Hell”
Samantha Power has been an outspoken advocate of US humanitarian intervention, promoting the Iraq war and defending human rights abusers like Israel and Saudi Arabia.
One Last Hurrah
In what are likely his final few days in office, Secretary of State Mike Pompeo has been taking a number of increasingly outlandish and aggressive policy steps.
Where is the corporate media’s disgust for the courtesans of corporate destruction that wreak violence on Americans daily?
While Israel’s behavior is not entirely surprising, it is consistent with the sordid reality of military occupation and institutional racism, it is also self-defeating.
A Nation Imploding: Digital Tyranny, Insurrection and Martial Law
This is what we have been reduced to: A violent mob. A nation on the brink of martial law. A populace under house arrest. A techno-corporate state wielding its power to immobilize huge swaths of the country. And a Constitution in tatters.
Saint Anthony Fauci: The Hidden History
What the media won’t tell you about Dr. Anthony Fauci.
A Hidden Last Act
Oak Flat: Trump’s Final Middle Finger to the Environment
As Trump’s term comes to a dramatic close, the administration’s last minute effort to rush through multiple mining projects that pose a grave environmental risk is lost in the headlines
In a parting gift to the Cuban exile community for their loyalty to Trump, the US declared Cuba a “state sponsor of terror.”
The Forgotten War
The State Department’s decision to designate Yemen’s Houthi Rebels as a terrorist organization was immediately condemned by humanitarian organizations.
Meet The Pseudo-Left Imperialists Fighting Against Universal Healthcare
Since comedian Jimmy Dore called on progressive members of Congress to pressure Nancy Pelosi to hold a floor vote on Medicare For All, a collection of media personalities have launched vicious attacks against him while deflecting from his overwhelmingly popular argument.
Propaganda Pandemic: The Craziest COVID Claims Of The Year
No matter how many Americans die, corporate media is desperate to shore up support at home and attempt to discredit foreign countries for handling the pandemic properly. Behind The Headlines’ Dan Cohen reviews the most absurd COVID propaganda of the year.
Corporate Media Shills For Assassination Of Iranian Scientist
Corporate media features serial liars and pundits paid by the weapons industry to discuss the assassination of Iranian nuclear scientist and Defense Minister Mohsen Fakhrizadeh. Dan Cohen examines the propaganda campaign to drum up support for a war against Iran.
|
cc/2021-04/en_middle_0021.json.gz/line1934
|
__label__cc
| 0.621266
| 0.378734
|
NARRATIVE SELECTION | NOVEMBER 2019
Director: Oleg Vitvitski
Synopsis: Yekaterina is organizing her mother’s funeral while the rest relatives try to divide possessions of the deceased as soon as possible. Each of them pursues their personal goals but circumstances take a sudden turn.
Wild Garlic (2019)
Director: Chris Zahariev
Synopsis: To kill or get killed? That’s the decision Angel have to take. And take it quick. Grown up on the streets in Eastern Europe, Angel now works for a crime organization. When he fails his boss in a money deal, he is given one last chance for redemption. Will Angel commit the murder of a rival drug dealer and what’s going to happen when in his mess he cross roads with an lost elderly woman, who is trying to go back home? “Wild Garlic” is a film about unexpected meetings, which reminds us that somewhere deep down we all have power for a new beginning.
Ironrite (2019)
Director: Clayton Combe
Synopsis: A 1950s housewife struggles to accept her place in the world, while hiding herself and her young son from an aggressive door-to-door salesman.
Abiura (2018)
Director: Giovanni B. Algieri
Synopsis: Fofo, an humble and honest retired worker, picks up strange people on his van and drives them to the polling station.
COMET (2018)
Director: Giorgio Messina, Stefania Simoni
Synopsis: Max finds a message in a bottle that will change his life drastically and unexpectedly.
𝗕𝗟𝗨𝗘 𝗠𝗔𝗧𝗧𝗘𝗥 (dir. by Andrea Gatopoulos) (2019)
Director: Andrea Gatopoulos
Synopsis: It’s a sunny summer day. Mickey is sick with the worst disease. He chooses Flo, an old friend, for a trip in his hippie van to forget about everything just for one night.
The Hen Man (2019)
Director: Thiebault Guérin
Synopsis: John has the feeling that he belongs to the poultry world and meticulously crafts himself a hen costume. Marginalised by society but supported by his loving sister he remains true to his vision.
Festival Of The Midnight Sun (2019)
Director: Björn Rallare, Niklas Mertel Ekelund, Peder Carlsson
Synopsis: Two filmmakers wants to make a movie, but what story to choose? One of them pitch the idea of that true story about what was supposed to be Sweden’s answer to Woodstock, set at a motorway in the Swedish countryside back in 1970. They expected 300.000 people, but only 3.000 showed up and a plethora of weirdness took place around what has been described as “Sweden’s biggest music failure”. As this story unfolds over a phone conversation, we see what the movie would have looked like, it they were to pick that idea. But will they? To begin with they don’t even have time for this, and actually, real life is even more hard to puzzle than this short show in its documentary parts. A short that ends in the beginning, with long time Swedish actor Bert-Åke Varg in one of the roles, Swedish writer and columnist Fredrik Strage and Swedish band Hellsingland Underground as Canned Heat. Weird doesn’t end here, while working on this short, getting no funds having to fund it themselves and using crowdfunding, the creators came in contact with a person that said “Hey, let’s breathe some life in to this festival…” and the festival returned, gloriously, in August 2019. This short is a slice of a full length script, where more ideas with various themes are pitched back and forth, with a longer short baked into it – the short they finally decide to make. That long script can however also be broken down in to more shorts.
THIS TOWN. THAT FUTURE (2019)
Director: Thomas John
Synopsis: It’s a story of two young sisters who are on a mission to get back to the city they love. Their father gets a job in a small town and moves the base from Mumbai city to a small hill town. A sudden change of lifestyle from fast and interesting city life, to a slow and simple small-town life, gets to them. After a year and a series of events, they finally confront their father for good and demand that they are taken back to their city life. The father tries to explain that life has rules and he cannot just leave his job and move to a city which has an expensive lifestyle. To this, the girls take upon themselves to find ways to get back to Mumbai city without their father’s help and move out of the small town they’re trapped in, which by now has become their enemy NO.1
On the web (2019)
Director: Pavel Goncharov
Love me (2019)
Director: ΑΝΤΩΝΗΣ ΣΑΜΟΥΡΑΚΗΣ
Once in Purple Dungarees (2019)
Director: Benjamin Kramme
Synopsis: Three women. Three generations. One political conflict. While visiting her grandmother, Johanna meets her mother coincidentally, who broke off contact with her, and a major dispute breaks out.
PRASKOVYA (2019)
Director: Alexander Solovyov
Synopsis: Praskovya continues working in the Bank despite hunger in the freezing siege of Leningrad. Her husband went to war. The only thing he left is the ink pot. This gift is the onlyitem which makes Praskovya feel warm. In the most critical moment when no hopes or energy is left only the ink pot acts as a twist of destiny.
Staying with Penny (2018)
Director: Carolyn Dekkers
Synopsis: STAYING WITH PENNY: A SINKING SHIP OR A STEP UP TO SHORE? For some people life can be like walking a tightrope. They’re just one step away from everything to come crashing down. Penny understands this and has built her world around the needs of the more vulnerable. ‘Staying with Penny’ follows Sam into this volatile dynamic, as he’s forced to choose between taking the safe road or finding the courage to ride the chaos he’s found himself in.
Once Upon A Time In…Sai Wan (2019)
Director: Nate Ki
Synopsis: In 1989, there were rumors saying money became joss papers when a delivery guy returned to his restaurant after delivering food order to Room 4E of Sau Lai Building which was to be disassembled. Such rumors horrified restaurant staff members nearby as they all afraid that they would receive call from the ghost someday. Shui, who was a staff member from Chiu Fat Restaurant, however, manipulated people’s superstition, claiming that he received order from the ghost. He stole all the money after delivering food orders while replacing the money with joss papers. His boss and colleagues were shocked as they had never thought that their restaurant was chosen and cursed! Shui found that his trick succeed and thus decided to cheat money using the same tactics again and again…
Happy Birthday (2019)
Director: Kevin McAuliffe
Synopsis: We jump in to the thoughts and feelings of a group of friends at a surprise party.
Liberation (2019)
Director: Karim Imamiev
Synopsis: The action takes place in the near future. A man returns home from the war, where he is overcome by heavy memories of the past. After unsuccessful attempts to return to normal life, the past catches up with him.
CHASING MY DREAM (2019)
Director: Rudrajit Roy
Synopsis: CHASING MY DREAM,is an inspirational short film about a doctor in his late 30’s who breaks free from his daily life to explore the nature .Its about fulfilling his dream to travel,and explore the mother nature,adjusting from the fast life which he leads in a busy city from India .The film will serve as an example of inspiration and also give few social message.
Touch (2019)
Director: Nir Berger
Synopsis: A dark romantic comedy in the age of social media. The film features no spoken dialogue, as its protagonist communicates solely through text messages. Adele is an aggressive, self-conscious 17-year-old girl who spends most of her time “trolling” (i.e insulting) her classmates online. When she is hit on by another internet troll, Uri, they flirt until he urges her to send a picture in which she is actually visible. But instead of sending her own picture, Adele sends Uri a picture of a random pretty girl from Syria – sparking another unexpected relationship.
Never (2019)
Director: Mohammad Ali Husainy
Sunset Idol (2019)
Director: Gautier Babe
Synopsis: During a funeral wake, a young boy questions his grand father’s passing.
After Anyuta (2019)
Director: Clemy Clarke
Synopsis: London, 2019. Anyuta spends the day posing as a life model for both her lover, medical student Steven, and neighboring artist Ferris. A meditation on toxic relationships and agency inspired by Anton Chekhov’s short story Anyuta (1886).
National Boomerang (2019)
Director: Gaïa Rasnova
Synopsis: “National Boomerang” retraces the wanderings of Loba, a lonely teenage girl, against a backdrop of urban, country and industrial landscapes.
Charcoal (2019)
Director: Miguel Góes
Country: Not Specified
Synopsis: A story about a man, doorman of a village of houses, haunted by an irresistible obsession. Quiet, averse to intimacy, he draws with charcoal all the people who pass by his cabin. He draws for him self, until a woman discovers.
Shell Shock (2019)
Director: Thushara Ramanayake
Country: Sri Lanka
Synopsis: It is the post-war era. An expressway construction project. A man working as Flag Man (Budde). He is a Post-Traumatic Stress Disorder (PTSD) patient. He has a 6-year-old daughter. Budde is not a fanatic of the Crows club; therefore, its behavior is a challenge to him. He tries to live in the problem by lighting fire crackers without looking for an alternative. (Budde, is fond of inhaling gun powder and the sound of gun fire) The doctor who is desiring to save Budde is explaining to him, the theory of “Finding a crow feather”. Budde goes to the dumping ground in search of a crow feather. He finds a crow instead of a feather. (he cannot kill the crow for feathers.) He, lives with his daughter and the crow under one roof. However, she tries to save the crow from her father’s cruelty. Throws fire crackers at the crow. Her fingers get fractured and she becomes handicapped. One day the crow which flies away from the man giving up all bonds and takes away the life of the little girl.
Double Blind (2019)
Director: Pieter du Plessis
Synopsis: Keith enters a poker game without understanding the stakes and finds himself trapped in a life and death situation of a hatred triangle.
Forgive me (2019)
Director: Gustavo Adolfo Contreras Barranco
Synopsis: Renowned medical doctor Julián Mosquera is also known for being unfaithful to his wife Diana. Tired of her lies, she decides on her own to follow him covertly in order to catch him with her lover and put an end to his stormy deception; but like all plans, they are not perfect.
STUDENT SELECTION | NOVEMBER 2019
Pardon (2019)
Director: Rositsa Trayanova
Synopsis: After the three times that Thais tried to kill herself, she ends up at the rehabilitation center where she meets Roxan. Young singer, who is seeking treatment for her drug addiction. They get close very quick after spending little time together behind the doctors back. During a secret beach walk, a day before they release Thais, Roxan makes a present. Small player with a record of her last song. On other hand, Thais tells Roxan all the reasons why she wanted to end her life. Roxan is asking Thais to forgive, because “if we do not forgive we will never forget the pain.” And the pains stay, especially if you cannot forgive to yourself. A random meeting with the love of your life. A young singer who makes you see the life from another side of view. Who teach you that forgiving is the way to forget.
A Trip with Mom (2019)
Director: Sophie SHUI
Synopsis: In order to take care of his old mother (played by Liou, Yiin-Shang), who has lost her intelligence and is disabled, Xia Changming (played by Yi-Wen CHEN) remains unemployed at home. A family of four, who have been relying on the wife Xiaoling (played by CHIN, TZU-YEN), who is an insurance salesperson, for many years. Under the multiple pressures of the complaints from her wife, economic loading, long-term care, and physical and mental bundling, Changming is always depressed and feels hopeless and helpless. Finally, when the police brought the mother back, and his wife took his son away, after receiving a call, Changming mark the late summer with a red pen. He decided to take his mother to travel…
DROWNED (2019)
Director: Daria Kocherova
Synopsis: A father fakes his own drowning in a desperate attempt to force his estranged, high-flying daughter and layabout son to visit his Italian home and become friends again.
Bambiland (2019)
Director: Danilo Stanimirović
Country: Serbia
Synopsis: Strahinja has just finished acting school and he works as a clown in a kid’s playhouse. Bambiland is a big amusement park in his home town which was open when he was a child. Now, it is an abandoned, creepy place and as such it represents a metaphor for Strahinja’s generation in Serbia.
Caninity (2019)
Director: Chuang-Chieh Liao
Synopsis: When a young Taiwanese man visits a remote Escort Karaoke for the first time, he begins to understand the complexity of desire and exploitation.
Recharge (2019)
Director: Michal Hytroś
Synopsis: It’s a sci-fi movie which concentrate mostly on human beings and their loneliness in the future world. The world where people become androids. She (name unknown) sinks into this unbearable silence, far away from the external world, locked in her unconquered house-fortress. We do not know who she is, do not know why she m’de the decisions that got her to the current place – place that is surrounded by emptiness.
Meatgrinder (2019)
Director: Vladislav Bakhanovich
Synopsis: Eighth-grader Dima starts a new life. A beautiful girlfriend, grown-up friends, night parties – everything he dreamed about is already starting to come true. It only remains for him to win the fight without rules in the tournament “Meat Grinder” and for this he will have to make a truly adult choice.
Postludium (2019)
Director: Svend Colding
Synopsis: Joachim has come to take care of his self-destructive and suicidal father Ulrich, who lives on the countryside. They have not spoken nor seen each other for several years. It’s a story about family and betrayal. They will both have to let go of their failure, shame and guilt to move on, even though the outcome might be hard.
Sooner or Later (2019)
Director: Gadi Rimer
Synopsis: Adam’s longing to his ex-girlfriend, Alona, leads him to break into her new house. When she discovers him there, they are forced to deal with the pain caused by their separation.
One thing at a time (2019)
Director: Niels Beth
Synopsis: The Judith van Swethuis is a residential facility for people with a long psychiatric history. They don’t get, nor want, treatment anymore. Caretakers Tanja Kroeze and Jeffrey Duffels try to give fragile people as much independency as possible. Will they be able to give meaning to the life of this vulnerable group?
AZAN (2019)
Director: Georgia Marangouli
Synopsis: Angelos, an eighteen year old soldier, disappears the night before at the Greek-Turkish borders. After his mother travels up there in a desperate mood and everybody denies information about him, she sets on a quest at the actual borders. The meeting with a woman from Syria would help her to understand what happened the night her son disappeared.
FREE TO A GOOD HOME (2019)
Director: Natalia Matrokhina
Synopsis: A girl is looking for a hamster free a to a good home. You are responsible for what you have tamed.
Director: Alexey Fedorov
Synopsis: “He who kennels with wolves must howl with the wolves.” – vital position Seryoga. We judge people by their appearance, but often we don’t know what is inside the person. Serega was on the verge, he was ready to pull the trigger. But at the last moment in his life comes Vlad – a new boyfriend of his ex-girlfriend. Can this meeting change Serega’s decision?
The Eighth (2019)
Director: Siyun Liu
Synopsis: Taking place in a small county hospital in China the 2000s, Juan is being forced into her eighth abortion by her family, because she repeatedly doesn’t get pregnant with a boy. Despite being told that the surgery could be dangerous to Juan’s health, she is forced to go through with it, with her 6-year-old daughter watching.
DOCUMENTARY SELECTION | NOVEMBER 2019
65 Roses (2019)
Director: Murat Zherka
Country: Macedonia, the former Yugoslav Republic of Macedonia
Synopsis: The documentary follows the story of a 14 year old from Prishtina, Yllka Leti, who suffers from cystic fibrosis. Yllka has a great talent for art, especially for paintings. This documentary shows her day-to-day life, the obstacles that she has to ovrecome and the battle that she fights as a 14 yearold for her life.
THE CLAUSTROPHILES (2019)
Director: Sirio Sechi
Synopsis: This film about caving is not meant for cavers. It was made for all those people who stay outside and ask questions such as: ” how can you breath? “don’t you feel afraid of being trapped there?” “But..what do you do in there?” The speleology films often talk about the caves: the discovery of a cave, the unblocking of a cave, the conjunction of a cave, the mysteries of that cave, the peculiarities of that cave, etc … But they rarely talk about speleologists, who are these strange people who live unlike the others?
Thanks For Watching (2019)
Director: LEE Chien-cheng
Synopsis: “Zhongsen Theatre” opened in 1968. At that time, the theaters competed with each other. The Zhongsen Theatre still managed its own characteristics in many theaters. However, after 2000, the old city was down, and it was closed to the changes of the times. The company was closed down and idle. As the old city began to recover, the theaters also changed hands, but most of them did not present the cinema, and the Zhongsen Theatre was sold to the construction company in 2016. The film records the demolition of the old theater and the rescue of two antique projectors, hoping to find a more suitable place for them to preserve and continue the spirit of the times. After the demolition is completed, the site is intended to be used as a new residential construction site.
A better world (2019)
Director: Geraldine Ottier
Synopsis: A better world is a docu-short film that tells the point of view of Giulia, an 11-year-old girl who lives in a society where the telephone, the social media are at the center of her days, and of which use she can’t be without because, otherwise, she would be seen as different. Unknowingly in a conversation, Giulia makes a comparison with the society of the 90s, in which children had no telephone and played with each other, having human contacts and direct communications. A wish expressed unconsciously that will be fulfilled, in fact Giulia will jump back in time in the 90s. Giulia is an 11 year old girl who just wants to be a child.
BELLE-ILE IN ACADIE (2019)
Director: Phil Comeau
Synopsis: A group of Acadians from Belle-Ile-en-Mer, France, travel to eastern Canada to visit their “cousins” with whom they share a common history. They are descendants of the deported Acadians by the British from their Nova Scotia homeland. They come to see their ancestors’ lost “Acadie” and meet other relatives at a World Acadian Congress. Face to face with their brutal history, will they be able to forgive? This film is about exile, the power of memory and finding your roots.
Manifesting Greatness. A True Story by Raz Degan (2019)
Director: Raz Degan
Synopsis: The hero film piece is a collection of short docu clips that connects audiences to the Jägermeister MANIFEST brand through authentic storytelling. Our protagonist Raz Degan shares his personal life story while taking viewers on an exciting journey through space and time.
miserere, the blessing of the mountain (2020)
Director: Michel Pavlou
Synopsis: Still today, a long-lasting procession, in honour of Saint Panteleymon, leads, once a year across the mountain, to a cave, where squirts, it is said, by the cracks of the rock, a holy water. Sliding between the ancestral mannerism of the faithful, the centuries-old olive trees, the abandoned houses and the elderly byzantine icons, the camera spreads thus out layers of a millennial history.
20 Liters (2019)
Director: Andy Seiler and Aaron Thomas
Synopsis: “There is no joy without water.” Set in Kenya, 20 Liters is an experiential short documentary that gives you insight into what it’s like living with the Samburu tribe. Experience what it’s like with only 20 liters of water a day and the life surrounding the search for water.
ANIMATION SELECTION | NOVEMBER 2019
Gym & Goolie (2019)
Director: Tović
Synopsis: When alone, Gym and Goolie escape into the worlds of their own imaginations. Gym creates fan-work for an online community and Goolie crafts fantastical costumes. Both long to be someone else, somewhere else, yet struggle with the fear of connection and the anxieties of self-expression.
Urbanality (2019)
Director: Evan McInnes
Synopsis: The city folk are about to get a wake-up call. But, will they stop and listen? “Urbanality” explores the isolation of our modern environment, the resistance we have to change, and the beauty of going with the flow.
Trap (2018)
Director: Paul James
Synopsis: A young girl fights for a sense of belonging.
Smell of Sound (2019)
Director: Carol-Ann Belzil-Normand
Synopsis: Smell of Sound is an animated film combining sounds, smells and moving images. Abstract forms produced with computer-generated images is animate in an intimate sound space.
Director: Pouya Afshar
Synopsis: ‘LA DOLCE VITA’ is the story of a displaced character. Hope, decides to leave his/her war infested city to find a better life abroad. He/She goes on a journey in hoping for finding a purpose in life in the new world but encounters a wall along the way.
The Elephant of Air (2015)
Director: Alexey Galkin
Synopsis: In every family there is a place for a great adventure, and our characters are no exception to the rule. Together they find themselves in a parallel fantasy world inhabited by flying hippos and other fantasies.
Horizon leap (2019)
Director: Beata Pantya
Synopsis: We attune to the Forest’s organic rhythm as moving through her roots and branches. The trees come to subtle motion, their pulse paces and we become capable of leaping the horizon’s frontier. A soul’s journey through the Forest towards the stars.
Magic Dream (2019)
Director: Tomás Welss
Synopsis: “Magic Dream” is a painted stop-motion full animation film that tells the story of a magician on stage trying to perform his show. As his magic goes wrong, he loses control and gets weak. The wizard timidly reintegrates to the set and tries to extract a rabbit from his hat. The rabbit rejects the magician and his environment. As he keeps crumbling down, the rabbit offers him help, to deal with the misleading and confusing magic and to confront his life.
EXPERIMENTAL SELECTION | NOVEMBER 2019
Ghost Nursery (2019)
Director: Brandon Wilson
Synopsis: A ghost is born in the forest. No longer tangled in a mass of spirits it gains strength as it turns to observe its surroundings, reveling in its mastery over death and time.
STuK (2019)
Director: Nadira Murray
Synopsis: LOGLINE: Angela’s mind explodes with horror when she is trapped in the bathroom of a night club. SYNOPSIS: Troubled teen Angela enters the toilet to refresh herself. She feels odd. She hears a sudden gunshot and screams – “the night club is under attack”. Angela fears for her life; or is her mind playing tricks?
At the Time (2019)
Director: Nathan Johnson
Synopsis: “At the Time” follows an individual’s relationship with addiction and the internal struggle that is yoked with that relationship. It is inspired by a loved one’s personal story of what they had experienced, at the time when they were at their deepest struggle.
See my ghost passing away (2019)
Director: Yann PICHOT
Synopsis: Between dreams and nightmares, Lilith sees the ghost of her lost love.
An Exploration of the Dreamworld (2019)
Director: Paulina MacNeil
MUSIC VIDEO SELECTION | NOVEMBER 2019
Sansara – Miami (2019)
Director: Ivan Sosnin
Synopsis: This video is about a dream of a young boy. Regardless of extending circumstances, you have to go to your dream. After all, it is not necessary to live in a hot country to surf. In the story, the main character who dreams of surfing quarrels with his mother and leaves home with his surfboard. It’s winter outside. He walks through the snow in an industrial Russia city. In his thoughts, he replaces reality with pictures of sunny Miami. Finally he comes to the coast of the Arctic Ocean and fulfills his dream.
Music clip “DUDKI” (2019)
Director: Gulzhan Sitakhmetova
Synopsis: Mad flight without time and space, where the reality, dreams, fears, and memories are intertwined with each other. Look beyond mindlessly!
Sophisticated (2019)
Director: Daniel Duguay, Adam Benish
Synopsis: Official video for “Sophisticated”, the title track from Paul Cafcae’s 2019 debut LP.
Director: Łukasz Zabłocki
Synopsis: A visual interpretation of an euphoric state of mind, occurring while in a presence of an exceptional personality or a flawless beauty.
Azhar’s Aria (2019)
Director: Madina Altynbayeva
Country: Kazakhstan
Synopsis: Zarina Altynbayeva performs “Azhar’s Aria” from the opera “Abai”. This is a story of of pure eternal but forbidden love between Azhar and Aidar. Despite all of the obstacles they faced, with Abai’s help they seemed to stand a chance. This story is from Azhar’s perspective.
Puppet (2019)
Director: Alexej Sigalov
Synopsis: Everybody is dependent. You, me. Especially me. People don’t speak to each other nowdays, they stare to their gadgets, thinking they’re online. The fact is – they’re offline.
Lone in the Dark (2019)
Director: Tomasz Chrapusta
Synopsis: Lone in the Dark – first fictional beatbox video in world. What happens when two creative forces meet? When extreme emotions are given voice and indomitable passion prevails over the complicated matter? Time is in the void, scattered over the past, the present and the future. Sense of place is of no consequence, it’s merely a pretext to show the real and lasting solitude of a man. There is however light in darkness, which shelters from fear. Two opposed forces fight each other, none wins over the other. Good and evil, light and darkness, life and death. All come together in Lone in the Dark.
The Sun Will Fool You (2019)
Director: Daniel Bigelow & Talon Nightshade
Synopsis: Our sun has a surprise for you…his blinding bright light doesn’t always come with warmth. In “The Sun Will Fool You” a young girl grows up reaching out for him and finding him cold.
Fool For Your Love (2019)
Director: Odeya Rush
Synopsis: Fool For Your Love is a journey into the imagination of a young boy named Scooter.
PICTURES (2018)
Director: Vladislav Parovozov
Synopsis: Synthetic romance of artificial space, collected from pieces of photographs, clippings of Soviet Newspapers and fragments of images. Mixed media (collage / graphics/stop-motion)
Taki Pooost (2019)
Synopsis: As if by magic, “Taki Pooost” takes us to the colorful 90s, which today are experiencing a real renaissance of popularity. The current trends in fashion and culture are also there, with Instagram at the forefront, which in the clip functions as an ultimate symbol of contemporary lifestyle. What would Instagram look like in the 90s? A seductive visual and textual answer to this question awaits in this music video. In a world ruled by likes, stories, followers and hashtags, where there is little room for intellectual debate – alas, they’ve arrived: the most popular instagrammers in Poland! The stylized The Insta Of Queen knows exactly what and when to wear, which profile is better and what light seems best for each photo to make her look slimmer and more athletic. For Sexy Polish Girl, what counts most is clothes and murderous competition for perfect shots, even if she was to pose in the same position from dusk till dawn. This unreal world is thoroughly observed and analyzed by Lame Duck, who dreams that one day she will also become popular. At least for these 600 likes. Even for a moment.
NARRATIVE SELECTION | DECEMBER 2019 Nox (2018) Director: Keyvan Sheikhalishahi Country: France Duration: 13:00 Synopsis: Peter and Claire are two professional burglars […]
April 2020 – Moscow Shorts Official Selection
NARRATIVE SELECTION | APRIL 2020 Bully Director: Adhip Iyer Country: India Duration: 23:57 Synopsis: A 12 year old boy struggles with bullying […]
NARRATIVE SELECTION | DECEMBER 2020 Happy (2020) Director: julie Anastasopoulou Country: Greece Duration: 08:29 Synopsis: Αggeliki, a lonely and kind of quirky […]
June 2020 – Moscow Shorts Official Selection
NARRATIVE SELECTION | JUNE 2020 BUNNY IN THE RAIN… (2020) Director: Oksana Barkovskaya Country: Russian Federation Duration: 20:38 Synopsis: A six year […]
Previous post Moscow Shorts – December 2019 Live Screenings – Trailer [1 min]
Next post PHOTOS: Moscow Shorts Screenings – November 2019
|
cc/2021-04/en_middle_0021.json.gz/line1937
|
__label__wiki
| 0.66831
| 0.66831
|
Home / News / Motorsports
McLaren 720S GT3 race car ready for arrival in 2019
Jeff Glucker August 26, 2018 Comment Now!
McLaren is a brand with a rich racing heritage. Sure, lately it's been known for kicking out tremendous road cars. That doesn't mean that motorsport isn't always on the minds of McLaren engineers and designers. Woking's latest and greatest is the 720S, and now there's an even faster version designed for racing. GT3 racing, to be precise.
Testing is currently underway on tracks all over Europe, the Middle East, and the United States. Customers vying to get their hands on the 720S GT3 will be able to do so early on in 2019. They'll have the cars in time to battle for top spots during the various series set to run that year.
Starting with the road car, McLaren utilize the carbon fiber MonoCage and build up the chassis from there. Out back sits the twin-turbocharged 4.0-liter V-8 M840T engine, but here it's been tweaked for racing duty. What that means specifically, McLaren isn't telling just yet but we assume it involves beefing up any parts for increased longevity out on the race track. The torque curve has been revised and shift speed of the six-speed sequential paddle gearbox has been increased.
Each GT3 is hand assembled at Woking and carries a starting price tag of around $565,000. McLaren hopes its customers will be interested in going racing, which is why the automaker has to make sure the 720S GT3 is a capable yet drivable machine. The car has big boots to fill as its predessecor, the 650S GT3, is a popular option in the GT3 racing scene.
"The 720S GT3 is a significant car for McLaren Automotive," Executive Director of Global Sales and Marketing Jolyon Nash says. "It still has the road car’s ability to deliver extreme performance in a way that all drivers can access, but taken to an altogether higher, race track level. Crucially it also forms a part of our growing customer-focused racing and business strategy which sees dedicated motorsport products developed in-house that draw on our rich pool of motorsport experience and expertise.”
This is a chance for McLaren to mirror some of the Porsche customer racing devotion. The German automaker has essentially dominated the customer racer space, with Ferrari and Aston Martin playing along as well. McLaren is a perfect company to go down this path. There's true motorsport history and heritage to go along with race engineering expertise. Add in the fact that a McLaren 720S owner can add a 720S GT3 race car to their garage and it plays into the ego boost side of it all.
After all, being able to say "If you think that car is cool, you should see my race car" is just a great phrase to have ready at hand.
High-Res Gallery: 2019 McLaren 720S GT3 race car
2019 McLaren 720S more bonkers thanks to new Track Package
Mercedes' EQ Silver Arrow concept is an electric streamliner with 738 hp of grunt
$2.71M Apollo IE sold out, looks even crazier as track car
Holden showcases design talents with Time Attack Concept
Jeff Glucker - Contributor
Ecurie Ecosse launches Jaguar C-Type continuation car Classic Cars January 16, 2021
Driverless cars will race at Indy Racing January 12, 2021
Revised 2021 F1 calendar sees opening Australian Grand Prix moved to end... Racing January 12, 2021
McLaren open to racing in Formula E Racing January 11, 2021
|
cc/2021-04/en_middle_0021.json.gz/line1938
|
__label__wiki
| 0.981563
| 0.981563
|
Home / News / Faralli and Mazzanti
Faralli and Mazzanti
Mazzanti EV-R to deliver over 885 pound-feet of torque
Viknesh Vijayenthiran May 10, 2016
Mazzanti has released a new teaser in its series highlighting its Project EV-R supercar. In the latest installment we discover the EV-R will have more than 885 pound-feet of torque. That’s more than any other production car to come out of Italy, and it fits in line with Mazzanti’s claim the EV-R will be the most powerful production car to ever come out of the country and possibly the fastest too. The EV-R, which is due for a reveal June 8 at the 2016 Turin Auto Show (officially the Parco Valentino), is a more extreme version of Mazzanti’s existing Evantra. Like the Evantra...
Mazzanti EV-R supercar to reach 250 mph
Mazzanti is just weeks away from unveiling its Project EV-R. The car is a more extreme version of the company’s Evantra supercar and promises to be the fastest, most powerful car out of Italy. In its latest teaser, Mazzanti has revealed that the EV-R has a targeted top speed of 250 mph...
Viknesh Vijayenthiran May 2, 2016
Mazzanti EV-R stops from 186 mph in 7.0 seconds thanks to carbon brakes
Fresh from an appearance with its updated Evantra supercar at the 2016 Top Marques Monaco, Mazzanti has released a video teasing its next major announcement. That next announcement will be the reveal of a new, much more potent version of the Evantra code-named the EV-R. The car is due for its world...
Viknesh Vijayenthiran April 20, 2016
Mazzanti shows off Evantra supercar with new “Biplano” wing
Mazzanti is gearing up for the launch of a hardcore version of its Evantra supercar that may just prove to be one of the fastest road-going cars to ever come out of Italy. It will be unveiled this June at the 2016 Turin Auto Show. However, the new model, code-named the EV-R, isn’t the only...
Mazzanti EV-R to feature twin-turbo V-8, 2.7-second 0-60 time
Mazzanti is about to launch a new supercar, one that could be faster and more powerful than anything we’ve previously seen from an Italian firm, Ferrari [NYSE:RACE], Lamborghini and Pagani included. We’ve learned that the car, code-named the EV-R, will be a hardcore version of...
Mazzanti to unveil updated Evantra at 2016 Top Marques Monaco
Mazzanti burst onto the scene back in 2006 with the unveiling of its Antas grand tourer at the Top Marques Monaco. A decade on the Italian firm is returning to Monaco with an enhanced version of its latest model, the Evantra supercar, the current version of which is shown below. The Evantra debuted...
Italy's Mazzanti teases new EV-R supercar
Andrew Ganz April 7, 2016
Italian supercar marque Mazzanti, in the news just a few days ago with its first model, the Evantra, is now tantalizing us with a new car code-named EV-R. Few details have been released on the new EV-R, which is set to be revealed fully on June 8 at the 2016 Turin Auto Show. Mazzanti says that it will be the most "extreme" street legal car ever built in Italy, heady language for a country as associated with high-performance supercars as it is with manicotti with cheese. To that end, Mazzanti has indicated that the car will be Italy's most powerful street legal ride yet. That means its output...
Mazzanti Evantra rips through the hills of Tuscany
When you want to make a gorgeous promo video for a car in the States, you are most likely going to end up somewhere along the California coast. The sweeping vistas, endless glory of the Pacific Ocean, and absolutely wonderful roads combine for a perfect visual symphony. ALSO SEE: R34 Nissan Skyline...
Jeff Glucker April 5, 2016
Italian firm F&M debuts Evantra supercar
We knew it briefly as "Mugello," but that was just the name of the project that created it. The car itself is called the Evantra, and it's the latest supercar to hail from the style and supercar capital known as Italy. The car's name comes from the language spoken by the ancient Etruscan...
Chris Weiss December 20, 2011
Italy’s latest supercar is the F&M Mugello
From the creator of the V-12 powered Vulca S and the deliciously retro Antas V8 comes a brand new supercar, the F&M Mugello, which has been teased here today ahead of a global launch pegged for early next year. The Mugello hails from the atelier of Italian coachbuilder Faralli & Mazzanti...
Viknesh Vijayenthiran December 7, 2011
Faralli & Mazzanti launches the V-12-powered Vulca S
Italy's Faralli & Mazzanti (F&M) is probably most widely recognized for its Antas V8 but the company has a new hero car, this time with a V-12 heart. Unlike the previous Antas V8, which was based around a donor Maserati chassis, the new Vulca S V12 was designed from the ground up and...
Viknesh Vijayenthiran March 23, 2009
|
cc/2021-04/en_middle_0021.json.gz/line1939
|
__label__wiki
| 0.644827
| 0.644827
|
AMDBMovies
Populer Movies
In Theaters Movies
Populer TV Shows
When a woman is rescued from a doomsday cult and lands in New York City, she must navigate a world she didn’t think even existed anymore.
Created By: Tina Fey | Robert Carlock |
Genres: Comedy |
Production Company: Universal Television | Little Stranger |
Total Sessions: 4
Vote Count: 287
Network: Netflix |
Homepage: https://www.netflix.com/title/80025384
Share Trailer
Season 1 2015 | 13 Episodes
Unbreakable Kimmy Schmidt - premiered on March 06, 2015
After she's freed from a cult that kept her underground for 15 years, Kimmy wants to erase her past and start a new life in New York City.
Unbreakable Kimmy Schmidt - premiered on April 15, 2016
Tired of being Jacqueline's assistant, Kimmy moonlights as a Christmas elf and an Uber driver. Titus finds love, and Lillian fights gentrification.
Unbreakable Kimmy Schmidt - premiered on May 19, 2017
Change is afoot as Kimmy saves up for college, Titus searches for a new job, Jacqueline takes the next step with Russ, and Lillian runs for office.
Kimmy faces new challenges as the head of HR for tech startup Giztoob. Meanwhile, Jacqueline signs Titus to her fledgling talent agency, White Talent.
More Backdrops of Unbreakable Kimmy Schmidt
More Posters of Unbreakable Kimmy Schmidt
More Videos of Unbreakable Kimmy Schmidt
Ellie Kemper Kimmy Schmidt
Tituss Burgess Titus Andromedon
Jane Krakowski Jacqueline Voorhees / White
Carol Kane Lillian Kaushtupper
See Full Cast & Crew of Unbreakable Kimmy Schmidt
Recommendation Like - Unbreakable Kimmy Schmidt
Hilarious ensemble comedy that follows Leslie Knope, a mid-level bureaucrat in the Parks and Recreation ...
30-year-old New York actor Dev takes on such pillars of maturity as the first big ...
30 Rock is an American television comedy series that ran on NBC from October 11, 2006, to January 31, 2013, ...
The story of a wealthy family that lost everything, and the one son who had ...
A '90s-set single-camera comedy about a hip-hop-loving Asian kid growing up in suburban Orlando, ...
Broad City follows two women throughout their daily lives in New York City, making the ...
Follow the lives of a group of students at what is possibly the world’s ...
A look into American politics, revolving around former Senator Selina Meyer who finds being Vice ...
Satirical sketch comedy set and filmed in Portland, Oregon that explores the eccentric misfits who ...
Single father George Altman is doing his best to raise his sixteen-year-old daughter Tessa in ...
More Like - Unbreakable Kimmy Schmidt
Peter89Spencer
When lockdown started, all I had to keep me from going insane was Netflix. And one of the shows I binge watched throughout lockdown was this show. Unbreakable Kimmy Schmidt was silly, quirky, and hilarious. Season 1 had me in stitches. Although the next two seasons gave me mixed feelings. However, the final season restored my faith! The final episode was a fitting end, although part of me would've wanted to see the Reverend one last time, and maybe see Kimmy reunite with Dong. But other than that, this show was very entertaining. I am glad I saw this.
id : 5fabb6c141a5610041a3ab83
Similar TV Shows
1962 - 7.0
Jed Clampett's swamp is loaded with oil. When a wildcatter discovers the huge pool, Jed sells his land to the O.K. Oil Company and at the urging ...
Baby Daddy follows Ben, a young man in his early 20s living the life of a bachelor in New York City with his buddy, Tucker, and his brother, ...
Young, urban newlyweds Paul and Jamie Buchman try to sustain their marital bliss while sidestepping the hurdles of love in the '90s.
A stand-up comedian and his three offbeat friends weather the pitfalls and payoffs of life in New York City in the '90s. It's a show about nothing.
Liza Miller, a suddenly single stay-at-home mother, tries to get back into the working world, only to find it’s nearly impossible to start at the bottom at 40...
What I Like About You
Valerie Tyler is a 28-year-old organization freak who loves her 16-year-old sister Holly. Even if Holly is rambunctious. Spontaneous. Impulsive. Disconcerting. And definitely disorganized. Then Holly moves in ...
Based on the bestselling book by Candace Bushnell, Sex and the City tells the story of four best friends, all single and in their late thirties, as they ...
Will Truman and Grace Adler are best friends living in New York, and when Grace's engagement falls apart, she moves in with Will. Together, along with their friends, ...
Workaholic Mike Flaherty is the Deputy Mayor of New York City, serving as Mayor Randall Winston's key strategist and much-needed handler. Mike runs the city with the help ...
Smart but wholesome Betty embraces her unique appearance and independent attitude in the cutthroat world of New York fashion. With the help of her proud yet far-from-glamorous family ...
The adventures of relatable and adventurous Riley Matthews, the tween daughter of Cory and Topanga Matthews, and her bold best friend Maya as they traverse the twists and ...
Three's definitely a crowd for parcel post deliveryman Doug Heffernan, whose newly widowed father-in-law, Arthur has moved in with him and his wife Carrie. Doug's no longer the ...
TV Genres
© 2021 Azwaad Movie Database. All rights reserved
Design by azwaad.com.bd
Total Visit: 152,437
|
cc/2021-04/en_middle_0021.json.gz/line1944
|
__label__wiki
| 0.982158
| 0.982158
|
During Gawker trial, Heather Clem tearfully recalls sex with Hulk Hogan
By JON SILMAN and Stephen Rex Brown
Heather Clem, seen with her former husband Bubba the Love Sponge, testified he liked to film her having sex with other men. (Ethan Miller/Getty Images)
Hulk Hogan was a publicity hound who couldn't resist the cameras — even after his sex tape surfaced, the woman in the raunchy footage testified Wednesday.
Heather Cole tearfully recalled in a taped deposition played for a Florida jury her frustration after Hogan went on a media blitz following the video's publication on Gawker in 2012.
JURY AWARDS HULK HOGAN $115M IN CASE AGAINST GAWKER
The grainy, edited footage showed Cole having sex with Hogan, who at the time was the best friend of her kinky hubby, shock jock Bubba the Love Sponge.
"I felt more embarrassed," she said of Hogan's public comments about the tape. "I wanted it to go away."
Cole, 41, added that in her opinion, the pro wrestling superstar enjoyed publicity.
She said that she agreed to sleep with Hogan at her husband's behest in 2006 — contradicting the wrestler's earlier statement on the stand that Cole had hounded him for sex.
"I was asked to go to Mr. Bollea's room by my husband, and I did," Cole said, using Hogan's real name, Terry Bollea.
Her tearful testimony was the most damning moment yet for Hogan, 62, during the two-week trial. Hogan is suing Gawker for $100 million, arguing the publication of the video represented an invasion of his privacy and damaged his personal life.
But Cole's deposition painted a picture of a pervy household during her marriage with Bubba, who was born Todd Alan Clem. Hogan was a regular.
Hulk Hogan says the sex tape was filmed without his permission. (STEVE NESIUS/AP)
HULK HOGAN BLAMES WIFE FOR HIM SLEEPING WITH PAL'S SPOUSE
"Did Mr. Clem generally pick who you had sex with?" she was asked during the deposition shown to the St. Petersburg, Fla., jury.
"On the occasion that I had sex with someone other than him, yes," Cole replied.
But, Cole said, she and the former WWE heavyweight champ were unaware they were being filmed in a bedroom at Bubba's home — one of at least three occasions she slept with the Hulkster.
When she realized Bubba, 49, had recorded the deed she became upset and demanded the video be destroyed, Cole said.
She thought Bubba — whom she later divorced — had complied with her request until the tape appeared on Gawker. Clem now goes by Heather Cole.
Bubba's attorney has said he will invoke the Fifth Amendment and not testify in the case. He and Hogan reportedly settled a lawsuit stemming from the leak of the sex tape for $5,000.
Earlier, an expert testifying for Gawker said that the site earned all of $10,000 from the post that could potentially leave it bankrupt.
Tech consultant Peter Horan said that since advertisements did not run alongside the popular sex tape post, earnings were minimal.
Gawker lawyer Michael Sullivan defended the site's former editor-in-chief A.J. Daulerio, saying Hogan's boasting about his sex life diminished his right to privacy. (Stephen Yang/AP)
"This is the type of post that scares off more advertisers than (it) attracts," Horan said.
GAWKER CHIEF READS LINES FROM HULK HOGAN SEX TAPE TO JURY
Under cross-examination, Hogan's attorneys countered that the story that received 5.4 million visits was valuable to Gawker in ways that couldn't be calculated through traffic alone.
"I just took the traffic at face value," Horan said.
He analyzed data that found Gawker earned $8,200 from visitors who went from the Hogan post to other pages on the website. Gawker earned a paltry $2,762 from people who went from the sex tape post to other websites.
The testimony will be used by jurors to calculate damages if they find Gawker committed wrongdoing by posting the tape.
Hogan says the sex was recorded without his permission.
Gawker argues that Hogan is a public figure who has a limited right to privacy due to his larger-than-life persona and frequent boasts about his sex life.
sbrown@nydailynews.com
|
cc/2021-04/en_middle_0021.json.gz/line1949
|
__label__cc
| 0.633982
| 0.366018
|
5 - Aesthetics
Objectivist Philosophy
Peikoff CD offer -- and rejection (2005)
By Roger Bissell,
December 28, 2005 in 5 - Aesthetics
Roger Bissell 15
Roger Bissell
$$$$$$
Location:Antioch, Tennessee
Interests:philosophy, psychology, genealogy, fiction
To begin with, here's an amusing little quote from Ayn Rand Answers to chew on:
Speaking of one’s ability to know another’s sense of life, now might be a good time to make a request: Please don’t send me records or recommend music. You have no way of knowing my sense of life, although you have a better way of knowing mine than I have of knowing yours, since you’ve read my books, and my sense of life is on every page. You would have some grasp of it-but I hate to think how little. I hate the painful embarrassment I feel when somebody sends me music they know I’d love -- and my reaction is the opposite: it’s impossible music. I feel completely misunderstood, yet the person’s intentions were good. Nobody but my husband can give me works of art and know infallibly, as he does, that I’ll like them. So please don’t try it. It’s no reflection on you or on me. It’s simply that sense of life is very private. (p. 187)
Considering Rand’s remarks (which I had actually heard way back in the 70s, when I rented and hosted the “Philosophy of Objectivism” lecture course they appeared in) to be a decent guideline for gift-giving, and considering the fact that I knew Leonard Peikoff was a fan of jazz music, I decided to offer him a copy of my jazz duo CD by approaching him in the following manner:
leonard@peikoff.com
Dear Dr. Peikoff: Allow me briefly to introduce myself: Professionally, I have been a trombonist and musical arranger since finishing my M.A. in 1971, and I have been working 5 days a week at Disneyland since 1985, playing a combination of marches, ragtime, show tunes, Disney tunes, and Dixieland jazz. I also tour several weeks a year with a jazz group called the Side Street Strutters, who regularly play at Disneyland. (My own assignment is the Disneyland Band.)
I have been a fan of your lectures and books since the 1960s, and I most recently have been enjoying the DIM Hypothesis lectures and your DVD "In His Own Words." From the latter, I learned that you like jazz music, so I would like to offer you a copy of my jazz duo CD, "The Art of the Duo." It was recorded in 1992 with my piano player, Ben Di Tosti, and it contains a number of swing and easy listening tunes, including an original of mine. I think you would find it quite enjoyable. Let me know if you would like a copy, and where I should send it.
Roger Bissell, musician-writer
AchillesRB@aol.com
P.S. -- In case you don't wish to receive the CD and/or are curious as to its contents, you can hear brief clips from the CD at this web address: http://www.gemtone.com/art_of_the_duo/
Much to my mixed delight and chagrin I received the following reply
Date: Mon, 05 Dec 2005 11:06:11 -0800
To: AchillesRB@aol.com
From: Leonard Peikoff <leonard@peikoff.com>
Subject: Re: Message from web site viewer
Dear Mr. Bissell,
Thank you for your comments on my work, and for your kind offer to send me your CD. The fact is, however, that I really only enjoy jazz on the piano, and so am not really a suitable audience for your work.
Leonard Peikoff
(Dictated but not read)
Gee, too bad about that extra instrument (trombone), cluttering up what would have otherwise been a perfectly acceptable piano jazz CD. Sheesh. No matter that it contains some of the finest jazz piano playing you’re ever going to hear anywhere. Double sheesh.
A friend of mine, with whom I shared the above, had the following cryptic comment:
“HOLY SHIT! ”
To which I replied:
“What, that I actually got a reply? Or that the reply was such B.S.? :-)”
And he clarified:
“Just that you got a reply. But what a farce to not take your CD, given that he only likes piano. I guess I'll have to write him now and tell him I'd like to send him a Bill Evans CD. LOL ”
Double . And farce is right.
P.P.S. -- my CD is still available from the above-mentioned gemtone.com website, as well as from www.cdbaby.com. Or you can save several bucks and mail a check for $12 to me at Roger Bissell, P.O. Box 5193, Orange, CA 92863. But be forewarned, the CD contains trombone playing. :roll:
Michael Stuart Kelly 1,548
Michael Stuart Kelly
LOLOLOLOLOLOLOL...
Peikoff only likes his jazz on the piano?
What a metaphor, if applied to Objectivism and life in general.
Can anyone here recall any incidents in which [LP] was ~intentionally~ funny?
Oh, sure: his joke about love making the world go round (a joke pertaining to Platonic philosophy), if one considers that funny, rather than a groaner. He did have a sense of humor, though, but not an obvious one -- the sort of stuff like in the Dudley Moore/Peter Cook "Round the Fringe" imitation of G. E. Moore and (?) -- I'm drawing a blank on who the other philosopher is.
The funny thing is that I'm with Peikoff here. Not with regard to his silly reply, but concerning his musical taste. Now I have no great affinity for jazz, but I can appreciate some jazz piano music and play sometimes some jazz pieces myself (ragtimes of Scott Joplin, transcriptions of Art Tatum, Fats Waller, Count Basie). I'm allergic to the sound of the saxophone however, that really grates on my nerves; now I can tolerate a trombone, but I still prefer the pure piano music.
Peikoff's reaction is of course ridiculous. That pompous "Dictated but not read", as if he's too busy to read those two lines (I can't imagine that Rand would have done that!). I wonder whether he would have accepted your offer if the CD had only contained piano music, somehow I have a feeling that he then would have found another excuse. I certainly wouldn't have refused it, trombone or not...
This is pure speculation, but I don't think piano had anything at all to do with it.
If Roger had been a staunch member of ARI and adhered to the party line, my feeling is that he could have offered a CD of Rachmaninoff's Second Piano Concerto re-orchestrated for accordion, harmonica, banjo, tuba quartet and shot gun and it would have been graciously accepted.
Michael, you're terrible! What's worse, you're probably right! :cry:
Jonathan, there are no concrete plans for a second CD at this time, but Ben and I have played together on three CDs in the past 2 years, backing up an old fellow who sings standards and dixieland and novelty tunes. We are joined by a rhythm section and a trumpet and sax/clarinet player, and our solos are definitely secondary in importance (though not quality) to the guy's singing.
My personal plan is to lay out at least one CD project this year and execute as much of it as I can -- but I haven't yet decided whether it will be a jazz nonet (9-piece) project or a trombone + orchestra (mostly synthesized plus several live assistant soloists) project. I am particularly eager to get some of my original songs recorded, even if just as instrumentals -- and I have some really pretty arrangements of other people's songs already written -- so the material is there. I just have to gird up my loins, so to speak, and do the work!
My wife has agreed that we can consider the previous project closed and "paid for," and that we can push forward on another project, so it's really not a matter of lack of finances. Just time and energy and gumption. (That's what conditional freedom/teleological determinists call willpower. :-)
So, stay tuned!
Ellen Stuttle 265
Ellen Stuttle
Interests:Psychology, Physics, Philosophy, Literature, Music
For some reason, it seems that my signing on doesn't work unless I hit the "quote" button in replying to a post. The "Guest" (Anonymous) post above was by me -- and contained two errors. (That's the sort of stuff which happens when I'm working on a copyediting project: I make silly errors in my own stuff. It's the "conservation of error" principle.) The "love makes the world go round" joke which Leonard used multiple times I believe pertained to Aristotle's theory of attraction for the Unmoved Mover. And the Dudley Moore/Peter Cook show was called "Beyond the Fringe." I was conflating that with "Round the Horn [or Horne?]," another British-humor show, but less sophisticated than "Beyond the Fringe."
"'Moore,' I said, "have you any apples?', and we were friends for life."
ahem...
That thing about the "conservation of error" principle...
Boy did that hit a nerve with my past.
Glenn Fletcher 0
Glenn Fletcher
I fondly recall Leonard making a joke in his "Objectivism:State of the Art" lectures. He was giving his favorite Hegel quote, and it went something like this:
"The truth is the whole. That's w-h-o-l-e." That one cracks me up every time. Robin Williams, eat your heart out!
Rich Engle 1
Rich Engle
Location:Fort Myers, Florida, USA
Interests:Philosophy, Religion, Psychology, Chess, Music, Spirituality.
You know, that just says if effing all, Roger. About the only person on the planet that really has a reason to be that shitty in that situation is a record company guy. I know because I used to do that for an indie. There's a point where you can't stand the sight of a new CD.
Outside of that, though, what's to lose? How hard would it have been to say "Thanks for the kind words, and if you wish, do send me a CD."
I really need to watch my thoughts. I was thinking of the right term for him in that situation, it involved an early form of feminine hygiene product that dispensed liquid.
Rich, I appreciate your solidarity in the CD-offer matter.
Peikoff had absolutely nothing to lose except perhaps 5 or 10 minutes of his time in opening and playing a cut or two from the CD. And he would have heard some of the most wonderful, creative jazz piano playing there is. (Not to mention my own not-too-shabby efforts. :-)
However, I do agree with the other person (can't click back to see who without losing what I've typed) whose comments (re: Art Tatum, etc.) suggested to me that Peikoff's taste in jazz piano players might be so narrow that my partner's style would have turned him off, too.
Rand was right. To each his own. And I can't get inside Peikoff's mind to know whether he was simply saving himself from hearing something in all likelihood he would not enjoy -- or just being an unadventurous,
narrow-minded dolt.
I'll continue to enjoy (and criticize) his fine lectures, and he'll continue not to hear my music. Fair enough.
can't click back to see who without losing what I've typed
Why's that? It isn't even necessary to click back, you can find the previous posts on the same page by using the scroll bars. And if necessary, you can always click to read other threads or even search the web in the meantime. The safest way to do that is to open a new page, so that you can't lose your editing page in the forward/backward chain.
Oh, you're right, Dragonfly, and thanks for the reminder.
(Why is there no emoticon for chagrin?)
I agree with the "narrow" part, Roger. But I'm a musician to the bone, and in that kind of instance, what with your background, achievements and all, the question that comes to my mind is why he wouldn't be the least bit curious. I guess it's the eclectic in me, I would've been thinking "Well, he clearly isn't sporting a mohawk, and I don't think his aesthetic would be anywhere near Nine Inch Nails, or Korn, or even Megadeath...let's give it a turn, what the Hell<tm>."
But that's me. Send me the fucker, I'll listen to it, and you'll be down twelve bucks. Or, you can wait until later this year, when the new On The Air CD gets done and we'll indulge in trader mentality... :-({|=
Oh well, you can't be having an at-gunpoint audience (I've tried that, and they always seem to have more guns than we do, especially in the west side bars).
I'll betcha Nathaniel will listen to mine if I send him one...
nyah-nyah, nyah nyah-nyah :D/
Send me the fucker, I'll listen to it, and you'll be down twelve bucks. Or, you can wait until later this year, when the new On The Air CD gets done and we'll indulge in trader mentality... :-({|=
Watch your mail, buddy, here it comes! :-)
Probably. Both he and Barbara listened to mine, so your chances are pretty good, I'd say. Nah-nah-nah-nah-nah, nah-nah-nah-nah, nah-nah-nah, nah-nah-nah, nah-nah-nah-nah. (Actual song lyrics -- not mine.)
Kat and Michael Stuart Kelly - Copyright © 2007 Objectivist Living Powered by Invision Community
|
cc/2021-04/en_middle_0021.json.gz/line1950
|
__label__cc
| 0.541174
| 0.458826
|
Deputy Sheriff Thomas H. Hall
Luna County Sheriff's Department
Luna County Sheriff's Department, New Mexico
End of Watch Friday, November 17, 1911
Thomas H. Hall
Deputy Sheriff Thomas Hall and Special Deputy Sheriff A.L. Smithers were shot and killed as they attempted to arrest an escapee from the county jail.
The suspect was apprehended and hanged on April 25, 1913.
Deputy Hall was survived by his wife and five children.
Cause Gunfire
Weapon Rifle
Offender Executed in 1913
{"lat":"32.2612117","lon":"-107.7573957"}
Related LODD Deaths
Special Deputy Sheriff A. L. Smithers
Luna County Sheriff's Department, NM
EOW: November 17, 1911
Thomas Hall was my GREAT GREAT GRANDFATHER. He really was a Hero .Also his Deputy. They Both helped to bring the Law to the West. I'm so Proud he was My 2x Grandpa
Robert Lasby
2X Grandson
|
cc/2021-04/en_middle_0021.json.gz/line1953
|
__label__wiki
| 0.515689
| 0.515689
|
Pros and Cons of the Ketogenic Diet
Nutrition
Medical Advances
COVID-19: Advances in Care
New Therapies and Drug Trials
Science and Research
Patient Stories
Heroes for Better
Healthy Tips
Emotional Health
Fitness
Nutrition
Share on Facebook Share on Twitter Share through Email Print
What You Need to Know About Keto
Though it may seem new to your newsfeed, the ketogenic diet has been around since the 1920s. The low-carbohydrate, high-fat diet gained a foothold when proven to reduce seizures in pediatric patients with epilepsy. While still prescribed for that purpose today, the diet is now touted as a weight loss tool.
Breaking Down the Keto Diet
The keto diet is all about cutting carbs and eating more fat. Here’s what the daily breakdown of carbs, protein and fat looks like:
5 percent of calories from carbohydrates, including low-carb, non-starchy vegetables and small amounts of leafy greens. The keto diet excludes carb-rich foods like grains, beans, fruits and starchy vegetables.
20 percent of calories from protein, such as meat, eggs and cheese.
75 percent of calories from fat, such as oils, unprocessed nuts, butter and avocado.
According to Dietitian Richelle Gomez, MS, RDN, LDN, Northwestern Medicine McHenry Hospital, the ketogenic diet is designed to burn fat by cutting carbs. “Your body turns carbohydrates into glucose for energy,” she explains. “When you cut carbs from your diet, you switch to burning fatty acids, or ketones.”
Breaking down fats for energy is called ketosis. It takes about three weeks of carbohydrate elimination for your body to transition into ketosis.
Here are the pros and cons of the keto diet.
“There has been anecdotal evidence of people losing weight on the ketogenic diet,” says Melinda R. Ring, MD, director of Northwestern Medicine Osher Center for Integrative Medicine. “People also report feeling less hungry than on other types of restricted diets.”
Gomez says people feel less hungry because fatty foods take a longer time to break down in the body. Weight loss not only comes from ketosis, but also from reducing calorie intake by eliminating food groups.
No More Low-Fat
On paper, burning fats by eating more of them is enticing, which is why the diet has become popular. The keto diet allows many people to eat the types of high-fat foods that they enjoy, such as red meats, fatty fish, nuts, cheese and butter, while still losing weight.
Health Benefits for Specific People
The keto diet helps reduce seizures in pediatric patients with epilepsy. Endurance athletes and body builders also use it to scrap fat in short timeframes. The keto diet is being studied for mitigating symptoms for patients with progressive neurological disorders like Parkinson’s disease, but scientific research has not confirmed benefits for these populations.
Difficult to Sustain
Because of the stringent food restrictions, many find the keto diet hard to stick to.
“The ketogenic diet can be effective for weight loss when used in a short time period followed by the adoption of healthier eating habits,” says Cardiologist Kameswari Maganti, MD,Northwestern Medicine Bluhm Cardiovascular Institute. “Unfortunately, it lends itself to yo-yo dieting, which increases mortality.”
Ketosis is difficult to achieve because it’s like a light switch: either on or off. Individuals who consistently track food intake are more likely to remain in ketosis. But the only way to tell if your body is in ketosis is a blood test.
Calorie Depletion and Nutrient Deficiency
“Because the keto diet is so restricted, you’re not receiving the nutrients — vitamins, minerals, fibers — that you get from fresh fruits, legumes, vegetables and whole grains,” says Dr. Ring.
Due to these deficiencies, people also report feeling foggy and tired. These symptoms have been dubbed “the keto flu.” Constipation is also common on the keto diet due to the lack of fiber.
On paper, burning fats by eating more of them is enticing.
Bad Fats in Practice
The high-fat nature of the diet could also have negative impacts on heart health. The American Heart Association recommends limiting saturated fat intake to 5 to 6 percent. “In practice, many people eat high amounts of saturated fats, which could increase cardiovascular disease risk,” says Dr. Maganti. “We see an increase in lipids, or fats, in the blood of patients on the keto diet within six to eight weeks.”
Renal Risk
“Patients with kidney disease have an increased risk of requiring dialysis on the keto diet due to the additional ketones that their renal system has to process,” says Dr. Maganti.
Some people also experience dehydration on the keto diet because they’re eradicating glycogen, which holds water, from their bloodstream.
Food Obsession
“When you micromanage your food intake by tracking how much you eat, it disconnects you from what your body is asking for,” says Gomez. “You start using outside numbers to determine what to eat instead of listening to your body.”
Monitoring food so closely can lead to psychological distress, such as shame, and binge eating. Restriction can lead to bingeing, which often leads to guilt, which then leads back to restriction in a continuous cycle.
Both Dr. Ring and Dr. Maganti recommend balanced approaches, like the Mediterranean diet, for long-term weight loss.
“You can still receive the benefits of ketosis while eating a varied and balanced diet through intermittent fasting,” says Dr. Ring.
Gomez advocates making small changes based on your health goals. “All foods fit into a healthy diet,” she says. “It’s a matter of moderation and finding ways to eat the foods you love without overindulging.”
Consult your physician or a dietitian if you’re looking to change your diet.
Northwestern Medicine Weight Management Services, an HMR® Program
read more about A Closer Look at Supplements
A Closer Look at Supplements
Your 5-Step Checklist
arrow_forward Read More
read more about What's the Deal With Vitamin D?
What's the Deal With Vitamin D?
Learn why you need it and how to get it.
read more about Recipes for Thanksgiving Leftovers
Recipes for Thanksgiving Leftovers
Packed to the giblets with Thanksgiving leftovers? Use them up with four healthy recipes from a Northwestern Medicine dietitian.
|
cc/2021-04/en_middle_0021.json.gz/line1958
|
__label__cc
| 0.657798
| 0.342202
|
Proudly Serving Clients in Birmingham and Solihull
Northwood Banks & Co Limited
The Offices will be closed for Christmas and New Year from 5pm 23rd December 2020 and will re-open on Monday 4th January 2021 at 9am.
1600-1602 Coventry Road,Yardley,
Birmingham, West Midlands, B26 1AL
0121 721 9162 | 0800 043 1369
mail@northwoodbanks.co.uk
Wills and Probate Solihull
“It's unwise to pay too much, but it's worse to pay too little.
When you pay too much, you lose a little money - that's all.
When you pay too little, you sometimes lose everything, because the thing you bought was incapable of doing the thing it was bought to do. The common law of business balance prohibits paying a little and getting a lot - it can't be done.
If you deal with the lowest bidder, it is well to add something for the risk you run, and if you do that you will have enough to pay for something better.”
Wills and Powers of Attorney (LPA )
All prices shown are inclusive of VAT at 20%
Single Will £156 Double Wills £240
Single LPA
Double LPA £240
Single LPA Registration £210 + Court Fee (if applicable) Double LPA Registrations £350 + Court Fee (if applicable)
Consultancy Only £45 Willbank (P.A) £25
Probate Prices and Service
Those dealing with the loss of a loved one will not have been comforted by headlines regarding extortionate probate fees.
According to research by consumer group Which?, the high street banks charge an average of 4% for the administration of straightforward estates under the inheritance tax threshold. Specialist probate companies have also come under criticism for charging similar fees and a lack of regulation of non-solicitors means there is no protection for customers. Solicitors come out comparatively well in a Daily Mail report charging an average of 1.92% for an estate with a value of £270,000.
The fundamental problem is that some service providers are unclear about how they charge for probate work, leaving families with inflated bills that they were not expecting.
At Northwood Banks we constantly strive to provide clear and
fair fees that reflect your needs, regardless of the estate’s size. Rather than charging an unpredictable hourly rate that can lead to surprises at the end, our fees are set from the start and fixed.
We are committed to keeping our fees below the average fees charged by soliciors as reported in the daily Mail report referred to above.
Fee for grant of probate only £550 + VAT
Full estate Administration
Depending on the size and complexity of the case Northwood Banks & Co fees are between 1 and 1.9% of the gross estate. plus a reduced fee for the Grant extraction of £200 + VAT. This is likely to be a fraction of the charges which according to Which? are charged by banks.
How much do banks and others charge?
According to the The Which Survey the charges for a £350,000 estate from nearly all the banks surveyed were substantially higher than the solicitors average including:
Lloyds TSB: 4% of the value of
Barclays: 4.5% of the value of
NatWest/RBS: 4% of the value of the estate
Other providers of probate services such as retailers tend to be less forthcoming about what their charges will actually be.
What do clients want?
According to a recent report called “Shopping Around” by legal research company Jures, two of the most important things for clients were quality and fixed prices.
Quality can be hard to judge in advance but in probate high technical expertise and the experience to give realistic estimates of timing are important (see our Probate Guide for general guidance on this).
The choice of adviser is important. A wrong choice can lead to inconvenience and potentially loss. Too cheap an option can prove too expensive in the end.
Conversely the assurance that comes with a big bank’s brand is not what it once was. The Which? Survey also shows that it is an unnecessarily expensive option.
Third party costs (disbursement costs) and service extras
There are some fees - known as disbursement costs - that you will have to pay as part of getting probate.
With some estates, it is sometimes necessary to sell off assets, such as property, when administering the estate.
As such, there are usually valuation and conveyancing fees which are additional to the quote you receive. See our conveyancing quote calculator
Disbursements are costs related to your matter that are payable to third parties, such as court fees. We handle the payment of the disbursements on your behalf to ensure a smoother process. examples are :
Probate application fee of £155
£7 Swearing of the oath (per executor)
Bankruptcy-only Land Charges Department searches (£2 per beneficiary)
Approx. £170-£250 Post in The London Gazette and in a Local Newspaper – Protects against unexpected claims from unknown creditors.
If there is no will or the estate consists of any share holdings (stocks and bonds) there is likely to be additional costs that could range significantly
depending on the estate and how it is to be dealt with. We can give you a
more accurate quote once we have more information.
If any additional copies of the grant are required, they will cost £50p each (1per asset usually).
On average, estates are dealt with within 6-9 months. (see our probate
guide for more information) Typically, obtaining the grant of probate takes 8-12 weeks. Collecting assets then follows, which can take between 12-24 weeks.Once this has been done, we can distribute the assets, which normally takes 4-6 weeks.
As part of our fixed fee we will:
Provide you with a dedicated and experienced probate solicitor to work on your matter
Identify the legally appointed executors or administrators and beneficiaries
Accurately identify the type of Probate application you will require
Obtain the relevant documents required to make the application
Complete the Probate Application and the relevant HMRC forms
Draft a legal oath or statement of truth for you to swear
Make the application to the Probate Court on your behalf
Obtain the Probate and securely send two copies to you
Collect and distribute all assets in the estate
Our team has over 100 years of collective experience in delivering high quality work in all matters relating to wills and estate administration. The team has particular expertise in high value estates and inheritance tax matters.
We have six members of the team who may work on your matter. Regardless of who works on your matter, they will be supervised by Kevin Parsons, director and Head of Legal Practice and Roland Borriello, director and Head of Wills and Probate.
Kevin Parsons- Director
Kevin is our Head of Legal Practice and has over 35 years' experience in private client work, specialising in wills and probate.
Kevin has been working in this area since he qualified and has helped thousands of families and individuals.
Roland Borriello – Director
Roland originally graduated from University with an accountancy degree and went on to forge a career in Financial Services before
switching to a career in law. Roland was at the forefront of changes to how Legal services is delivered to consumers allowing more choice and flexible options for consumers. .
Stephanie Borriello – Director
Stephanie qualified as a chartered accountant in 1996. Having a fully qualified Chartered accountant in our team is quite rare and an invaluable asset when dealing with our client tax affairs in particular.
Samra Ullah –Solicitor
Samra has a degree in Law from Coventry University and has completed the the Legal Practice Course at Birmingham University. Samra qualified as a Conveyancing Solicitor in 2016. Being an experienced Conveyancing Solicitor is invaluable when dealing with the property sale in an estate.
Maryiam Lunat- trainee licensed Probate Practioner
Mariyam has been working in our probate dept for almost 2 years. She is currently studying for the prestigious CLC Licensed Probate Practioner qualification. Mariyam has a degree in Law from Nottingham Trent University
Conveyancing Prices and Service
Click the button below for an bespoke instant quote
How long will my house purchase take?
How long it will take from your offer being accepted until you can move in to your house will depend on a number of factors. The average process takes between 8-10 weeks.
It can be quicker or slower, depending on the parties in the chain. For example if you are buying a leasehold property that requires an extension of the lease, this can take significantly longer. In such, a situation additional charges would apply.
Stages of the process
The precise stages involved in the purchase of a residential property vary according to the circumstances. However, below we have suggested some key stages that may apply
Take your instructions and give you initial advice
Check finances are in place to fund purchase and contact lender's solicitors if needed
Receive and advise on contract documents
Carry out searches
Obtain further planning documentation if required
Make any necessary enquiries of seller's solicitor
Give you advice on all documents and information received
Go through conditions of mortgage offer with you
Send final contract to you for signature
Agree completion date (date from which you own the property)
Exchange contracts and notify you that this has happened
Arrange for all monies needed to be received from lender and you
Deal with payment of Stamp Duty/Land Tax
Deal with application for registration at Land Registry
Kevin is our Head of Legal Practice and has over 35 years' experience in private client work, specialising in wills probate and conveyancing. Kevin has been working in
this area since he qualified and has helped thousands of families and individuals.
Roland originally graduated from University with an accountancy degree and went on to forge a career in Financial Services before switching to a career in law.
Roland was at the forefront of changes to how Legal services is delivered to consumers allowing more choice and flexible options for consumers.
Charles Fentiman –Solicitor
Charles has been a Solicitor for over 30 years specialising
in Conveyancing and Employment Law. He has a degree in Law from Wolverhampton University. Charles heads up our Conveyancing Dept
Samra has a degree in Law from Coventry University and has completed the the Legal Practice Course at Birmingham
University. Samra qualified as a Conveyancing Solicitor in 2016.
Deepak Badham - Trainee Licensed conveyancer
Deepak originally worked for a large trust Corporation
that specialised in Trust properties. As a private Client Practice many of our conveyancing cases involve trusts and Deepak’s experience in this field is invaluable. He plans to study for the prestigious CLC Licensed Conveyancer
qualification next year. Deepak has a degree in Law from Coventry University.
Contact our will writers in Birmingham today for more information about our prices and services in the West Midlands.
Northwood Banks & Co Ltd
Birmingham, West Midlands,
B26 1AL
CLC License number 11292
info@northwoodbanksuk.com
Mon – Fri, 9:00 a.m. – 5:00 p.m.
|
cc/2021-04/en_middle_0021.json.gz/line1960
|
__label__wiki
| 0.630732
| 0.630732
|
This is a small community in a single neighborhood. As throughout the site, some neighborhood-level data are reserved for subscribers.
More Layers
Maple Rapids
Maple Rapids Profile
Maple Rapids is a tiny village located in the state of Michigan. With a population of 681 people and just one neighborhood, Maple Rapids is the 525th largest community in Michigan.
Occupations and Workforce
When you are in Maple Rapids, you'll notice that it is more blue-collar than most other communities in America. 35.59% of Maple Rapids’s employed work in blue-collar jobs, while America averages only 27.7% that do. Overall, Maple Rapids is a village of sales and office workers, managers, and service providers. There are especially a lot of people living in Maple Rapids who work in office and administrative support (12.40%), management occupations (12.31%), and sales jobs (7.12%).
Also of interest is that Maple Rapids has more people living here who work in computers and math than 95% of the places in the US.
Setting & Lifestyle
Maple Rapids is a good choice for families with children because of several factors. Many other families with children live here, making it a place where both parents and children are more likely to develop social ties with other families. The village’s good public school district and large population of college-educated adults provide an environment conducive to academic success. Many people own their own single-family homes, providing areas for children to play and stability in the community. Finally, Maple Rapids’s overall crime rate ranks among the lowest in the country, making it one of the safest places to raise a family.
In Maple Rapids, however, the average commute to work is quite long. On average, people spend 31.46 minutes each day getting to work, which is significantly higher than the national average.
Maple Rapids Demographics
In terms of college education, Maple Rapids is nearly on par with the US average for all cities of 21.84%: 18.52% of adults 25 and older in Maple Rapids have a bachelor's degree or advanced degree.
The per capita income in Maple Rapids in 2018 was $29,243, which is middle income relative to Michigan, and upper middle income relative to the rest of the US. This equates to an annual income of $116,972 for a family of four. However, Maple Rapids contains both very wealthy and poor people as well.
The people who call Maple Rapids home describe themselves as belonging to a variety of racial and ethnic groups. The greatest number of Maple Rapids residents report their race to be White, followed by Asian. Important ancestries of people in Maple Rapids include German, Irish, English, French, and Polish.
The most common language spoken in Maple Rapids is English. Other important languages spoken here include Polish and Spanish.
AGE OF Maple Rapids, MI HOMES
TYPE OF Maple Rapids, MI HOMES
SIZE OF Maple Rapids, MI HOMES
Employment Industries in Maple Rapids
in Maple Rapids
Maple Rapids VIOLENT CRIMES
Maple Rapids Property CRIMES
This neighborhood is served by 5 districts:
ECONOMICALLY DISADVANTAGED 34.7% 48.6%
FREE LUNCH ELIGIBLE 29.3% 43.6%
REDUCED LUNCH ELIGIBLE 5.4% 5.0%
CARSON CITY-CRYSTAL AREA SCHOOLS
Carson City Elementary School
338 Eagle Ave
Carson City, MI 48811
Carson Citycrystal Alternative Academy School
Carson Citycrystal High School
213 East Sherman St
Carson Citycrystal Upper Elementarymiddle School
Montcalm Community Adult Education School
PEWAMO-WESTPHALIA COMMUNITY SCHOOLS
Pewamowestphalia Elementary School
Pewamo, MI 48873
Pewamowestphalia Middlehigh School
5101 South Clintonia Rd
Westphalia, MI 48894
FULTON SCHOOLS
Fulton Alternative Education School
129 East George St
Middleton, MI 48856
Fulton Elementary School
8060 Ely Hwy
Fulton High School
Fulton Middle School
FOWLER PUBLIC SCHOOLS
Fowler High School
700 South Wright Rd
Fowler, MI 48835
Waldron Elementary And Middle School
11214 West Kent St
Popular real estate near Maple Rapids
St. Johns, MI (Eureka)
St. Johns, MI (W State St / N Lansing St)
88% Match ‐ Ashley, MI
88% Match ‐ Perrinton, MI
87% Match ‐ Breckenridge, MI
|
cc/2021-04/en_middle_0021.json.gz/line1961
|
__label__cc
| 0.727501
| 0.272499
|
Dare to Lead
Author(s): Brene Brown
In her #1 NYT bestsellers, Brene Brown taught us what it means to dare greatly, rise strong and brave the wilderness. Now, based on new research conducted with leaders, change makers and culture shifters, she's showing us how to put those ideas into practice so we can step up and lead.
Leadership is not about titles, status and power over people. Leaders are people who hold themselves accountable for recognising the potential in people and ideas, and developing that potential. This is a book for everyone who is ready to choose courage over comfort, make a difference and lead.
When we dare to lead, we don't pretend to have the right answers; we stay curious and ask the right questions. We don't see power as finite and hoard it; we know that power becomes infinite when we share it and work to align authority and accountability. We don't avoid difficult conversations and situations; we lean into the vulnerability that's necessary to do good work. But daring leadership in a culture that's defined by scarcity, fear and uncertainty requires building courage skills, which are uniquely human.
The irony is that we're choosing not to invest in developing the hearts and minds of leaders at the same time we're scrambling to figure out what we have to offer that machines can't do better and faster. What can we do better? Empathy, connection and courage to start.
Brene Brown spent the past two decades researching the emotions that give meaning to our lives. Over the past seven years, she found that leaders in organisations ranging from small entrepreneurial start-ups and family-owned businesses to non-profits, civic organisations and Fortune 50 companies, are asking the same questions- How do you cultivate braver, more daring leaders? And, how do you embed the value of courage in your culture?
Dare to Lead answers these questions and gives us actionable strategies and real examples from her new research-based, courage-building programme. Brene writes, 'One of the most important findings of my career is that courage can be taught, developed and measured. Courage is a collection of four skill sets supported by twenty-eight behaviours. All it requires is a commitment to doing bold work, having tough conversations and showing up with our whole hearts. Easy? No. Choosing courage over comfort is not easy. Worth it? Always. We want to be brave with our lives and work. It's why we're here.
Imprint : Vermilion
Author : Brene Brown
|
cc/2021-04/en_middle_0021.json.gz/line1962
|
__label__wiki
| 0.764843
| 0.764843
|
Home Infotech Blogs Walmart+ will finally launch in September. Can it compete with Amazon Prime?
Infotech Blogs
Walmart+ will finally launch in September. Can it compete with Amazon Prime?
The Walmart+ membership program launches September 15. Can it offer an alternative to Amazon Prime? | Walmart
One Walmart executive says the new program is “the ultimate life hack.”
Walmart’s much-anticipated membership program, Walmart+, will finally launch nationwide September 15, the company announced Tuesday, about six months after the Covid-19 pandemic pushed the retailer to delay its original timing. The brick-and-mortar retail giant needs the program to be successful in order to stop top-spending customers from fleeing to Amazon Prime.
Walmart+ will cost $98 a year, or $12.95 a month, and focus mainly on unlimited delivery of groceries and other general merchandise from Walmart stores that will be delivered as soon as the same day they are ordered. Members also get fuel discounts at Walmart gas stations and those of partners, as well as access to “Scan & Go” technology, which allows shoppers to use smartphones to scan goods at Walmart stores. The company says it will add more perks in the future. Recode previously reported these may include a branded credit card, early availability on product deals, and, potentially, access to a popular streaming video service.
Walmart wants the membership program to be “the ultimate life hack” for customers, Walmart Chief Customer Officer Janey Whiteside told Recode in an interview on Monday, arguing that its perks will save customers both time and money.
At the same time, Walmart+ will undoubtedly attract comparisons to Amazon’s Prime program, the ultra-popular delivery and entertainment membership program that boasts more than 150 million members worldwide and has developed into a retail industry wrecking ball since its launch in 2005. Amazon Prime includes express delivery of millions of products (including groceries), video streaming of a large library of TV shows and movies, music streaming, and other perks. It now costs $119 a year, and Prime customers spend more and shop more frequently than non-Prime members.
And, most importantly for Walmart, more than half of Walmart’s top-spending families are now Prime members, as Recode previously reported. Which leads to the question: Will they really subscribe to both membership programs?
When asked about comparisons to Prime, Whiteside told Recode that “we didn’t necessarily launch Walmart+ to compete with anything else.” And that answer makes sense; the head-to-head comparison between the services does not look great for Walmart when considering online customers who value the widest selection of goods or the longest list of perks.
In addition to the unlimited delivery perk — which is basically just a rebrand of Walmart’s existing Delivery Unlimited membership — Walmart+ only features two other benefits at launch. One is fuel discounts of up to 5 cents per gallon at Walmart, Murphy USA, and Murphy Express gas stations (Sam’s Club gas stations are slated to be included soon). The other perk is access to Walmart’s Scan & Go technology for in-store shopping, which allows shoppers to scan items with their phone, scan their phone at a self-checkout kiosk, and walk out of the store without stopping to pay. Walmart briefly tested but discontinued the tool two years ago. Walmart’s bet is that the mix of online, in-store, and on-the-go perks, like fuel discounts, will carry unique appeal. Whiteside said that “deepening a relationship further will mean we will get an even greater share of wallet from those customers.” Of course, some Walmart shoppers will also value the $21 difference between the annual fee of Walmart+ and Amazon Prime.
Amazon has made moves in recent years for Prime to appeal to households with less disposable income that historically have favored shopping at Walmart. Amazon added a monthly payment option for Prime fees in 2016, a 45 percent Prime fee discount for those on government assistance in 2017, and, most recently, ways for Prime customers to pay for orders with cash. By early 2017, Amazon Prime membership growth was strongest in the US for households making less than $50,000 a year, according to a study by Robert W. Baird & Co.
The success of Walmart+ will likely hinge on how many customers are attracted to the core grocery delivery component of it. While Walmart’s overall grocery business is larger than Amazon’s and its prices are often cheaper, one fear is that top Walmart customers could eventually turn to Amazon for groceries as they get sucked further into the Prime suite of perks. Sources previously told Recode that some Walmart execs believe that top-spending Walmart families that subscribe to Amazon Prime will still be attracted to Walmart+ because its fresh grocery prices are often lower than those Amazon offers.
In the past, some Walmart executives have opposed a paid membership program, seeing Walmart’s competitive advantage as giving shoppers everyday low prices without the need to pay a membership fee. Whiteside promised that the low prices will remain even for those who don’t splurge for the bonus services.
“In no way does this membership program take anything away from customers who don’t choose to, or can’t afford to, engage with this,” she said.
On the company’s earnings call earlier this month, CEO Doug McMillon stressed the flexibility of Walmart’s customer offerings.
“We’re going to have multiple ways to serve them, and those families will decide in that moment how they want to shop,” McMillon said. “And sometimes they’ll be in the store, and sometimes they’ll do pickup, and sometimes they’ll do delivery, and many of them will buy a membership, and when they do they’ll get benefits from that.”
Help keep Vox free for all
Millions turn to Vox each month to understand what’s happening in the news, from the coronavirus crisis to a racial reckoning to what is, quite possibly, the most consequential presidential election of our lifetimes. Our mission has never been more vital than it is in this moment: to empower you through understanding. But our distinctive brand of explanatory journalism takes resources — particularly during a pandemic and an economic downturn. Even when the economy and the news advertising market recovers, your support will be a critical part of sustaining our resource-intensive work, and helping everyone make sense of an increasingly chaotic world. Contribute today from as little as $3.
Previous articleEmployee-monitoring technology: Productivity vs privacy – INTHEBLACK
Next articleCalifornia’s air conditioner-driven blackouts are only the start
Do your neighbors want to get vaccinated?
Virtual CES Was As Surreal As We All Suspected It Would Be
Bulla Dairy utilises Smart Badge technology – FOOD Magazine – Australia
YouTube is awash with election misinformation — and it isn’t taking it down
Predictions for cloud computing in 2021
Five Supreme Court rulings that signal what to expect next
Dungeons, Dragons, and Diversity
The quinoa evangelist
Sustaining our mission, shaping the conversation
Slowing the spread
Why Has The Online Florist Become So Popular?
Infotech Blogs898
As the technology is getting advanced, there are more products that are created to make life easier. With the help of modern technology, people's standard of living also changes.
|
cc/2021-04/en_middle_0021.json.gz/line1964
|
__label__cc
| 0.741987
| 0.258013
|
Home / Lexus / GS 350 / Lexus GS 350 Reviews / Lexus GS 350 vs Acura TLX
2020 Lexus GS 350 vs. 2021 Acura TLX Review
MPG - City 19 - 20 21 - 22
MPG - Hwy 26 - 28 29 - 31
You'll be making about the same number of stops at the gas station with the Lexus GS 350 as you will with the Acura TLX, as they get the same number of miles per tank of gas.
There are a lot of factors to consider when calculating the overall cost of a vehicle. The main consideration is Manufacturer's Suggested Retail Price (MSRP). The Lexus GS 350 is somewhat more expensive than the Acura TLX. Another consideration is the Destination Charge, which is a standard charge for transporting the vehicle to the dealer from where it's built. The Lexus GS 350 and the Acura TLX have similar Destination Charges.
When it comes to horsepower, the Lexus GS 350 is somewhat more powerful than the Acura TLX.
In terms of seating you'll be able to fit the same number of people in both the Lexus GS 350 and the Acura TLX.
The Lexus GS 350 comes with essentially the same basic warranty as the Acura TLX.
Lexus GS 350 Comparison Reviews
Lexus GS 350 vs. BMW M340
Lexus GS 350 vs. BMW 530
Lexus GS 350 vs. Mercedes-Benz AMG CLA 45
Lexus GS 350 vs. Acura RLX
Lexus GS 350 vs. Audi A6
Lexus GS 350 vs. Volvo S90
Lexus GS 350 vs. Genesis G80
Lexus GS 350 vs. Mercedes-Benz AMG C 43
Lexus GS 350 vs. Mercedes-Benz E-Class
Lexus GS 350 vs. INFINITI Q50
Lexus GS 350 vs. Jaguar XF
Lexus GS 350 vs. Lincoln Continental
Lexus GS 350 vs. Lexus ES 300h
Lexus GS 350 vs. Acura TLX
Lexus GS 350 vs. Alfa Romeo Giulia
Lexus GS 350 vs. Lexus ES 350
Lexus GS 350 vs. Lincoln MKZ Hybrid
|
cc/2021-04/en_middle_0021.json.gz/line1965
|
__label__wiki
| 0.9678
| 0.9678
|
Gulf reconciliation ends Saudi-Qatar dispute
AP Interview: Digital minister says Taiwan to guard privacy
Taiwan plans to create an independent agency to enforce digital privacy, a Cabinet minister says, tackling an increasingly urgent issue as countries step up surveillance during the pandemic.
Taiwan is one of Asia’s most robust democracies and has been praised for its outbreak response, which has kept its death toll at seven. But privacy advocates object to measures used to track the public and say there are too few safeguards for personal information.
The proposed council, if approved by lawmakers, would have power to enforce privacy rules, Audrey Tang, who is in charge of open government initiatives and social innovation, told The Associated Press in an interview.
President Tsai Ing-wen said creating such a body would be a priority following her re-election in January. The opposition Nationalist Party made a similar proposal to the legislature this month.
The agency “will truly be independent,” reporting directly to the head of Tsai’s Cabinet, Tang said Thursday.
Other governments including China and South Korea track the public with smartphone apps, credit cards and other technology. In Europe, governments have faced strong public resistance to tracking apps due to privacy concerns.
The United States is wrestling with how to enforce data privacy following thefts from corporate and government databases. The Trump administration is pressing the Chinese owner of video service TikTok to sell its U.S. unit and is trying to bar messaging service WeChat from the country on the grounds that they might gather too much personal data about Americans.
In Taiwan, authorities use a system dubbed an “electric fence” based on cell phone location data to track people who are supposed to be quarantined. It alerts police if the person’s phone leaves a designated area.
Taiwan is one of the world’s most digitally connected societies with an internet penetration rate of around 82%, according to government survey in 2017. The global penetration rate for internet usage was 53.6% in 2019, according to the U.N. International Telecommunication Union.
Taiwan’s Central Epidemic Command Center was given expanded powers to take “necessary response measures” under legislation enacted in April.
Privacy activists expressed concern about merging of databases to give the epidemic agency information including about immigration. They said there should be limits on how data could be used or how long it would be held.
“The criticism is valid,” Tang said. However, she said the government has set up no new data collection and instead relied on databases such as health insurance cards and a disaster warning system that already were in place.
Tang said Taiwan’s lack of a central agency to enforce digital privacy prevents it from qualifying for the top level of information sharing with the European Union under the 27-nation trade bloc’s stringent data protection rules.
Taiwan’s approach was “a balance between collectivism and individualism,” Tang said.
“The most we can do during that fight of a pandemic is not to make the norm even more destructive for privacy purposes,” she said.
Tang was an entrepreneur and activist for open government before joining Tsai’s Cabinet.
In a Twitter message to U.S. President-elect Joe Biden and Vice President-elect Kamala Harris in November, Tang said, “Governments around the world can start with one simple principle: trust the citizens more.”
EU inches toward landmark budget, virus recovery fund deal
African health official blasts ‘terrible’ vaccine inequality
Asian shares fall on sign of escalating US-China tensions
Editor November 21, 2018
Britain: North Korea Was Behind May Global Cyberattack
Bangladesh-based terror outfit spreads its activities in Indian states, NIA shares list of suspects
|
cc/2021-04/en_middle_0021.json.gz/line1966
|
__label__wiki
| 0.965612
| 0.965612
|
Lebanon plans 11-day, 24-hour curfew, hospital beds fill up
By NDT Bureau January 12, 2021 January 12, 2021
Lebanese authorities tightened a nationwide lockdown Monday, including an 11-day, 24-hour curfew, amid a dramatic surge in coronavirus infections and growing criticism of uncoordinated policies many blame for the spread of the virus.
News of the restrictions to be implemented starting Thursday morning sparked panicked grocery buying as people lined up outside of supermarkets to stock up, raising fears the crowds could further spread the virus.
Lebanon had only just announced a nationwide lockdown last week. But many, including the health minister and officials on a government committee, considered it to be too lenient because it exempted many sectors, such as florists, plant nurseries and factories. Hospitals, meanwhile, were running out of beds amid rapidly multiplying COVID-19 cases.
Critics have said uncoordinated and hesitant policies wavering between relaxing restrictions and shutting down were behind the failure to contain the virus.
For instance, despite a rise in infections, the government relaxed restrictions ahead of Christmas and New Year’s celebrations, hoping to boost a crumbling local economy as thousands of Lebanese expats arrived in the country. Bars and nightclubs, which had been ordered shut for months, were allowed to open.
Daily infection rates have since hovered above 3,000, hitting an all-time high of over 5,000 last week. Doctors and experts say the extent of the spread has yet to be felt, predicting numbers will skyrocket in the coming days, overwhelming health facilities in the country of nearly 6 million.
Despite the nationwide lockdown announced last week, a soccer match was allowed to take place in the northern Tripoli province on Sunday with an audience and was aired on TV.
The spike in cases has exhausted the health care sector, prompting lawmakers and officials to call on the government to consider a 24-hour lockdown without exemptions, and to shut down the airport.
Panicked shoppers swarmed supermarkets following reports they would only be allowed to take delivery orders amid the tightened lockdown. Long lines formed outside chain supermarkets and in some cases arguments broke out over shopping carts, sparking fear the crowds could further spread the virus.
Merna Jumaa left a packed supermarket in eastern Beirut pushing a cart full of groceries but with no bread. “We came to get bread. There was already not a single piece of bread left,” she said, walking away with her mother.
The government declared a “state of health emergency” between Jan. 14-25 that includes a round-the-clock curfew. Lebanon’s caretaker prime minister said earlier that the country has entered a “very critical zone” in the battle against the coronavirus
As of Sunday, the World Health Organization said 81.7% of Lebanon’s hospital beds were occupied and the intensive-care-unit bed occupancy had reached 91.4%, with the highest in Beirut. Some 2,295 health care workers had been infected by Jan. 10, up from 2,015 last week.
Kayssar Mawad, director of a private hospital in Zgharta in northern Lebanon, said he has been turning cases away because there were no more beds. Out of 35 patients there with COVID-19, the illness caused by the virus, seven are in ICU, he said. Zgharta is one of the country’s hotspots.
“It is a difficult period,” said Mawad. “We are refusing many cases. There are no places, no more respirators.”
Since February, Lebanon has recorded more than 219,000 infections and 1,606 deaths. Hospitals have appealed to the government to turn all health care facilities into locations for treating coronavirus patients, saying all 15,000 hospital beds are needed to meet the new surge.
At the largest public hospital in Beirut, Rafik Hariri University hospital, doctors and nurses were overwhelmed with new patients and all 40 ICU beds were occupied. “We are in the heart of the crisis,” said nurse Therese Gobar.
Jad Chaaban, a Lebanese economist and political activist, tweeted that Lebanon “is dying” and called it “another chapter” of the “criminal incompetence” of the authorities.
Lebanon’s political class was facing a wave of antigovernment protests before the virus outbreak. The protesters blamed the long-serving political elite for mismanagement. Then, a massive explosion in August in Beirut’s port killed over 200 people and injured thousands. The blast, caused by the ignition of explosive chemicals stored there for years, has been blamed on gross negligence.
Woman hedges apology in tense interview on hotel attack
Snow and ice disrupt lives, vaccine rollout in Spain
Study Finds High Incidences of Abuse of Mothers During Childbirth
Editor October 9, 2019 October 9, 2019
US, Mexican Officials to Meet on Immigration and Tariff Threat
Editor June 3, 2019 June 3, 2019
Kosovo Voters Flock to Opposition Parties in Parliamentary Poll
|
cc/2021-04/en_middle_0021.json.gz/line1967
|
__label__wiki
| 0.984364
| 0.984364
|
Home > Internet
After Twitter Complained of Censorship, Uganda's Election Ends in Disputes
Critics have complained about Twitter permanently suspending President Donald Trump's account on the one hand and condemning Uganda's internet shutdown on the other.
By James Crowley On 1/16/21 at 4:58 PM EST
Sea Shanties Are Making a Comeback in 2021, Thanks to TikTok
TikTokers are envisioning themselves on a virtual pirate ship, and singing both classic sea shanties and covers of pop songs fit for the ocean.
Hold Twitter To Account
This is not a theoretical debate in free speech, but rather a demand for an equal standard for those who use Twitter to incite violence.
By Arsen Ostrovsky On 1/13/21 at 5:30 AM EST
The Fight for Internet Freedom Begins at Home
The ultimate outcome of the fight for internet freedom is hardly a foregone conclusion.
By James S. Robbins On 1/12/21 at 5:30 AM EST
Trump May Have Encouraged 'Violent Acts' at Biden's Inauguration: Twitter
The warning came in a lengthy blog post explaining the social media site's decision to suspend the president from the platform.
By James Crowley On 1/9/21 at 11:21 AM EST
AMPLIFY - Technology
Keep Your Family Protected This New Year With Online Security: Why & How
New year, new (online) threats. Keep your and your family's online presence safe with the right protection
By Newsweek AMPLIFY On 1/5/21 at 12:13 AM EST
TikTok Account Puts Animation to the Strangest Real 911 Calls
A TikTok user's animated videos of real 911 calls has fans laughing.
By Jon Jackson On 1/4/21 at 1:46 PM EST
What Will Happen to the POTUS Twitter Account in 2021?
It's still very unclear whether the @POTUS account under Biden will be reset back to zero followers or if he will retain all of Trump's followers.
By James Crowley On 12/22/20 at 4:54 PM EST
Congress Should Invest in Internet Connectivity for Underserved Students
When it comes to education, far too many of our nation's students are living without basic broadband internet connections.
By Tim Scott On 12/18/20 at 7:00 AM EST
Here's How A VPN Protects You During Online Holiday Shopping
Don't fall pray to cybercrime while shopping online for your holiday presents. Here's how
By Newsweek AMPLIFY On 12/18/20 at 4:48 AM EST
Meet TikTok's Newest Stars: Frank Sinatra and John Lennon
Whitney Houston and George Michael also have TikTok accounts. The official accounts from the musicians who have passed away appear to be a way to turn younger generations onto their music.
By James Crowley On 12/4/20 at 12:01 PM EST
Who's Performing at the 2020 Streamy Awards: Trixie Mattel and Katya Host
Now in its 10th year, the Streamy Awards on December 12th celebrate all the best and most popular online video creators.
By James Crowley On 12/3/20 at 2:57 PM EST
The Monoliths: A Timeline of the Mysterious Objects That Keep Appearing
It's probably not aliens leaving the mysterious monoliths across the globe, but we can hope.
'Bear Witness, Take Action 2': When Can You Watch Mark Cuban
The followup to June's "Bear Witness, Take Action," will feature panel discussions with celebrities, activists, and scholars to talk about the next steps to be taken towards racial justice.
Twitter Updates Rules of Conduct to Protect Users from Dehumanization
Twitter's new policy focuses on language that dehumanizes people based on race, national origin, or ethnicity, noting that tweets will be deleted and accounts may be suspended.
Tony Hsieh, Man Who Introduced Advertising to the Internet, Dead at 46
The former Zappos CEO played a major role in the redevelopment of downtown Las Vegas in recent years.
By Darragh Roche On 11/28/20 at 4:21 AM EST
Courteney Cox's Thanksgiving Turkey Dance Viewed More Than 2 Million Times
Courteney Cox sent legions of "Friends" fans into a frenzy this Thanksgiving by recreating her iconic turkey head dance.
By Emma Nolan On 11/27/20 at 6:17 AM EST
Man Refuses to Believe Washington State Is Blue: 'The Only Majority
Despite acknowledging that more people in Washington voted for Democrats than Republicans, TikToker Dutch Hollander seemed to argue that land mass demonstrated a majority for Republicans.
By James Crowley On 11/25/20 at 11:59 AM EST
Homeless Families File Lawsuit Against NYC Mayor as Schools Shut Down
Homeless families demand that Mayor Bill de Blasio install Wi-Fi networks in homeless shelters housing school-age children before classes resume after the winter break.
By Katherine Fung On 11/24/20 at 12:31 PM EST
Trisha Paytas Shares TikToks She Alleges Show the D'Amelios N-Word Use
One of the videos in question uses Paytas's own audio.
By Kelly Wynne On 11/20/20 at 11:02 AM EST
Logan Paul Defends Harry Styles Amid Dress Drama
"Is manly like being comfortable in your own skin and being comfortable with who you are? Paul said on the latest episode of his podcast.
Karl Marx Is Trending on Twitter and It's Thanks to K-Pop Fans
As Marx might have said if he had a Twitter account: "A specter is haunting Twitter, the specter of K-pop stans."
Should the Government Aggressively Crack Down on Online Pornography?
Terry Schilling of the American Principles Project debates Hall of Fame adult entertainer Brandi Love.
By Josh Hammer On 11/16/20 at 3:37 PM EST
Science Says Porn Is a Huge Problem. Lawmakers Must Stop Ignoring It
Modern porn isn't anything like your father's Playboy.
By Terry Schilling On 11/16/20 at 3:15 PM EST
Banning Porn Is a Bad Idea. There Are Other Ways To Improve the Internet
We'll never agree on banning porn—that's ridiculous.
By Brandi Love On 11/16/20 at 2:35 PM EST
Jack Black Dancing to 'WAP' on Instagram Brings the Internet Joy
"Certified freak, seven days a week" ...as the song's lyrics go.
By Emma Nolan On 11/16/20 at 11:12 AM EST
YouTuber Jake Paul Mocked for Claiming He Created the First Content House
"I create the first content house—then there's 500 content houses," tweeted Paul, 23, with a Twitter pile-on ensuing.
YouTube Announces There Will Be No Rewind for 2020: 'It Doesn't Feel Right'
The company did shout out all the people who made the best of a bad situation and brought light to 2020 with their videos.
'Stop the Steal' Facebook Group Taken Down After Attracting 300,000 Member
A Facebook group encouraging people to interfere in the election reached over 300,000 members before it was deleted by Facebook.
Rick Astley Just RickRolled All of TikTok, Now Known as 'RickTok'
The singer welcomed everyone to "RickTok" by dancing along to his 1987 hit "Never Gonna Give You Up."
|
cc/2021-04/en_middle_0021.json.gz/line1968
|
__label__wiki
| 0.810684
| 0.810684
|
Go to nysc home
BOSTON SPORTS CLUBS
WASHINGTON SPORTS CLUBS
PHILADELPHIA SPORTS CLUBS
Work with NYSC
Join Our Super Team
colImg
Sports Clubs for Kids
mobile-subnav
Town Sports International
Enter your email for a free trial.
About TSI
Club & Membership Policies
Private Center Management
Like us on facebook Follow us on twitter Instagram
Download from /app/ios Download from /app/android
Join today Join todayJoin today
Login Forn Username Password
New to New York Sports Clubs?
Lucille Roberts Says Thank You to Medical Personnel with Free Gym Memberships
Lucille Roberts is proud to participate in the 1,000 membership give away alongside Town Sports lnternational's other fitness brands
New York, June 25, 2020 -- Lucille Roberts, in conjunction with Town Sports lnternational's other fitness brands, announces a new initiative to thank medical personnel at the forefront of the COVID-19 crisis with free gym memberships. Lucille Roberts is participating in a 1,000 membership giveaway focused on a specific network of hospitals, whose workers will receive free memberships in thanks for the courage and selflessness they have demonstrated on the frontlines of the pandemic.
"It's an honor to be able to give back to our medical personnel in this way," said Patrick Walsh, Chairman and Chief Executive Officer of Town Sports International. "These men and women risk their lives every day to care for all of us, and we hope this small way of saying thank you makes a difference in keeping them strong and healthy for a long time to come."
Starting today, each hospital's COO or HR Representative will be contacted with instructions as to how their staff can enroll for their hospital's allotment of free Elite memberships, which provide access to over 160 of TSl's fitness clubs throughout the Northeast, California, Florida, and Puerto Rico.
The free memberships will go into effect as soon as Lucille Roberts's clubs are back to normal operating hours. In preparation for reopening, Lucille Roberts has instituted a number of important new procedures designed to keep its members and staff safe and healthy. All club locations will reorganize cardio equipment to allow for appropriate social distancing and ask members and staff to have their temperatures taken upon entrance, among other measures.
About Lucille Roberts
With 16 locations throughout Manhattan, Brooklyn, Queens, Bronx, Long Island, and New Jersey, at Lucille Roberts, we believe in serving our empowered community with fitness and wellness experiences in a positive, inclusive and fun environment. This women's only brand is continually innovating to provide the best possible service by offering personal training, tons of group fitness classes, saunas, steam rooms, and so much more. We want you to think of Lucille Roberts as a place for generations of strong, sexy, and confident women to call their own.
https://www.clubindustry.com/press-releases/nysc-lucille-roberts-says-thank-you-to-medical-personnel-free-gym-memberships
Try us out! Enter your email for a free trial.
|
cc/2021-04/en_middle_0021.json.gz/line1969
|
__label__cc
| 0.657993
| 0.342007
|
Pain and “Choice”
By Nancy Valko
It was 1969 and I was fresh out of nursing school when I was assigned to a patient I will call “Jenny” who was thirty two years old and imminently dying of cancer.
She was curled up in her bed, sobbing in pain and even moaned “just kill me.” The small dose of Demerol I injected into her almost non-existent buttocks every four hours “as needed” was not helping. I reassured Jenny that I was immediately calling the doctor and we would get her more comfortable.
However, I was shocked when the doctor said no to increasing or changing her medication. He said that he didn’t want her to get addicted! I told him exactly what Jenny said and also that she was obviously very close to death so addiction would not be a problem. The doctor repeated his no and hung up on me.
I went to my head nurse and told her what happened but she told me I had to follow the doctor’s order. Eventually, I went up the chain of command to the assistant director of nursing and finally the Chief of the Medical Staff. The verdict came down and I was threatened with immediate termination if I gave the next dose of Demerol even a few minutes early.
I refused to abandon Jenny so for the next two days before she died, I spent my time after my shift sitting with her for hours until she fell asleep. I gave her whatever food or drink she wanted. I stroked her back, held her hand and told stories and jokes. I asked her about her life. I did everything I could think of to distract her from her pain and make her feel better. It seemed to help, although not enough for me. I cried for Jenny all the way home.
And I was angry. I resolved that I would never watch a patient needlessly suffer like that again.
So I educated myself by reading everything I could about pain medicine and side effects. I also pestered doctors who were great at pain control to teach me about the management, precautions and rationale of effective pain management. I used that knowledge to advocate and help manage my patients’ pain as well as educating others.
I was delighted to see pain management become a major priority in healthcare and even called “the fifth vital sign” to be evaluated on every patient. I saw new developments like nerve blocks, new drugs and regimens to control pain and other techniques evolve as well as other measures to control symptoms like nausea, breathlessness and anxiety. Now we also have nutritional, psychological and other support for people with terminal illnesses and their families.
Best of all was that I never again saw another patient suffer like Jenny despite my working in areas such as ICU, oncology (cancer) and hospice.
TWENTY-FOUR YEARS LATER
When my oldest daughter was 14, she attended a public high school where the science teacher unexpectedly started praising the infamous Dr. Jack Kevorkian and his public campaign for legalized assisted suicide and euthanasia. Kevorkian’s first reported victim was Janet Adkins, a 54-year-old woman with Alzheimer’s in no reported physical pain who was hooked up to a “death machine” in the back of a rusty van. Mrs. Adkins was just the first of as many as 130 Kevorkian victims, many if not most of whom were later found to have no terminal illness.
Kevorkian escaped prosecution–even after he harvested a victim’s organs and offered them for transplant–until the TV show 60 Minutes aired Kevorkian’s videotape showing him giving a lethal injection to a man with ALS (Lou Gehrig’s disease).
Shockingly, Kevorkian served only 8 years in prison before he was paroled and eventually became a media celebrity peddling assisted suicide and euthanasia.
My daughter, who never before showed any interest in my speaking and writing on the topic of assisted suicide, now stood up and peppered her teacher with facts about Kevorkian. The teacher asked her where she learned her information and she answered “From my mom who is a cancer nurse.”
Sarcastically, he responded “So your mother wants to watch people suffer?” My daughter responded “No, my mother just refuses to kill her patients!” End of discussion.
But not the end of the story. Tragically, we now have legalized assisted suicide in several states and serious efforts to expand it to include people without physical pain but with conditions like Alzheimer’s, mental illness or other psychological distress as well as even children.
As Wesley Smith recently and astutely observed:
Moreover, the statistics from Oregon and elsewhere show that very few people commit assisted suicide due to physical suffering. Rather, the issues are predominately existential, such as fears of being a burden or losing dignity
The public is being duped by groups like Compassion and Choices that campaign for legalized assisted suicide on the alleged basis of strict criteria for mentally competent, terminally ill adults in unbearable physical pain to freely choose physician-assisted suicide with (unenforceable) “safeguards.”
The emerging situation throughout the world is more like Kevorkian’s dream of unfettered and universal access to “medical termination” of the lives of “expendable” people. How much easier is that when people with expensive mental health problems, serious illnesses or disabilities can be encouraged to “choose” to be killed?
Editor’s note. This appeared on Nancy’s blog and is reposted with permission.
Categories icon Assisted Suicide
Tags icon Assisted Suicide, dying, kill, Pain
After 21 years, more and more abortions funded by Minnesota taxpayers
Harry Potter and the 23-week premature baby girl
|
cc/2021-04/en_middle_0021.json.gz/line1974
|
__label__wiki
| 0.577055
| 0.577055
|
Pickup strikes utility pole and rolls, injuring driver
Mike Emery
The Palladium-Item
CENTERVILLE, Ind. — A Wayne County man driving a pickup truck was injured Wednesday when he was ejected from the vehicle as it rolled off the west side of South Centerville Road after striking a utility pole.
Kenneth Vaughn, 53, who had a listed address in Richmond, was flown by LifeLine medical helicopter to Miami Valley Hospital in Dayton, Ohio, with serious injuries after being taken to Reid Health. He was listed in serious condition Thursday afternoon at Miami Valley.
Vaughn was treated at the scene by members of the Centerville and Williamsburg fire departments and by Red Line EMS, Reid Trauma and the LifeLine flight crew, according to Sgt. Jack Martin of the Wayne County Sheriff's Office.
After the accident, which occurred around 5:15 p.m., a Red Line ambulance transported Vaughn to Reid. The LifeLine helicopter that had been on a grassy patch of a field across the road from the accident took off to meet the ambulance at Reid. Medical personnel had begun to unload Vaughn from the ambulance to take him to the helicopter when they reloaded him and headed for Reid.
The accident occurred just past where a sign with a left-pointing arrow indicated a curve in South Centerville Road near Tice Rroad. A small hill led into the curve.
Tire tracks led into the grass west of the roadway as the curve began, indicating the southbound 1993 GMC Sierra 1500 pickup truck missed the curve. The pickup drove through the grass and struck a utility pole, which caused the truck to overturn, Martin said. Vaughn, who was not wearing a seat belt, was ejected, and the pickup came to rest nestled against a cornfield with the upside down cab facing west and the mostly detached, upside down bed resting on the cab.
A short stump of the utility pole remained in the ground, with a large middle section laying next to it. The top of the pole remained suspended in the air, held up by the tension in the wires. A Whitewater Valley REMC truck was on hand and the utility's worker had begun making repairs as the accident investigation continued.
The sheriff's department's investigation indicates alcohol was likely a factor in the accident. The investigation continues.
Centerville Police Department, Indiana Conservation officers, Centerville Fire/Rescue, Abington Fire Department, Williamsburg Fire, Red Line, Reid Trauma and the LifeLine flight crew assisted the sheriff's agency at the scene.
|
cc/2021-04/en_middle_0021.json.gz/line1981
|
__label__wiki
| 0.895921
| 0.895921
|
Pre-Game - Pooch Hall and Dash Mihok Play Liar, Liar
Season 5 E 11 • 06/25/2019
Before stepping onto the Lip Sync Battle stage, "Ray Donovan" stars Pooch Hall and Dash Mihok try to guess which "facts" about each other are true and which are false.
Nicole Ari Parker Is a "P.I.M.P."
Make no mistake, Nicole Ari Parker is not to be trifled with as she puts her own spin on 50 Cent's "P.I.M.P."
Boris Kodjoe Unleashes His Sassy Side
Boris Kodjoe goes full pop star with his unicorn-infused performance of Meghan Trainor's "No Excuses."
Lip Sync Battle Breakdown - Choppy Bangs for the Win
Jeffery Self loves Nicole Ari Parker's look, Justine Marino appreciates Boris Kodjoe's cotton candy realness, and Akilah Hughes believes everyone is a winner.
Lip Sync Battle Breakdown - A Powerful Premature Mic Drop
Akilah Hughes isn't ready for Ben Feldman's rap game, Jeffery Self loves Lauren Ash's level of commitment, and Justine Marino catches a risqué dance move.
Lauren Ash Expresses Herself
Actress Lauren Ash puts her spin on Madonna's classic "Express Yourself," sporting a black pantsuit like the singer wore during her 1989 MTV Video Music Awards performance.
Ben Feldman Cries It Out for the Championship Belt
Actor Ben Feldman wows the crowd with an over-the-top theatrical performance of Celine Dion's "It's All Coming Back to Me Now."
Ben Feldman Knows "It's All Coming Back to Me Now"
Upping the feathers and the flamboyance, "Superstore" star Ben Feldman dons a Liberace-inspired look for his performance of Celine Dion's "It's All Coming Back to Me Now."
Pre-Game - Ben Feldman and Lauren Ash Dig Up Each Other's Most Embarrassing Secrets
Ben Feldman clears the record about the porn he received at camp from his mother, and Lauren Ash reveals her childhood crush on a Canadian TV mannequin.
Lauren Ash Believes You Should "Express Yourself"
The iconic cone-shaped bras are out for Lauren Ash's performance of "Express Yourself" by Madonna.
Lip Sync Battle Breakdown - These Are Top-Level Boy Band Skills
Justine Marino notes Marcus Scribner's CrossFit abilities, Jeffery Self praises Brandon Micheal Hall's impressive take on Kendrick Lamar, and Akilah Hughes rates dance moves.
Brandon Micheal Hall Doesn't Miss a Beat
Brandon Micheal Hall is flawless as he performs Kendrick Lamar's "DNA."
Marcus Scribner Activates His Sexy
Marcus Scribner brings next-level energy to his performance of Bruno Mars's "Perm."
Brandon Micheal Hall Delivers a Wild Degree of Difficulty
Brandon Micheal Hall stuns on the Lip Sync Battle stage when he tries his hand at Kendrick Lamar's "DNA."
Marcus Scribner Is the Godfather of LSB Soul
Marcus Scribner is a force to be reckoned with as he channels Bruno Mars during his performance of "Perm."
Pre-Game - Big Bird and Jason Schwartzman Bring the Party to Lip Sync Battle
Before they face off, Big Bird and Jason Schwartzman get to know each other with some icebreakers, play hide-and-go-seek and get encouragement from Cookie Monster and Elmo.
Pre-Game - Nico Tortorella and Molly Bernard Play How Well Do You Know Your Castmate?
Younger co-stars Molly Bernard and Nico Tortorella see how well they know each other with questions about pets, college majors and quirky habits.
|
cc/2021-04/en_middle_0021.json.gz/line1984
|
__label__wiki
| 0.533909
| 0.533909
|
Turmoil in the Media
By OpenbusinessCouncil - November 24, 2020
In a time where a lot of conventional financial wisdom simply does not apply, some major U.S. media companies are bearing the brunt of an unprecedented downturn. It is now being widely reported that AT&T is desperately trying to untether itself from loss-making cable news channel CNN.
Record Debt
Things could not have come at a worse time for AT&T which is already saddled with losses estimated to be as high as $150 billion. The telecommunications giant might be stuck with CNN for now, though, as an uncertain financial cloud hangs over the financial markets in the midst of the coronavirus pandemic.
CNN was once a world-leading financial news broadcaster and could have broadcast guides to trade cfds, if it was allowed. Instead, in perhaps the most stunning blow, one of its landmarks will soon see the curtains. AT&T has announced the sale of CNN Center itself, the building in Atlanta which is marked by the widely-recognised giant CNN logo sitting outside.
It will be the end of an era that started when Ted Turner began operations there in 1980. The logo and building unfortunately also saw chaos when Black Lives Matter protestors smashed windows and vandalised the structure in May.
Shared Misery
CNN is in good company, though – Disney announced its first annual loss in 40 years this week. Much of the impact has been as a result of the carnage wrought upon its theme parks by the coronavirus lockdowns. The company fired almost 30,000 staff over 2020, compounding what has been an abysmal year.
Some of the blame lies on its over-reliance on the Star Wars movie franchise. The new trilogy, spinoffs, characters and merchandise have proven to possess none of the magic that made the original George Lucas trilogy the classics they are.
The lone bright spot is the company’s launch of the Disney+ app. It was fortuitously launched just when the pandemic began to bite, leading to a sharp increase in home entertainment demand. Whether it can sustain that advantage as more players enter the arena is another question. After 2020, it seems anything is possible.
This is an article provided by our partners’ network. It does not reflect the views or opinions of our editorial team and management.
OpenbusinessCouncil
Open Business Council offers resources, Trade Finance, business advice, SME Finance and a forum and directory for businesses! Improve your business and use the best digital, financial and funding tools to grow ROI – return on investment and ROA – return on attention!
12 Best Bitcoin And Blockchain YouTube Channels To Follow
By - November 24, 2020
Enterprise Data: TIBCO Completes Acquisition of Information Builders
The COVID-19 Pandemic Accelerates Investment To Support Business And Industry
Why Track and Trace is Crucial to Supply Chain Management
DASH Price Analysis – Active Masternodes
|
cc/2021-04/en_middle_0021.json.gz/line1988
|
__label__wiki
| 0.53915
| 0.53915
|
Solarpanelsinfo.co.uk Presents Refreshed Website Logo and Header
11-22-2011 04:36 AM CET | Energy & Environment
Press release from: Solar Panels Info Inc.
Company rebranding is a difficult decision to make especially when it entails changing the look of the logo. Last month, Solarpanelsinfo.co.uk recently unveiled their new logo and header to give it a modern look yet retains the company’s persona and appeal.
Officials of the best solar panels information site say that the refreshed logo symbolises the new and exciting direction the company will undertake. The company’s brand evolution also signals the steady growth and progress they are experiencing over the past few months.
The logo redesign is the first for Solarpanelsinfo.co.uk since it first became a company many years ago. The company wanted to create a logo with simple visual appeal yet easy to recall. They also believe that the logo is the face of the company and thus should be able to communicate subtle characteristics describing Solarpanelsinfo.co.uk.
Apart from the redesigned logo, the company official has also implemented header changes to its website. According to the officials of the company, the header change is intended to give users better navigation, functionality and control over the website.
For years, Solarpanelsinfo.co.uk has been the leading source of online information concerning basic and sophisticated solar panels services. The company provides customers from all over UK with comprehensive solar panel service quotes from their database of solar panel installers near the client’s area. Through the company’s unwavering commitment to providing the best priced solar panels for homes, they have become one of the leading resources of information. Their services includes quotes for PV solar panels, solar water heating, and information regarding Feed-in-Tariffs, renewable heat incentives, and solar electricity.
Solar panels are known as value added investments to your home that could save homeowners from higher electricity costs. Visit http://www.solarpanelsinfo.co.uk/ to help you make informed and smart decisions about solar panels.
Solar Panels Info Inc.
4149 Hawks Nest Lane
You can edit or delete your press release Solarpanelsinfo.co.uk Presents Refreshed Website Logo and Header here
More Releases from Solar Panels Info Inc.
SolarPanelsInfo.co.uk Provides Easy Solar Panel Quotation Service
Today, UK residents looking for affordable solar panels no longer have to suffer. SolarPanelsInfo.co.uk provides an easy and fast way of obtaining solar panels quotes without wasting time, money, and effort. With the company boasting the largest UK network of accredited, certified and reliable solar panel installers, customers are surely in good hands. By answering a simple form on the company’s website, customers will be able to receive at least three…
|
cc/2021-04/en_middle_0021.json.gz/line1989
|
__label__cc
| 0.659458
| 0.340542
|
Weather forecast for the rest of the week from Met Eireann
Home-made ice cream cones
The weather forecast for Ireland for the week from Met Eireann is for it to turn cooler with low pressure becoming more dominant this week, resulting in generally more unsettled conditions with some rain at times.
The weather forecast for Ireland for Monday from Met Eireann is for it be a cool and bright day, with some scattered showers, mainly in the north and northwest at first, but a few will develop further south as the day progresses. Southern coastal counties will be cloudy and misty at first, with patchy rain and drizzle, clearing during the morning. Maximum temperature 11 to 15 degrees, in light northerly or variable breezes.
Any remaining showers will soon die out on Monday night and it will become dry with variable cloud and clear spells. Mist and fog patches will form in the near calm conditions. Lows of 1 to 5 degrees, dipping to 0 degrees locally where clear spells prevail.
The weather forecast for Ireland for Tuesday from Met Eireann is for another cool and bright day, generally, with scattered showers. The best of the sunshine will be through the morning and evening hours, with cloudier periods occurring during the afternoon. Highs of 11 to 13 degrees in light and variable breezes. Showers will persist into Tuesday night, but there will be some dry and clear intervals too, especially early on. Cloud will, however, increase from the south overnight. Lows of 2 to 6 degrees, coldest in the east. Light to moderate east to southeast breezes developing.
A spell of rain is likely push in from the southwest on Wednesday morning, and although the timing and northward extent of this rain is still open to some uncertainty, Munster and south Leinster have a reasonable chance of seeing some appreciable amounts. Mostly cloudy conditions look likely to prevail elsewhere with patchier falls of rain and drizzle. Cool, with highs of 9 to 12 degrees in light to moderate easterly breezes. Mainly dry conditions prevailing in the northwest on Wednesday night. Mostly cloudy with outbreaks of rain and drizzle elsewhere. Lows of 4 to 7 degrees. Light to moderate north to northeast breezes.
Our 7 day Atlantic Chart shows the precipitation and pressure forecast in 6 hour intervalshttps://t.co/9Giuj4CR5m
A nationwide forecast and outlook covering the next week can be found here. https://t.co/9gKN6SVok4 pic.twitter.com/CMOV4rptOJ
— Met Éireann (@MetEireann) April 26, 2020
The weather forecast for Ireland for Thursday from Met Eireann is for it to be mostly cloudy with outbreaks of rain and drizzle, but mainly dry conditions prevailing in the northwest. Highs of 10 or 13 degrees. Light or moderate north to northeast breezes.
The current weather forecast for Friday and next weekend is for it to be somewhat milder but largely unsettled conditions signalled with showers or longer spells of rain moving up from the south or southwest.
|
cc/2021-04/en_middle_0021.json.gz/line1992
|
__label__wiki
| 0.996642
| 0.996642
|
Marja-Liisa Kirvesniemi-Hämäläinen
Name News
Marja-Liisa•Kirvesniemi-Hämäläinen
10 September 1955 in Simpele, Rautjärvi (FIN)
176 cm / 65-72 kg
Simpeleen Urheilijat, Simpele, Rautjärvi (FIN)
After competing without distinction at the 1976 and 1980 Winter Olympic Games, Finnish cross-country skier Marja-Liisa Hämäläinen achieved unprecedented success at the 1984 Olympic Winter Games. With victories in the 5, 10 and 20 km races she became the first woman to win three gold medals for Nordic skiing at one Winter Games. After her triple victory in 1984 she married Harri Kirvesniemi, himself an Olympic bronze medalist. She also won a bronze medal in the relay in 1984 and won her second relay bronze in 1988 but illness prevented her from adding to her medal tally at her fifth Olympics in 1992. At the 1994 Olympic Winter Games, she finished her Olympic career with bronze medals in both the 5 and 30 km races, giving her a total of seven Olympic medals. Hämäläinen-Kirvesniemi was the first woman to have competed in six Olympic Winter Games. At the World Championships, she won eight medals as follows: gold – 1978 and 1989 relay, 1989 10 km; silver – 1985 5 and 10K, 1989 15 km, 1991 5 km, 1993 15 km. In 1989 Kirvesniemi-Hämäläinen won her only Holmenkollen title in the 20 km race, and was awarded the Holmenkollen Medal that same year. She also won the World Cup in 1982-83 and 1983-84 and won a bronze in 1987-88. At the Finnish Championships, Hämäläinen-Kirvesniemi won 30 titles and 46 medals and was named the 1984 Finnish Athlete of the Year and the Finnish Female Athlete of the Year in 1985 and 1991. After her sporting career ended, Hämäläinen-Kirvesniemi suffered with clinical depression, but she announced in 2009 that she will be opening a biomedical facility in her hometown of Simpele.
1976 Winter Olympics Cross Country Skiing (Skiing) 10 kilometres, Women Olympic 22 Representing Finland as Marja-Liisa Hämäläinen
1980 Winter Olympics Cross Country Skiing (Skiing) 5 kilometres, Women Olympic 19 Representing Finland as Marja-Liisa Hämäläinen
10 kilometres, Women Olympic 18
4 × 5 kilometres Relay, Women Olympic Finland 5
1984 Winter Olympics Cross Country Skiing (Skiing) 5 kilometres, Women Olympic 1 Gold Representing Finland as Marja-Liisa Hämäläinen
10 kilometres, Women Olympic 1 Gold
4 × 5 kilometres Relay, Women Olympic Finland 3 Bronze
1988 Winter Olympics Cross Country Skiing (Skiing) 5 kilometres, Women Olympic 5 Representing Finland as Marja-Liisa Kirvesniemi
10 kilometres, Women Olympic 9
1992 Winter Olympics Cross Country Skiing (Skiing) 5 kilometres, Women Olympic 31 Representing Finland as Marja-Liisa Kirvesniemi
5/10 kilometres Pursuit, Women Olympic DNS
1994 Winter Olympics Cross Country Skiing (Skiing) 5 kilometres, Women Olympic 3 Bronze Representing Finland as Marja-Liisa Kirvesniemi
30 kilometres, Women Olympic 3 Bronze
5/10 kilometres Pursuit, Women Olympic 13
1984 Winter Olympics Flagbearer at the Closing Ceremony Representing Finland
1994 Winter Olympics Flagbearer at the Opening Ceremony Representing Finland
Olympic family relations
Wife of Harri Kirvesniemi
Listed in Olympians Who Were Awarded the Holmenkollmedaljen (1989 (as Marja-Liisa Kirvesniemi))
Listed in Olympians Who Won a Medal at the World Nordic Ski Championships (3–5–0 1978 Lahti CCS gold: 4×5 km relay (competed as Marja-Liisa Hämäläinen); 1985 Seefeld CCS silver: 5 km and 10 km (competed as Marja-Liisa Hämäläinen); 1989 Lahti CCS gold: 10 km classical and 4×5 km relay, silver: 15 km (competed as Marja-Liisa Kirvesniemi); 1991 Val di Fiemme CCS silver: 5 km (competed as Marja-Liisa Kirvesniemi); 1993 Falun CCS silver: 15 km (competed as Marja-Liisa Kirvesniemi))
Instead of Ancient Olympia, the torch for the 1952 Winter Olympics was lit in the hearth of a house in Morgedal, Norway. It was the birthplace of Sondre Norheim, a pioneer of modern skiing.
|
cc/2021-04/en_middle_0021.json.gz/line1995
|
__label__wiki
| 0.897226
| 0.897226
|
#Womens Day
How Women's Day celebration turned into a nightmare to many unemployed teachers in India
Women's Day: PM Modi to interact with 'Nari Shakti' awardees
Modi reveals why he is giving up his social media accounts on Sunday
Women’s Day: As US-Taliban talks go on, UN seeks bigger role by women in Afghanistan peace process
Women’s Day: This Bengaluru entrepreneur has revolutionised waste management
Women's Day: Robert Vadra says happy to be surrounded by 4 strong women
7 min ago Coronavirus found on ice cream in China
Women’s Day: Biopic made on India’s first stuntwoman ‘The Sholay Girl’
oi-Shubham Ghosh
By Shubham Ghosh
| Published: Friday, March 8, 2019, 16:15 [IST]
Bengaluru, March 8: Often, we hear and talk about stuntmen undertaking the tough acts on behalf of actors on the screen to save the stars from the real risks. But how many times do we really discuss about women stunts?
Photo caption: Bidita Bag; Image credit: Bidita Bag Facebook page
Or did many of us know before that the Hindi film industry also had women stunt artistes to chip in for leading ladies displaying acrobatic and fighting skills on the big screen?
When we talk about stuntwomen in films, one film that comes to our mind is the 1975 blockbuster 'Sholay' that had a sequence of even one of its leading heroines engaging in a life-and-death escape from horse-riding dacoits in her tonga.
Women's Day Special 2019: How should women plan their retirement?
However, although it was Hema Malini who had enthralled the audience with her daring act against the dacoits, the stunts were performed, some of which life-threatening, by Reshma Pradhan. She had been the body double of Hema Malini in the blockbuster and also for many other actresses in the Hindi film industry in the seventies and eighties.
However, it is not too many people who knew about Pradhan's contribution, especially in these years, but now, she is set to have a broader popular base as a biopic 'The Sholay Girl' released as an web film on Friday, March 8, the International Women's Day. Actress Bidita Bag portrayed the role of Pradhan in the film
'The Sholay Girl' is an original web film by Zee5 and is produced by Shrabani and Sai Deodhar - mother and daughter.
Pathan was just around 14 when she started the work as stuntwoman to back her poor family and faced a lot of resistance from the male stunt workers.
"At that time, there were hardly any women taking up the role of even body doubles, let alone those requiring stunts. So, she earned the wrath of stuntmen; they accused her of stealing her job!" Bidita was quoted as saying by The Better India.
Women's Day: This Bengaluru entrepreneur has revolutionised waste management
Pathan joined the industry in 1968 and it took some years for her before gaining recognition. She told The Better India: "Between 1971-72, I began getting more work, but these would rarely stretch beyond ten days in a month. Slowly, that began to change with more work coming along my way. But the real break came in 1975-with Sholay."
Pathan's name had such a circulation after that epic film that she even came to be known as "Sholay Girl". Pradhan also had faced several life-threatening situations in her career and had even suffered a serious injury during the stunt for 'Sholay' but she never gave up her work.
Once, a jumping sequence had also imperilled the baby she was carrying and then she decided to take a break only to return later, The Better India report added.
More WOMENS DAY News
Women’s Day: Moroccan woman who has scaled highest peaks in all seven continents
Sexist Women’s Day remark: Ram Gopal Varma apologises, Sunny Leone says ‘choose words wisely’
Complaint filed against Ram Gopal Varma for his 'Women's Day' message
Abolish tax on sanitary napkins: Congress to Jaitley
Women's day: Dip in cases of rape in Bengaluru, dowry is worse
Unfollow those who threaten women: Kejriwal's message to PM on Women's Day
PM Modi salutes the spirit of Nari Shakti on Women's Day
Celebrating womanhood, celebrating International Women's Day
Google doodle pays tribute to women on International Women's Day
Women power soars high: Air India flies with all-women crew, creates history
Crimes against women due to lack of good values: Raveena Tandon
womens day biopic
Story first published: Friday, March 8, 2019, 16:15 [IST]
100 ex-civil servants write to PM over transparency in PM-CARES fund
Will incorporate 'Karnataka-occupied areas' into Maharashtra: Uddhav
|
cc/2021-04/en_middle_0021.json.gz/line1997
|
__label__cc
| 0.739494
| 0.260506
|
At Payton & Associates, serving our clients is a top priority. We are working remotely to service our clients’ needs without interruption. We can be reached by phone, video, and email through our contact tab. Our thoughts are with everyone impacted by the COVID-19 pandemic. We hope that everyone takes precautions and stays safe and healthy.
Commercial Litigation Attorneys
Media/News
We serve businesses in
South Florida in a wide
range of commercial
business litigation.
Florida Ponzi scheme laws
On behalf of Payton & Associates, LLC | Mar 30, 2018 | Business Torts
A Ponzi scheme is a type of investment fraud that pays individuals who invested earlier in the scheme with the money the swindle takes in from later later investors. This creates the illusion that the enterprise is profitable and keeps law enforcement at bay – while it lasts. For years, Florida has unfortunately proven to be fertile ground for these types of schemes, whether involving gold bullion, fake stocks or real estate.
Ponzi schemes are named for Charles Ponzi, who perpetrated a large-scale investment scam of the kind that now bears his name. The red flag in any such scheme is an offer of above-market returns on investment in a short time. While many of these schemes end up in federal jurisdiction – due either to the subject matter or size of the case – the Sunshine State has also enacted laws to protect its citizens and help them to recover on their fraud claims.
In Florida, the Deceptive and Unfair Trade Practices Act is the law under which Ponzi schemes are investigated and prosecuted and under which consumers can recover. The state’s enforcing authority may investigate the actions alleged to comprise a Ponzi scheme, bring a declaratory judgment action or injunction against those involved in the actions, or refer the case to law enforcement for prosecution. In addition to referral for criminal prosecution, the enforcing authority can also levy a civil penalty against those who violate the act.
Ponzi schemes often cause considerable financial damage and, in some cases, have ruined the lives and livelihoods of victims. While governments do what they can to protect consumers, fraudsters will continue to try and separate victims from their hard-earned money. This means that consumers must also be vigilant and vet any investment opportunities that seem too good to be true.
Source: FindLaw.com, “Florida pyramid and Ponzi scheme laws,” accessed Mar. 26, 2018
Business Litigation (103)
Construction Litigation (48)
Contract Disputes (117)
DO YOU KNOW WHAT TIME IT IS? OR, CONTROLLING THE TOO TALKATIVE WITNESS
DOES COVID-19 PROVIDE AN EXCUSE FOR NON-PERFORMANCE OF A CONTRACT?
Can a Judgment Creditor Garnish a Contractual Obligation?
Should You Consider Arbitration?
2 S. Biscayne Blvd., Suite 2300
Serving clients in Miami and throughout Florida, Canada, Europe, Central and South America.
© 2021 Payton & Associates, LLC. All Rights Reserved.
|
cc/2021-04/en_middle_0021.json.gz/line2001
|
__label__wiki
| 0.945215
| 0.945215
|
South Park: The Stick of Truth (for PlayStation 3) Review
By Will Greenwald
https://www.pcmag.com/reviews/south-park-the-stick-of-truth-for-playstation-3
South Park: The Stick of Truth is a filthy, disgusting, offensive mess. A really good filthy, disgusting,offensive mess.
South Park: The Stick of Truth (for PlayStation 3) South Park: The Stick of
Captures South Park perfectly.
Mechanics are engaging and active for the genre.
Leans toward conservative JRPG trappings.
South Park: The Stick of Truth is like a filthy version of Paper Mario: The Thousand Year Door. That's high praise. It's a Japanese-style role-playing game, or JRPG, in only the most superficial sense of its mechanics, one which adds enough combat and environmental interaction to make it feel like it's more than just selecting menu options. It also has a single-camera panning perspective across an increasingly open, side quest-ridden world based on a single town with locations that spider out from there, and a narrative that focuses on humor more than drama or character development. So, basically, a filthy version of Paper Mario. A really, really filthy version. A version so filthy the console ports in other regions of the world were censored. The game, developed by Obsidian Entertainment and published by Ubisoft, is available for $59.99 on PC, Xbox 360, and PlayStation 3. I played the PS3 version.
But one thing at a time. Let's start with the premise of South Park: The Stick of Truth($14.97 at Amazon). You're a new kid in South Park, referred to as "the new kid" or "Douchebag." You're a silent protagonist in the same vein as Chrono or the main characters in the Persona or Dragon Quest games. This is literal; you don't say anything, and it really pisses off your parents and confuses your new friends. You join Grand Wizard Cartman in his Kingdom of Kupa Keep (spell out the acronym), one of two sides in a humans-versus-elves LARP war all the kids in town are playing. In true South Park fashion, it gets weirder, more offensive, and more deadly from there.
I don't want to spoil the plot for you, but more than that I don't want to spoil the jokes. They're everywhere, and every bit as dirty as any given episode of South Park. Also, my editor won't let me explain the jokes properly. The phrase "beastiality, abortions, and lots of pooping" comes to mind, and probably would have been a good subtitle for this game if "The Stick of Truth" didn't work.
Looks Like South Park
The game looks and sounds like an episode of South Park. The show's signature construction paper style works great as a design aesthetic in a high-definition video game, and I mean that without sarcasm. The cut scenes look like they could have come straight out of a 10:00 p.m. airing on Comedy Central, and the game looks so crudely alive and full of action whether you're wandering around town or fighting enemies. The voice acting (mostly Trey Parker and Matt Stone, naturally) only enhances this effect, and the generous smattering of f-bombs and occasional poorly drawn cartoon nipple evoke the South Park movie (which came out 15 years ago) and the show's steady push into the more graphic and more offensive.
Combat is where the game really feels like Paper Mario. It uses a turn-based system that relies on timed button presses to hit and block, making the action much more direct and interaction than the usual menu item selections. You can make light or heavy attacks by hitting the appropriate button when your weapon flashes, and every special move has its own inputs you need to make for it to be effective. You can even block enemy attacks by hitting a button at the right time to reduce the amount of damage you take. You fight alongside one partner, like Butters or Kenny, who serves as a second party member that can be swapped out for another at any time. Each partner has their own skills that can help you out, and offer both amusing commentary and assistance when you're walking around.
You can choose one of four classes: Fighter, Wizard, Thief, and Jew. I disappointed my mother by choosing Thief, which gave me armor-piercing backstab moves and let me steal items, compared to the Jew's protective magics. You can equip anything and chance how your character looks, but different items work better for different classes. As you level up, you can put points in different skills, and get additional perks by making friends on "Facebook."
The social network thing is actually a big part of the game. Making new friends can be as easy as talking to them or as hard as finding them and doing a line of quests for them, after which they send you a friend request. More friends mean more people are willing to be more friends, which adds to your perks. Your social network page serves as your menu system, keeping you updated on quests and tracking the friends you make. The menu also lets you distribute your skill and perk points, manage your inventory, and look at the in-game map.
Your skills and abilities work outside of combat to help you solve puzzles, and they're important for finding the many, many secrets and collectibles in the game. Once you get a ranged attack, you can stun enemies from afar and can break objects in your way. Once you get "magic" (Cartman teaches you how to fart), you can blow apart walls if they're near open flames. Once you get buddy commands, you can have Butters heal characters or Kenny... well, it's pretty messed up. Then there's another environmental skill that involves the butt. Yes, you have multiple butt-based problem-solving abilities.
Come on Down to South Park
It's hard to call South Park: The Stick of Truth "charming," because South Park isn't charming. It's gross and weird and offensive. Still, that gross, weird offensiveness is fundamentally part of South Park's "charm," even if it isn't the best word, and this game has that charm in buckets. Mechanically, it's a somewhat engaging JRPG that is enjoyable to any fan of the genre. Creatively, though, it's the ultimate interactive South Park experience, taking you as your own character on a tour through the world's most infamous quiet little mountain town and all of the obscenities and viscera it's known for.
South Park: The Stick of Truth (for PlayStation 3)
Best Game Picks
The Best VR Games for 2021
The Best PC Fighting Games for 2021
The Best Game Streaming Services for 2021
The Best PC Shooters for 2021
More from Ubisoft
Game Product Comparisons
Twitch vs. Facebook Gaming: How Should You Live Stream Video Games?
Stencyl vs. Fuze4: What's the Best Way to Start Making Your Own Video Games?
GOG.com vs. itch.io: Which PC Game Store Sells the Best Hidden Gems?
Steam vs. Epic Games Store: Which PC Game Store Deserves Your Dollars?
PUBG vs. Fortnite: Which Will Be the Last Battle Royale Standing?
Ratchet and Clank Come to PC With This Clever Doom 2 Mod
Frontier Mod for 'Fallout: New Vegas' Is Finally Available
Google Stadia to Support Sharing Saved Game States Via URLs, Starting With Hitman 3
Netflix’s Terrific Video Game Shows Shame Hollywood’s Awful Movie Adaptations
About Will Greenwald
Will Greenwald has been covering consumer technology for a decade, and has served on the editorial staffs of CNET.com, Sound & Vision, and Maximum PC. His work and analysis has been seen in GamePro, Tested.com, Geek.com, and several other publications. He currently covers consumer electronics in the PC Labs as the in-house home entertainment expert, reviewing TVs, media hubs, speakers, headphones, and gaming accessories. Will is also a THX Level I home theater expert and ISF Level III-certified TV calibrator, which ensures the thoroughness and accuracy of all PCMag TV reviews.
Read the latest from Will Greenwald
Samsung Galaxy Buds Pro Review
Anbernic RG351P Review
Herman Miller X Logitech G Embody Gaming Chair Review
Samsung Odyssey G9 Gaming Monitor Review
Razer Hammerhead True Wireless Pro Review
More from Will Greenwald
|
cc/2021-04/en_middle_0021.json.gz/line2002
|
__label__cc
| 0.530461
| 0.469539
|
It's Android vs. Apple: Will You Switch Sides?
Next week promises an epic battle between Apple and Android as several lusty Android cellphones hit the market on June 23 and, the next day, the iPhone 4 is released.
There's been a lot of jabber about OS market share, and dozens of comparisons between the two handset makers -- and soon it'll all come to a head. On June 24, you'll have to decide: Android or Apple? What phones are most appealing? Will either make you switch carriers?
The OSes
Let's start with a quick overview of the OSes. After all, what's the value of a sexy cell if the OS is broken trash?
The iPhone's iOS 4.0 comes packed with features, including iBooks, wallpaper, folders, games, camera zoom, multitasking, tethering, and much more. iPhone 4 owners get all of these goodies while some older models receive a smaller package.
Android 2.2 -- or Froyo -- is due to land on a bunch of phones any day now. Its features, which include tethering, multitasking, and even Flash support, have been touted as serious contenders and, to some, Apple poses no threat to 2.2's musculature.
An army of Android phones are about to descend upon us. Reports say that Motorola, Sony and LG are all prepped to debut new Android-powered phones this summer. LG may even release 20 Android phones. That's a whole lot of phones.
The hottest Android handset of them all is reported to be Motorola's Droid X. Based on its expected cavalcade of features, the overused term "iPhone-killer" may not be far off. According to reports, the Droid X has a massive 4.4-inch screen with 854 x 480 resolution; an 8 megapixel camera with flash and the ability to record 720p high definition video; a 1-GHz processor; an HDMI out port; 4 physical buttons along the bottom of the device; a capacitive touchscreen; and 8GB of internal storage. Flash 10.1 is also expected -- a feature Apple has refused to include in its products.
Motorola also reportedly plans on sneaking out the Droid 2, which will sport a few minor improvements over the original.
Found in a gym and (expectedly) handed to Gizmodo, the Droid Shadow may also see release. The Droid Shadow is said to have 16GB of internal storage; a Snapdragon processor; an HDMI port; an 8MP camera (capable of 720p video capture); and a 4.3-inch screen.
By now you've probably already salivated over the iPhone 4 and its specs. It is, without a doubt, a major upgrade from previous iPhone models. We're talking 24 percent thinner; a 960-by-640-pixel IPS Retina display; Apple's A4 CPU; a 5 megapixel camera with a LED flash, a backlit sensor, and integrated 5X zoom; 720p high-def video; and tons more.
Simply put, Android has gobbled up OS market share. Android sales had grown 707 percent from year-to-year and NPD researchers concluded that Android phones had actually outsold Apple phones in America for the first quarter of 2010.
This shouldn't come as a surprise and definitely shouldn't influence opinions. There is one iPhone; there are so, so many Android phones. Of course Android is going to sponge share. Computerworld's JR Raphael posits this data as though "Apple's fallen and it can't get up." Bleh. The iPhone 4 has over 600,000 pre-orders -- and those are just pre-orders. With that kind of popular demand, Apple may stand a chance to knock Android off its pedestal.
Will You Switch?
Here's the ultimate question: can all these specs, all these shiny new phones, and all this data actually influence your decision to stick with the iPhone's locked-down AT&T service, or will you hop onto the Android bandwagon, spread across multiple carriers?
I'm perilously close to switching to Android. I've been an iPhone junky since the 3G was released. When the 3GS debuted, I knew Apple would completely re-do the physicality of the device and I skipped out on the upgrade (plus, back then, AT&T didn't offer sweet upgrade deals, and I would've had to pay a ton).
Since then I've made it no secret that AT&T is my worst enemy -- the Skeletor to my He-Man, if I may be so modest. I couldn't make phone calls. My 3G reception dropped constantly. I was paying more than $90 a month for a beloved phone that simply did not work, given its carrier. And when rumors of a Verizon iPhone circulated, I was mostly sold: I needed to be a Verizon boy.
Then came my iPhone 3G problems. After less than a year of ownership, my 3G model began crashing more frequently than an armless driver. Apps wouldn't load; Web sites crashed; iTunes skipped -- the list went on and on. I went to the Apple store and got a replacement. Now my replacement is even worse than my first 3G.
Then came the Droid Incredible -- a powerful and sleek Android-powered cellphone. After a lot of research, the Droid Incredible sounded like the phone to have. Plus it seemed I couldn't lose with Verizon.
Then came the iPhone 4 pre-order fiasco. I spent half a day (at work, mind you) attempting to pre-order the phone with zero luck. Now I can't get one until mid-July -- a smack in the face to a loyal customer if I've ever felt one.
There are just too many problems, and with the floodgates of Android handset options opening up so soon, I think it's about time every iPhone owner who hasn't already pre-ordered Part IV should seriously consider ditching Apple and heading over to Android's camp. The phones will just get better and better. Meanwhile, there's only one iPhone 4, and that's ball-and-chained to -- ugh -- AT&T.
So who's joining me?
|
cc/2021-04/en_middle_0021.json.gz/line2003
|
__label__cc
| 0.60941
| 0.39059
|
Religion, The Golden Rule & Revolution
Worshiping a Strange God
Key Videos, Articles & Books
Attn: ALLSTON-BRIGHTON FOLKS
George Floyd & The Gall of Our Mayor!
WHAT WILL IT TAKE TO WIN?
Allston-Brighton Speaks Out!
Affordable Housing vs. Gentrification
Brighton People Posed for a Photo
Stop the Gentrification: Here's How
Better for WHOM?
"Affordable" Housing is NOT Affordable
100%, not 20%, Affordable Housing
HOUSING for FAMILIES, & GREEN SPACE?
The Moral Corruption of Our Leaders
Our City Councilor Liz Breadon???
Genuine Democracy & Affordable Housing
Some Lower Allston History
Do You Recognize Anybody Here?
Revolutionary Community Organizing
Dear BACC
BACC Censorship
WHY WEAR OUR BUTTON/STICKER?
JOIN THE EMAIL GROUP
About the editor, John Spritzler
Who's Our Leader?
No Big Leader for Us
What's the Measure of Our Success?
Let's Act Like the Majority We Are!
Why Wear a PDR Button/Sticker?
Sticker-Project Emails
Sticker-Project Emails pg. 2
Please Read This If You Wear a Button
Facebook Groups for Egalitarians
BLOG: NO RICH & NO POOR
OUR MISSION: EGALITARIAN REVOLUTION
What Is an Egalitarian Revolution?
What is an Egalitarian Economy?
Genuine Democracy: What Is It?
Why Have No Rich & No Poor?
How We CAN Remove the Rich from Power
Is ANYTHING "The Right of ALL"?
Affordable Housing for ALL
Legitimate Government: What Makes it So?
1865 Missouri: Racists Can't Vote :)
The Short Term Goal
WHAT IT'LL TAKE TO WIN
BLM: What's the Ruling Class Gonna Do?
What Replaces the Police?
What Replaces the Prisons?
Lessons from the Spanish Revolution
FAQ: How to Have No Rich & No Poor
Is APATHY the problem?
FEAR, YES. PARALYSIS, NO.
Mass Media: What's Its REAL Purpose?
Beware of Anti-Revolution Pessimism
LET'S GET OFF THE TREADMILL OF DEFEAT
LET'S GET ORGANIZED!
HERE'S WHAT AN INDIVIDUAL CAN DO
Most People Are Egalitarians
Who Are the "Rich" to Remove from Power?
What Happens to the "Rich"?
Here's How the Rich Treat Us Like Dirt
Freedom & Egalitarianism
Freedom...But to Do What?
Justice & Egalitarianism
Separation of Church & State: Bogus Idea
Prostitution & Egalitarianism
Why Good People Want Money
Some Rich People ARE Good
Can We Vote the Rich Out of Power?
Do Your Civic Duty: Vote
Remove the Rich from Power Legally??
What Makes Reform Movements So Weak?
Why Be OPENLY Revolutionary?
What Causes a Political Sea Change?
Taxing Billionaires is NOT the Solution
We Need an International Movement
The Transitional Phase to Egalitarianism
Credibility, But In Whose Eyes?
MUTUAL AID and NO RICH & NO POOR
What's the First Step?
Make Your Reform Effort EVEN STRONGER
How to Defeat Big Money's Arguments
What about Worker-Owned Co-Ops?
Get Money Out of Politics?
Views About Violence
The "This I Believe" Signature Campaign
Egalitarianism: What is it?
It's NOT Utopia!
What "Equality" Does NOT Mean
Why No Rich and No Poor?
Is Egalitarianism a Freeloader Paradise?
Blue Collar, White Collar?
Why Abolish the Use of Money?
Why Laws Only Made by Local Assemblies?
Why Only Egalitarians Can Make Laws
Real Life Voluntary Federation
Real Life Rationing
A Local Assembly Meeting: Spain (1937?)
What Replaces the Free Market?
Egalitarianism and Private Property
Luxuries and Egalitarianism
Small Business Persons & Egalitarianism
Entrepreneurship, Egalitarian Style
What about Freeloading Slackers?
Economic Productivity & Egalitarianism
What Motive to Work, If No Money?
How Can Abuse of Power Be Prevented?
Egalitarian "Bill of Rights"
Where Do Novelists & Musicians Fit In?
Why Egalitarianism is MUCH Better
How to Win Egalitarianism
Why Soldiers Will Join Us
Non-Violence? Or Non-Cruelty? View #1
TIT FOR TAT Guide for Violence
Egalitarian Militias
Authoritarian Principle Denounced
Trade Between Distinct Sharing Economies
Dealing with Criminals & Freeloaders
Barter versus Money
Children and Mentally Incompetent Adults
Egalitarian Response to the Pandemic
Global Wealth Equality: What it Means
An Egalitarian View of Physical Reality
LOTS OF SUPPLEMENTARY ARTICLES
Egalitarianism Compared to other "Isms"
Open Letter to Socialists
COMMUNISM NO! SOCIALISM NO!
The Communist Manifesto is Wrong
From Marx to Lenin
Marx Didn't Invent these Great Ideas
A GOOD Government is Needed
Are You a Progressive or Revolutionary?
Mom & Pop Capitalism?
Libertaria: A Libertarian Paradise
Egalitarianism Outproduces Capitalism
DSA: Its Goal Maintains Class Inequality
What about Sweden & Social Democracy?
Social Democracy (as in Germany)
Sweden: Why They're Rioting
Denmark: a Class Conflict Battleground
Iceland: Myth vs. Reality
Mayflower Colonists: Truth vs Myth
Egalitarianism Worked in Spain 1936-9 &
Egalitarianism in a Mexican Town
Egalitarianism in Ethiopian Village
Seattle 1919: Workers Ruled for 6 Days
Egalitarians in Kurdish Rojava (Syria)
Egalitarianism in Brazil
England 17th Century Egalitarians
England: John Ball Was Right
Local Assemblies of Egalitarians
Egalitarian "Notices" in Real Towns
DON'T CLICK if **
**OUR FAKE DEMOCRACY**
Proof We Have a Fake Democracy
Who Rules America?
Democracy: A Big Misunderstanding
U.S. Constitution: Help or Hindrance?
The Rule of Law...But for WHOM?
Voting Didn't & Won't Work
The Problem With All the Politicians
Elections: Why Do Our Rulers Hold Them?
GOP & Dems: Different But Same Master
Reforms Weren't Won by Voting
GOP, Dems DIFFERENTLY Serve SAME Rulers
Voting Is Your LEAST Important Act
How Important Is Voting?
Supreme Court: It ALWAYS Serves the Rich
Good Reforms Were NOT Won by Voting
How to Evaluate a Politician
MLK Jr. & Malcolm X-Why they Killed Them
US Founding Fathers: Enemy of the People
IWW "Wobblies" Revolutionary Lesson
Voting is NOT a Right of All Citizens
**BAD GUYS EXPOSED**
Robert Reich: Wolf in Sheep's Clothing
Bill Gates: Not a Good Guy!
The REAL Problem with Dr. Fauci
What the Nation's Top Doc Ignores, & Why
Jimmy Carter: Myth vs. Reality
Jeffrey Sachs Is NOT a Good Guy!
Henry Ford's High Wages Explained
In Cahoots (Trump, Clinton, etc.)
Mass Murderers: Our "Leaders"
Operation Gladio & MKUltra
**U.S. FOREIGN POLICY**
The "National Interest": Bogus Idea
Israel Lobby & Our "National Interest"
U.S. Foreign Policy & Defense
Sanctions on Iran are Evil
Nuclear War: Why Our Rulers Risk It
China: A Bogeyman Enemy
U.S. Armed the Soviet Union in Cold War
Drones Real Purpose: Create Hatred of US
Inventing the Enemy
Vietnam War: Ken Burns LIED
World War II--Not a 'Good War'
**ISRAEL & PALESTINE**
Israel's Existence: What It Means
LISTEN ANTI-ZIONIST!
Should There Be a Jewish State?
Israel/Palestine: Not REALLY Complicated
Why Our Gov. Supports Israel & Shouldn't
Israel's Government Attacks Jews Too
Evidence Israel Leaders Want Jews to Die
Should ANTI-anti-Semites Support Israel?
Should ANTI-anti-Semites--Cont.
Why Pick on Israael? Here's Why
The 'Two State Solution': Morally Wrong
Israel/Palestine: A JUST Solution
Why U.S. Billionaires Support Israel
Israel Lobby's Power: From US Rulers
Israeli Leaders & Hamas NEED Each Other
Rocket Attacks on Israeli Civilians
No! Non-Jews Aren't Inately Antisemitic
The Holocaust & Its "Deniers"
Newt Gingrich's Brilliant Insight
My Articles re Israel/Palestine
Specific Issues Part 2
**IMMIGRATION**
Illegal Immigration: What Should We Do?
We Have a Right to Limit Immigration
Three Questions If You Want to Deport
Letter to Editor: Illegal Immigration
Muslim Mass Immigration
Sharia & Democracy
**RACE**
An Injury to One is an Injury to ALL
Racism is Rampant & Hurts ALL Races
The New Jim Crow
The Racist War on Drugs
Crime and Race
Crime (continued)
Let's Talk about Black on Black Crime
Police Brutality and Oppression
Let's Fix this BLM Weakness
Police Brutality & Oppression (cont.)
Police: Iron Fist in Velvet Glove
Jim Crow Hurt Poor Whites in the South
"White Privilege" Rhetoric: a TRAP
Is It a "Privilege" Not to Be...
MLK, Jr.: Jim Crow Hurts Poor Whites
No! Whites Aren't Naturally Racist
Affirmative Action: a TRAP
Liberals Help KKK-type Groups Recruit
Reparations the GOOD Way
Myths re Slavery & Racism
Kneeling for the National Anthem
Civil War was about Slavery
The Confederacy OPPOSED States' Rights
They Were White and Slaves
What Do White Supremacists Believe?
White Nationalism's Crackpot Science
Nelson Mandela's HORRIBLE Decision
South Africa Today: Oppressive!
Nelson Mandela's IMMORAL Decision
**THE LEFT IS WRONG**
Leftism, Itself, Is a Huge Problem
Leftists Attacked White Commuters
Leftist Contempt for Us Illustrated
Why Have-Nots Don't Like the Left
Ordinary People Are the SOLUTION
What Does It Mean to Be Woke?
What Makes Capitalists Tick?
21st Century Divide-and-Rule
Rush Limbaugh & the Left
Rush Limbaugh NEEDS the Left
The Rulers Set Progressives Up to Fail
Left "Logic" Leads to Terrorism
**Men & Women**
**MORE TOPICS**
Why Life Is Harder Now Than in the 60s
FDR's New Deal: Won with Our Blood
LBJ: a Racist who Feared Revolution
How Unions Killed Working Class Mov't
Nuclear Energy & Fossil Fuels
Climate Change: Why Discuss It?
Global Warming/Climate Change
Footnotes to Global Warming article
Guns and the Working Class
Gun Control: One Opinion
Norway: Nonviolence or Class Struggle?
The Philosophy of Nonviolence?
Focusing Only on the Rich is a Mistake
How the Rich Set Progressives Up to Fail
Violent Repression
Population: What's the Global Future?
Social Issues: Used to Manipulate Us
Divide-and-Rule Lies & Manipulation
Abortion: the Phony Debate Framework
Mass Media: Its REAL Purpose
Free Will Is NOT an Illusion
Human Nature: the Capitalist Big Lie
Persuading People that Twice Two is Four
Surveillance: How to Respond to It
Bathroom Policy re Transgender
Corruption: How to Stop It
Market-Driven Health Care-Social Control
Covid-19 and School Openings
Kriminal Kapitalism Kills
Covid-19: Science & Values
A General Strike vs Gov. Spread of Covid
Big Farm$ Make Pandemic$
Some Problems with Vaccines
Is Covid-19 a False Flag?
Covid-19 & Ruling Class Domination
9/11: the Dog that Didn't Bark
Progressive Org's Run by Big $
Conception of Children: View #1
Links re Same-Sex Marriage
Sibling Marriage & the Law
Open Letter re Same-Sex Marriage
Supreme Court re Same-Sex Marriage
Universal Basic Income: a TRAP!
Modern Monetary Theory: Right & Wrong
Young Turks re Same-Sex Marriage
Cooperative Businesses: Not the Answer
Co-ops a Large Scale Solution? No.
Conspiracy Issues like Anti-Vaxx, etc.
Gallup Poll: Beware!
Prostitution & AIDS Scientists
Freedom of Speech: Bogus Idea
The Venus & Zeitgeist things
The "Obedience"/Shock Experiments
Nationalism: Good or Bad?
$15/hr Minimum Wage
Clinton/Trump Team
In Cahoots!
City Hall & Rich Developers
Renters vs. Owners, Etc.
US Towns Pass Illegal Anti-Corp. Laws
A Boring Detail re Egalitarianism
The 2020 Presidential Election
The Yellow Vests in France
Brexit Vote in the UK
Preventing Youths from Joining ISIS
JOBS, PHILANTHROPY & THE RICH
The Feigned Stupidity of Pro-Capitalists
We Debate Mr. Billionaire
Is Health Care a Right for Free Loaders?
Is Anything the Right of *ALL*?
A Parable: The Right to Health Care
A Parable about Job Creation
The Attack on Public Education
Great Songs!
The Green Party Is Wrong
Drag Queens at Childrens Story Hour? :(
Elitism: Some Tests of It
Boston Neighborhood Emails
Good Books, Films & Videos
Our Leaflets, Signs & Posters
Our Button & Sticker
Personal "buttoning" stories
Personal Stories (starting April, 2014)
Other Revolutionary Websites
"This I Believe" Signatures on View
Read & Download "This I Believe"
Who Has Signed "This I Believe"?
An Invitation to Your Organization
Signatures on Public Display
Photography & Egalitarianism
Music & Egalitarianism
Poetry & Egalitarianism
PDF ARTICLES pg. 1
Misc. URLs
Other People's Ideas--Not Mine!
WHY HAVE NO RICH AND NO POOR?
i.e. Why Have "From Each According to Ability, to Each According to Need" Equality?
[To see a video about this click here]
[To read about why it is not sufficient merely to reduce the gap between the richest and the poorest, or merely to return to being "a republic, not an empire." click here]
[To read why it is NOT true that some people DESERVE to be richer than others, click here]
[To read why we DON'T need the rich to create jobs, click here and click here to read "Jobs, Philanthropy & the Rich]
[To read HOW an economy can work with no rich and no poor, click here]
[A related article: "Can Co-operative Economic Enterprises Make Our Society a Good One on a Large Scale?"]
[In case you were wondering, "Some Rich People ARE Good"]
A society with some rich and some poor is a class society, one based on class inequality. It is a society with an upper class and a lower class. The very worst thing about a class society is that the upper class has to treat the lower class like dirt: see specific examples below. The upper class must do this in order to make lower class people "know their place," to make lower class people internalize the notion that they are an inferior lot that does not deserve to enjoy life the way upper class people do, and to accept their position at the bottom of an unequal society where they must unquestioningly do what they are told to do by their "betters"--the upper class folks.
To better understand why the upper class MUST treat ordinary people like dirt, do this. Read the many specific examples below (and also copied here) of how the rich treat us like dirt, and then imagine what would happen if the rich did NOT do these kinds of things. Imagine what would happen if the rich upper class treated ordinary people with the same respect and dignity as they treat their fellow upper class members. Imagine that Jeff Bezos and Bill Gates and those kind of people fully accepted and acted on the idea that ordinary people deserved to live in homes just as nice as theirs in neighborhoods just as nice as theirs, and have meals and vacations just as nice as theirs, and have health care and entertainment just as nice as theirs, and have their children attend schools just as nice as the ones their own children attend, and never be lied to by a mass media and never be induced to kill innocent people or be killed in foreign lands. Imagine such a world. How long do you think it would remain a world in which a tiny class of people, at the expense of all others, enjoys enormous wealth and power and privilege?
Today's oppression creates the chronic stress that causes sickness and shorter life as discussed here and here and here and here (it is chronic stress, as caused by one's job or poverty, that impairs immune response) and here and here. This oppression also causes additional serious illness and shorter life as discussed in detail here. Furthermore, Big Farm$ increase the risk of dangerous pandemics because it is more profitable to do so, as you can read about here.
If lower class people were treated with the full dignity and respect that upper class people take for granted as their due, then before long the upper class would be in serious trouble. Lower class people would begin to question--even more than they do already, which is a lot!--why society is so unequal with a privileged few lording it over everybody else.
The upper class knows very well that most working class people value equality and think the inequality of our society is morally wrong. The upper class knows that working class people, if left to themselves, would make a far more equal society. This is why the upper class dares not leave working class people to themselves. The upper class is forced to control the working class intensely. Treating the working class, especially the poorest working class people, like dirt is a strategy of social control that the upper class must use or risk revolution.
Click this photo to see more than 500 of my neighbors, all in my zip code, saying they want to remove the rich from power to have real, not fake, democracy with no rich and no poor. The upper class fears what these people would do if they are not treated like dirt.
The upper class knows that when people are not economically insecure (i.e., when there is no poverty and no fear of falling into poverty) people start feeling not like dirt but like people who can dare to stand up to the ruling upper class and fight to make society truly equal and egalitarian. This is what happened in the "radical 60s," when economic inequality was at a long time MINIMUM in the U.S. and unlike today many families could live well on the income of only one high school graduate; in France a revolution almost took place in May of 1968 when economic inequality was at a long time minimum and economic prosperity was very high compared to the hardships that had followed World War II. The ruling class was frightened to death in the "radical 60s"; it blamed the problem--a challenge to its authority in all walks of life--on "rising expectations." It deliberately arranged in subsequent decades to lower people's expectations. This is discussed in an article (click here) about the ways the ruling class did this, such as making health care profit-driven with HMOs.
Almost all of the problems that the upper class creates for working class people (many of which are discussed on the subpages of our "Specific Issues" page) are ways that the wealthy ruling upper class treats working class people like dirt. The upper class motive for this is not simply to maximize profits; it is to assert social domination over the working class.
When our rulers treat us like dirt, it is for the same reason that slave owners in previous centuries treated their slaves like dirt--to make them know their place. It is the same reason that the royalty and aristocracy treated peasants like dirt. The way that we're treated like dirt has changed over the years, but it's still a fact that we're treated like dirt, especially the poorest of us.
Treating working class people like dirt is what all of the following things, to select just some of many, have in common:
1. Paying low wages with minimal, if any, benefits and threatening to move jobs overseas if workers don't agree to even lower wages and reduced benefits. Read in detail how this affects many people in "Understanding the Dynamics of $2-a-Day Poverty in the United States," and scroll down to the section titled "Case Study: Monique" for a graphic description of the oppression these low wages cause.
2. Subjecting retail workers to "on call shifts" --"periods for which an employee must keep an open schedule but might not end up working. Instead of simply reporting for work, the employee has to check in with a supervisor a few hours in advance. If she gets called in, she may have to scramble for a babysitter. If she doesn’t get called in, she doesn’t get paid, and it’s too late to get a shift on a second job. 'People will be scheduled for eight on-call shifts in a pay period and only get called in for one shift,' says attorney Rachel Deutsch of the Center for Popular Democracy, a labor advocacy group." [Boston Globe, April 19, 2015]
3. Making people pay through the nose for health insurance, which may not even cover crucial health care needs when they are very sick or very old.
4. Telling our children in public schools that unless they score high on some absurd "high stakes" standardized test (that is designed so that children from poorer families get lower scores) they don't deserve to have a decent-paying job or perhaps any job at all. Read here about one big reason poor children get lower scores; it's because correct answers to test questions are marked wrong if they do not use virtually the same wording in the textbook that is linked to the test, and the poorest schools don't provide many (or sometimes any) of their students with these textbooks! These tests are a form of child abuse. Working class children in public elementary and high schools are required to take these tests, which are called "high stakes" tests because the child typically cannot be promoted or graduate from high school without passing the test. State governments tell parents that the tests are like the written test to get a driver's license in that if everybody has learned the material satisfactorily then everybody will pass. But in truth the authorities can and often do keep making the tests harder to pass in order to ensure that a large number of poor children will get a "fail" score no matter how well they have learned the material. Thus in Florida the Orlando Sentinel, in an article headlined, "Lawmakers push tougher scoring for high-stakes tests," reports:
"Florida’s key standardized tests, which already trip up more than 40 percent of those who take them, should be even tougher for students to pass in coming years, some House lawmakers say. Reviving a debate from last year, they want to require students to show 'proficiency' in order to pass Florida’s language arts and math exams, a move that could have far-reaching implications. The percentage of 10th graders who, on their first try, would pass the test needed to earn a diploma, for example, could fall from 51 percent to 36 percent, state data shows."
5. Having the police treat the poorest people like dirt. The police forces in the United States are essentially an occupation force acting to cow ordinary people into submission to the dictatorship of the rich. This may seem like an unjustifiably strong statement to individuals who have not experienced the police as a hostile force, as is the case for many upper middle class people. But for working class Americans, especially black and Hispanic and Native American working class Americans, this statement about the police is uncontroversial.
A retired Philadelphia police captain, Ray Lewis, described the police this way:
“I want to try and get a message to mainstream America that this system is corrupt, that police really are oppressing not only the black community, but also the whites,” he said. “It’s an oppressive organization now controlled by the one percent of corporate America. Corporate America is using police forces as their mercenaries.”
The New York Times, in order, no doubt, to give that newspaper some credibility, stated in an editorial Nov. 26, 2014, that:
"News accounts have strongly suggested, for example, that the police in St. Louis County’s many municipalities systematically target poor and minority citizens for street and traffic stops — partly to generate fines — which has the effect of both bankrupting and criminalizing whole communities. In this context, the police are justifiably seen as an alien, occupying force that is synonymous with state-sponsored abuse."
Read a whole lot more about this here.
6. Incarcerating people for things like smoking marijuana. More than two million people are behind bars in the U.S., and about half of federal prisoners were convicted of drug related (marijuana more than any other drug) but not violent crimes, and are subjected in many cases to utter brutality such as long solitary confinement.
7. Making decent paying jobs, or any jobs at all, artificially scarce (see how so here) so people who are more than willing to work cannot find work that enables them to support themselves and a family, thus forcing them to rely on welfare or unemployment compensation and suffer being wrongly looked down upon and accused of being a free-loader or worse.
8. Using a combination of lies (like "Saddam Hussein's Weapons of Mass Destruction" and "Saddam was behind 9-11") and the poverty draft ("If you want a job your only hope is to enlist") and the offer of citizenship to non-citizens if they first serve in the military, thereby manipulating young men and women to join the military where they are ordered to kill innocent people abroad and risk being killed themselves, resulting for many in post traumatic stress disorder, deep remorse and suicide.
9. Telling people who smoke (who are disproportionately working class) who live in publicly subsidized housing that they cannot smoke in their own home, and (in some towns) having the government give a grant (a bribe, really) to landlords who order their tenants to quit smoking in their home or be evicted. Working class smokers are being increasingly treated like dirt. Whatever the health argument is for banning smoking in some places (and by the way, there is no persuasive evidence that exposure to second hand smoke increases the risk of lung cancer, despite the fact that many people just assume it does), the fact is that wealthy people can stay in expensive hotels that have rooms where smoking is permitted, and they can smoke in their own expensive houses, but working class people are increasingly being denied the option of smoking at home and in this way they are being treated like dirt. The Affordable Care Act (Obamacare) treats smokers like dirt by allowing insurance plans to levy a surcharge of up to 50% on tobacco users' premiums, while not allowing such a surcharge on other "high risk" behaviors or conditions. (I was alerted to these facts by the Cambridge Citizens for Smokers’ Rights organization.) Click here for some more facts about smoking and lung cancer, etc.
10. Having hospitals treat working class people with far less respect and dignity than upper class people, as described in this Boston Globe article. Also read this ProPublica investigative article, titled, "Investors Extracted $400 Million From a Hospital Chain That Sometimes Couldn’t Pay for Medical Supplies or Gas for Ambulances Prospect Medical, which mostly serves low-income patients, has suffered a litany of problems: broken elevators, dirty surgical gear, bedbugs and more. Its owners, including Leonard Green & Partners and Prospect’s CEO, have cashed in."
11. Depriving people of good and affordable housing located near where they work. Making people live in tents instead of decent homes, by depriving them of jobs that pay enough to own or rent a decent home. See what's happening to homeless people in this video and this video and this video and this video. Here's a Boston Globe article that shows why even people with jobs cannot afford to rent an apartment.
12. Forcing ordinary people in a neighborhood to yield to the demands of Big Money real estate/property developers. These developers dramatically change neighborhoods for the worse to make a profit at the expense of ordinary people who are adversely affected by the new development. Typically, the city government (beholden to Big Money and not ordinary residents of the city) holds hearings to let residents blow off steam, and sometimes the developer will make trivial changes in the design of their project, but in the end the Big Money developers get what they want and ordinary people don't. Read examples of this here and here and here.
13. Gaslighting us with Big Money-controlled mass media. Instead of doing unbiased solid investigative journalism, these mass media tell us we're crazy--we're a nutty "conspiracy theorist"--if we have perfectly reasonable reasons (as a very large percentage of Americans do) for being skeptical of the official stories our rulers tell us about major events such as the JFK assassination and 9/11.
14. Forcing college students into debt slavery. College graduates today are in virtual debt slavery; they owe $1.5 Trillion (trillion, not billion!) in student loan debts. These debts are onerous. They are non-dischargeable in bankruptcy court (the government will garnish wages and intercept tax refunds.) They are unjust because a college education, like elementary and secondary education, should be paid for by society, not just the individuals in school.
These debts, which are impossible to pay back with only a modest income, force college graduates to work--or attempt to work--where they otherwise wouldn't choose to work, at the higher paying jobs devoted to making big profits for the rich, rather than lower paying jobs (often at non-profit enterprises) devoted to more noble goals. Those who choose, or more typically end up stuck in, the lower-paying jobs must put off marriage and having children, and must forget about ever being able to buy a house. Read about this here and here and here and here.
15. Poisoning poor people with toxic waste. Corporations (and government agencies) care more about saving a buck and lining their greedy pockets than they care about the health and lives of poor people. They view poor working class neighborhoods as a perfectly fine place to dump toxic waste and inflict related kinds of environmental hazards on people.
Read "How corporations dump their toxic sludge in areas filled with poor people: corporations still seek out the areas with the poorest people to dump their toxic waste" here.
Read "If you're a minority and poor you're more likely to live near a toxic waste site" here.
Read "Trump's EPA Concludes Environmental Racism Is Real: A new report from the Environmental Protection Agency finds that people of color are much more likely to live near polluters and breathe polluted air—even as the agency seeks to roll back regulations on pollution" here.
Read here how "the predominantly Black residents of Bayview-Hunters Point [a neighborhood of San Francisco, CA] had sensed the historically industrial area was different, as they faced poor health outcomes that can’t simply be explained away. Breast cancer rates there are twice the San Francisco average, and the life expectancy averages fully 14 years less than that of San Franciscans who live on Russian Hill." The probable cause? "[T]heir homes are on hazardous waste at a former shipyard that handled Navy ships exposed to radiation from nuclear bomb tests. "As far back as World War II, when the Navy used the drydock to clean ships exposed to atomic tests in the Pacific Ocean, Hunters Point became contaminated with radioactive cesium-137 and other hazardous materials: asbestos, glow-in-the-dark paint, lead, and pesticides." Who ended up living on this hazardous waste? Predominantly black people. Read more about this atrocity here.
Read "How tap water became toxic in Flint, Michigan" here.
Read "The Love Canal Tragedy: Quite simply, Love Canal is one of the most appalling environmental tragedies in American history. But that's not the most disturbing fact. What is worse is that it cannot be regarded as an isolated event. It could happen again--anywhere in this country--unless we move expeditiously to prevent it" here.
People who live in poor working class neighborhoods know all about this from personal experience. People who live in places like Beverly Hills don't, and it's not hard to understand why not.
16. Causing poor people to die 30 years earlier than wealthy people, as discussed in some detail in a Guardian article titled, "'It's totally unfair': Chicago, where the rich live 30 years longer than the poor."
17. Treating working class residents of nursing homes all too frequently like dirt. Here is a email sent to me by a friend in a nursing home who is suffering from ALS and who is being treated terribly there because--as he tells me--because he is poor and can't afford an expensive nursing home:
---------- Original Message ----------
From: Rafael *** <***rafael@gmail.com>
To: John Spritzler <
spritzler@comcast.net
Date: January 7, 2020 at 3:10 PM
Subject: “At the end of the day, this is after all a business.”
Said by the administrator of this facility at a staff meeting of nurses there to discuss with him the drastic problems they’re having with understaffing and reported to me by one of the nurses attending, whose only comment was that he was appalled by the remark.
A nurse here reported to me that the administrator of this facility said this at a meeting where the entire staff was present, and where the staff was bringing up the issue of gross understaffing:
18. Treating working class people like idiots and ignoramuses. Here's one typical example.
The owner of the Boston Globe, John Henry (net worth $1.1 billion) treated the people who deliver the Boston Globe newspaper like dirt, both physically and mentally. The Boston Globe newspaper recently switched to a new company to deliver its papers and the result was a catastrophe of Biblical proportions, forcing the owner of the Globe to publish an abject apology, (note that if you are a non-subscriber you can view three online Boston Globe articles per month for free) and forcing the paper to hire 100 people just to handle (barely) all of the phone calls of outraged subscribers who were not getting their paper delivered at all, never mind on time, and forcing the owner to ask Globe reporters and columnists to help deliver the paper (i.e., using their car to drive to unfamiliar neighborhoods throughout Massachusetts with stacks of papers to throw out the window.) It was weeks-long disaster. Thousands of subscribers were cancelling every day. What is the significance of this?
First, if you read this article you will see how the people who deliver the Globe are treated like dirt. It is really disgusting.
Second, if you read this article you will see that not only are the working class people who actually deliver the newspaper treated like dirt in the sense of being made to suffer, but they are also treated like dirt in the sense of being completely ignored regarding their knowledge of what the main problem was that caused the delivery catastrophe, even though these workers--and ONLY these workers--knew EXACTLY what the problem was--that the delivery routes they were given (by the new delivery company the Globe hired) were absurdly inefficient and stupid.
This entire debacle illustrates a fundamental fact about any society based on class inequality. The upper class must treat the lower class like dirt and in doing so it dares not respectfully ask working class people to participate as equals in figuring out how to get things done sensibly, and for that reason often does NOT get things done sensibly. One of the main reasons for abolishing class inequality is to abolish the treatment of ordinary people like dirt, which--and this is perhaps the worst thing about treating people like dirt--entails treating them like idiots and ignoramuses.
The main reason, therefore, for abolishing the class inequality of our society, for removing the rich from power to have no rich and no poor, is so that people will no longer be treated like dirt.
But wait. There's more!
19. Using people who are desperate for any kind of paid work to make those GODDAMNED PHONE CALLS all the FU**ing time, always when you're trying to do something else and when the last thing you need is a scam phone call interrupting you, a call asking you to give money to some bogus charity or--for the tenth time!--to buy an extended car warranty that you don't need or want, or telling you that you need to call such and such a number because your Social Security account is being investigated for fraud, or because you've just won $4,488,000 from Publishers Clearing House and you need to "call your agent" to get the money, and so on and on until it drives you out of your mind with anger and stress from being treated like dirt!
WHY NOT LET SOME PEOPLE BE JUST A LITTLE BIT WEALTHIER THAN OTHERS?
One of the reasons for making society egalitarian (i.e., based not on money but rather on the principle of "From each according to ability, to each according to need," which is to say "No Rich and No Poor") is that if a society is based on money (i.e., buying and selling) then the conditions exist for some people (because of luck or intention, as discussed here and here) to become a little bit wealthier than others. But with a little bit more wealth these people are a little bit more powerful. With a little bit more power (to influence politicians or other people) these people gain a little bit more wealth, which leads to more power, and so forth until eventually there is an upper class with far more wealth and power than other people, and this upper class will need to treat other people like dirt to keep them from making society more equal.
Here's an interesting article I came across: "Why Billionaires Need Society More than Society Needs Billionaires."
kPDR, 114 Strathmore Rd. #101 Boston, MA 02135 USA
PeopleforDemocraticRevolution@gmail.com
PDF file of the PDRBoston button/sticker
All content on this website is written by John Spritzler unless stated otherwise.
You are invited, and encouraged, to share any article on this website with others by providing them the article's URL on social media or otherwise. ,
|
cc/2021-04/en_middle_0021.json.gz/line2004
|
__label__wiki
| 0.671249
| 0.671249
|
Exploring beautiful England with pictures and history...
Pictures By Category
Member Favourite Pictures
Member Created Picture Tours
Add your Pictures
Picturesque Villages
Historic Market Towns
Members Favourite Towns
AONB
Beauty Spots
England Articles
Facts Explorer (soon)
England Poems
England Map
Sponsor a town: Coming soon Jan 2021
Find A Photographer - Add your business (Jan 2021)
Latest Pictures Added
All latest pictures
Latest favourites
Please login or click here to join.
Please help us stay online by donating today
England > Lancashire > Lytham St Anne's
Pictures of Lytham St Anne's
in the county of Lancashire
Take a picture tour of Lytham St Anne's...
About Lytham St Anne's
Set on the beautiful Fylde Coast, close to Blackpool the enchanting resort of Lytham St.Anne's has fortunately retained much of it's sedate Regency atmosphere and many of it's graceful old properties. It also benefits from a slower pace, than it's more lively neighbour.
St. Anne's has a fine sandy beach backed by grassy sand dunes and a fascinating pier, first built in 1885 and subsequently rebuilt and remodelled. The town is famous for its four fine golf courses as well as for being an enjoyable resort for the yachting fraternity. Surrounded by outstandingly beautiful countryside, this is a holiday town to enjoy and explore. It has fascinating reminders of an ancient seafaring past as well as nearby relics of Lancashire's cotton industry.
A few miles away from St.Anne's there is the legendry Forest of Bowland, and further along the coast lies the resort of Southport which has the second longest pier in Britain. If you feel in need of a little more exhilaration, in the Autumn you can take a trip to Blackpool to enjoy a spectacular tour of the world famous illuminations - a thrilling experience of over 500,000 lamps, lights and lasers, combining to create an unforgettable show.
In St.Anne's your holiday can be as peaceful or as hectic as you wish - it has something for everyone, it is truly a place from which you will take many happy memories.
Take a picture tour of Lytham St Anne's | Lytham St Anne's accommodation
Pictures Add Facts Map Upload
Add town to favourites
Looking for a Lytham St Anne's photographer? see local Lytham St Anne's photographer services
Other nearby recommended towns & villages..
Blackpool (282 Pictures)
a Seaside Town in the county of Lancashire
(5.1 miles, 8.1 km, direction N of Lytham St Anne's)
Blackpool, long famous for its vast illuminated Golden Mile, commenced its rise to fame way back in the Victorian Era when the famous seafront consisted of no more than a single row of houses...
Cleveleys (127 Pictures)
(8.8 miles, 14.1 km, direction N of Lytham St Anne's)
Less bustling than its busy neighbour Blackpool, Cleveleys lies on the same 15 mile stretch of beautiful golden sands...
Fleetwood (97 Pictures)
(11.4 miles, 18.3 km, direction N of Lytham St Anne's)
Fleetwood was once famous as a fishing port, but now it is more likely the visitor will see yachts and leisure boats lined up at the pretty quayside...
Rufford (6 Pictures)
(11.9 miles, 19.1 km, direction SE of Lytham St Anne's)
Noted for its picturesque late-medieval manor house Rufford Old Hall, the village of Rufford occupies a fine setting on the fertile Lancashire Plains...
Preston (68 Pictures)
(13.5 miles, 21.7 km, direction E of Lytham St Anne's)
This is the town that was at the centre of the cotton spinning industry for well over a hundred and fifty years. ..
All towns in Lancashire
Complete A to Z of towns in England
Nearby attractions..
Blackpool Zoo (10 Pictures)
(4.7 miles, 7.5 km, direction N)
Wildfowl & Wetlands Trust Martin Mere (52 Pictures)
(9.4 miles, 15.1 km, direction SE)
Rufford Old Hall (20 Pictures)
(11.8 miles, 19.0 km, direction SE)
Rufford Old Hall was presented to the National Trust in 1936 by Lord Hesketh. The Old Hall is a medieval manor house of splendid.....
Formby Reserve (2 Pictures)
(12.9 miles, 20.8 km, direction S)
A beautiful stretch of coastline offering a large expanse of beach, sand dunes and pine woods where you can glimpse the rare but.....
Harris Museum & Art Gallery, Preston (1 Pictures)
(13.1 miles, 21.2 km, direction E)
Preston Guildhall (1 Pictures)
Camelot Theme Park (4 Pictures)
Join Merlin, King Arthur and his brave knights of the Round Table at the Kingdom of Camelot and explore five magical lands filled.....
All attractions in Lytham St Anne's
All attractions in Lancashire
Complete A to Z of attractions in England
Please help us stay online by donating today - thank you
Explore England
England Counties
England Attractions
Picture Categories
England Facts
History of England
England Flags
© 2001-2021 Pictures of England.com - All rights reserved - Terms & Conditions - Privacy Policy
PestControl-Supermarket.com - Worldwide Pest Control Supermarket Price Comparisons
South Coast Campsites - Your best guide to camping and caravanning along the beautiful south coast of England
|
cc/2021-04/en_middle_0021.json.gz/line2008
|
__label__wiki
| 0.512456
| 0.512456
|
Taking care of business cross-border | PLANT
How OECD's new guidelines will impact base erosion and profit splitting.
December 13, 2013 by Angeline Zioulas and Joyce Cheung
organization for economic cooperation and development
print issue - Plant
New developments in transfer pricing and international tax planning have increased tax authorities’ scrutiny in Canada and foreign jurisdictions.
A significant volume of today’s global trade involves international transfers of goods and services, capital and intangibles within multinational enterprise (MNE) groups. But plans by the Organisation for Economic Cooperation and Development (OECD) to revise the attribution of profits to different countries will have a significant impact on transfer pricing, international tax planning and business restructuring on a cross-border basis for years to come.
Evidence shows such “intra-group” trade is growing steadily and accounts for more than 30% of all international transactions, according to United Nations Practical Manual on Transfer Pricing for Developing Countries. Given that the structure of transactions within an MNE group is determined by a combination of market and intra-group forces that can differ from the market conditions operating between independent entities, it’s important to establish the appropriate transfer price for intra-group, cross-border transactions.
Transfer prices serve to determine the income of both parties involved in a cross-border transaction and such internal pricing also forms the tax base for the countries involved. Base Erosion and Profit Shifting (BEPS) issues have resulted from the need for austerity measures by tax authorities in light of the global economic crisis and increased scrutiny by the public, non-governmental organizations and media.
One factor that poses significant challenges for the international tax regime is the digital economy. An initial report from the OECD explained that a holistic approach was necessary to properly address the BEPS issue. Key pressure areas include:
• Mismatches in entity and instrument characterization, typically referring to hybrid mismatch arrangements (transactions that take advantage of different tax treatments among jurisdictions) of financial instruments, entities or transfers. They generally arise in double deduction transactions, deduction/no inclusion transactions, or foreign tax credit generator transactions.
• Application of tax treaty concepts to profits derived from the delivery of digital goods and services.
• Tax treatment of related-party debt-financing, captive insurance, and other intra-group financing.
• Transfer pricing, particularly related to the shifting of risk and intangibles, and the artificial splitting of ownership of assets.
• The effectiveness of anti-avoidance measures such as General Anti-Avoidance Rules (GAAR), Controlled Foreign Corporation (CFC) regimes, thin capitalization rules, and rules to prevent tax treaty abuse.
• The availability of harmful preferential tax regimes.
A joint OECD-G20 project calls for greater disclosure of aggressive tax planning arrangements and treaty changes to neutralize hybrid mismatches. The OECD has proposed a plan to revise the basis for attribution of profits to different countries for businesses with high value intangible assets, and those with supply chains that deliver goods and services across multiple jurisdictions. Over the next two years, the project will attempt to produce 15 major international tax reforms, four of which address transfer pricing. Any of the following circumstances may trigger possible business impacts:
• High value intangible assets and transactions with overseas markets.
• Business in the digital economy.
• Distribution channels that include remote delivery of goods or services.
• Distribution structures that include local distributors with limited substance including commissionaires.
• Local headquarter executive teams with larger overseas operations.
Information exchanges between tax authorities around the world are increasing to a degree never seen before, creating new challenges relating to ensuring transparency and consistency across country lines. An important consideration of the OECD is the significance of a ‘big picture’ analysis of the corporate value chain and where profits are reported globally compared to where employees, assets or sales are located. This foreshadows the introduction of country-by-country reporting requirements to combat BEPS.
Although each country’s approach to documentation varies significantly, the number of those requiring preparation of transfer pricing documentation increases every year. The proliferation documentation requirements, combined with a dramatic increase in the volume and complexity of international intra-group trade and the heightened scrutiny of transfer pricing issues by tax authorities, makes transfer pricing documentation a top tax compliance priority for tax authorities and businesses.
When there are international tax disputes and cases of double taxation, bilateral tax conventions generally include a mutual agreement procedure (MAP) article as a form of dispute resolution mechanism. Residents in either country may formally request assistance from the “competent authority” to resolve a particular tax issue. The MAP reporting framework requires co-operation from taxpayers and regular communication between the tax administrations to resolve these cases.
According to OECD statistics released in September, member countries reported 4,061 open cases at the end of 2012 – the highest number in any year on record and a 5.8% increase over the 3,838 cases recorded for 2011. The average completion time for a MAP case last year was 23 months.
With increased enforcement by tax authorities, more companies are reviewing their transfer pricing plans. Effective planning and administration also reveals previously unknown information, including opportunities for driving value through transfer pricing, and where current weaknesses lie.
For supply chain and distribution businesses, transfer pricing moves cash between affiliates in different countries and minimizes cash taxes, maintains liquidity and manages cash more efficiently. Updating transfer pricing policies potentially increases profits and cash flow in desired locations.
Canadian manufacturers looking at or are currently managing an extended supply chain involving activities carried out in foreign jurisdictions need to understand more clearly the new developments in international tax planning and transfer pricing that are evolving to avoid putting the financial integrity of their cross-border activities at risk.
MNP is a chartered accountancy and business advisory firm with offices across Canada. Angeline Zioulas is a partner and national transfer pricing leader based in MNP’s Vancouver office. Joyce Cheung, is a senior associate, National Transfer Pricing Services.
Comments? E-mail jterrett@plant.ca.
This article appears in the Nov./Dec. 2013 issue of PLANT.
NB seeks leave to appeal ruling on cross border beer imports
From PLANT’s print edition: Where in the world…?
NB court ruling on cross border beer boosts Quebec sales
NB judge set to rule on cross-border beer case
CIEN: What’s new in lighting technologies
In favour of free trade | PLANT
|
cc/2021-04/en_middle_0021.json.gz/line2009
|
__label__wiki
| 0.956563
| 0.956563
|
Texans' Justin Reid playing well above expectation down the stretch of the 2018 season
By Evan McPhillips
• Houston Texans
Four safeties were taken in the 2018 NFL Draft before Justin Reid was selected by the Houston Texans with the 68th pick in the third round. Flash forward to Week 13, and Reid is coming off a 90.7 single-game grade and ranks seventh among all safeties in overall grade (80.3) on the year. The Stanford product has out-performed his draft position and on pace to finish as a top-10 safety in this league.
Reid’s strength this season has been his tackling, as he’s registered 50 tackles and only three misses all season long — good for an 87.4 tackling grade that is seventh-best at his position. His tackling efficiency of 18.3 is also the ninth-best mark among qualifying safeties this season.
In addition to his high-end tackling ability, Reid has truly made his mark for the Texans’ defense when dropping into coverage, where he has generated an 81.1 grade on the season. He has allowed an average of 0.62 yards per coverage snap and 27.9 coverage snaps per reception allowed, the latter of ranking inside the top-20 among safeties.
Limiting the big play has been a key component of Reid’s game, as well. He currently ranks fourth among safeties in forced incompletion percentage (36.4) on targets of 10-plus air yards this season. His 77.7 coverage grade on such plays also ranks second behind only Los Angeles Chargers rookie phenom Derwin James.
Quietly, Reid has tied James in interceptions (3) and pass breakups (5) on 23 fewer targets. Reid has also tied Landon Collins for the most combined interceptions and pass breakups among rookie safeties in the last five years and still has four games to play. Reid’s playmaking ability and athleticism were on full display in the play below, where he snagged an errant throw in the end-zone and promptly outran the entire Washington Redskins‘ offense for the touchdown.
Reid has been even more impressive over the second half of the season, playing not only like a top safety but also like a top defender.
In Weeks 7-13, Reid has been exceptional, earning an 89.4 overall grade and 89.9 coverage grade, both of which are the third-best mark among qualifying safeties. He has been flying around the field and making plays, producing two interceptions (tied fourth among safeties) and four pass breakups (third) in that span, showing a penchant for turning bad throws into big plays. He is playing with comfortability and aggression, and he has refused to quit on plays, leading to highlights like the one below. Cleveland Browns’ Antonio Calloway breaks loose against the Texans and looks to be running for the easy score, but Reid accelerates downfield contacting Calloway and forcing the fumble just before he crosses the goal line to save the touchdown.
His numbers across the second half of the season are even more impressive when looking at them compared to the rest of the rookie class, as his 89.4 overall grade in that span is the highest among rookie safeties and the second-highest among all rookie defenders. Not only that, but Reid’s overall grade in Weeks 7-13 ranks 18th among all defenders in the NFL.
Reid has been outplaying his third-round draft position and many of the safeties taken in front of him. His performance this season has not been that of a third-round pick, but of a first-round talent.
|
cc/2021-04/en_middle_0021.json.gz/line2016
|
__label__cc
| 0.742409
| 0.257591
|
PTA to Deploy Automated System to Monitor Telecoms’ QoS
Press ReleaseLast Updated: Dec 22, 2019
Pakistan Telecommunication Authority (PTA) has planned to procure automated quality of service (QoS) monitoring and benchmarking tool which would have also the support measuring audio and videos services, including live streaming as well as social media including emerging Over-The-Top (OTT) communication services testing.
According to the official documents, the automated system shall bear the specifications including the capacity to test and benchmark QoS across number of mobile operators (i.e. simultaneous and continuous measurement of at least five mobile networks), with the objective to reproduce end-user experience in different mobile networks, device types and wireless technologies (i.e. 2G/3G/4G etc.) operational in Pakistan.
The system will have data collection and data analysis (post-processing) modules and related services to benchmark voice, SMS and data QoS KPIs for at least five operators simultaneously and shall have the capability to expand to include more operators if required. It would have the capability to perform field tests, measure, benchmark and report QoS Key Advance Indicators (KPIs) as defined in mobile services licensees issued from time to time to Cellular Mobile Operators (CMOs) in Pakistan, as well as global industry standards and best practices.
The system will be required to measure all the QoS KPIs and should support all the technologies including but not limited to Global System for Mobile (GSM)/ Code Division Multiple Access (CDMA)/ Wideband Code Division Multiple Access (WCDMA)/High-Speed Download Packet Access (HSDPA)/High-Speed Upload Packet Access (HSUPA)/High-Speed Packet Access+ (HSPA+)/ Long Term Evolution (LTE)/ Voice over Long Term Evolution (VoLTE)/ Long Term Evolution Advanced (LTE-Advance) etc. (i.e. 2nd, 3rd & 4th generation wireless technologies) in all bands/spectrum, carrier aggregation in contiguous/non-contiguous bands/technologies and should be upgradeable to 5G, as and when required by the PTA.
The equipment would be able to determine and plot the route and map it with respect to its GPS coordinates. Plotting shall only show the relative movements with reference to a starting reference point. The equipment should be interfaced able with an off-the-shelf digitized map of the region, at any time in future with minimum hardware and software up-gradation. All instances have to be time and day stamped. The system should have a power measurement accuracies of up to ± ½ dB (min.). The system should have time-dependent measurements accuracies of one-second minimum. The specification shall explicitly indicate the minimum and maximum levels which can be measured by such an instrument. The system should have an extension for indoor / walk test service quality and coverage measurement.
The system would have the capability of being upgradable to consider upcoming mobile network technologies and related Advance parameters, such as VoLTE and 5G etc and active and optimized power control for phone charging. The installation of the QoS system should be in such a way that the set up provides optimal conditions for uninterrupted data collection in a stable environment for reliable test results.
The equipment should be capable of benchmarking multiple scenarios of Voice, SMS and Data services of at least five networks simultaneously and continuously. Moreover, it should have the capability to expand and include more operators, if required.
It should support both the Perceptual Evaluation of Speech Quality (PESQ) and Perceptual Objective Listening Quality Analysis (POLQA) voice/video quality Mean Opinion Score (MOS) for both narrow and wideband.
It should support Application based testing like, Facebook, Twitter, Snapchat, WhatsApp, Netflix etc and should provide flexibility to support multiple device types of multiple vendors including but not limited to smartphones, modems and mini cards etc.
It should be able to benchmark all possible testing scenarios in auto technology and locked mode. All the technologies 2G/3G/4G and all the bands can be locked also there should be flexibility to lock/unlock any desired technologies. Moreover, the tool should be able to lock and test specific Broadcast Control Channel (BCCH)/ Primary Scrambling Code (PSC)/ Physical Cell Identity (PCI)/ Absolute Radio Frequency Channel Number(ARFCN)/ Universal Mobile Telecommunication Service (UMTS) Absolute Radio Frequency Channel Number (UARFCN)/ Evolved Universal Terrestrial Radio Access (E-UTRA) Absolute Radio Frequency Channel Number (EARFCN) etc.
It should support a minimum 16 handsets for Voice, SMS and Data services simultaneously. It should have the capability to benchmark data services of all the operators simultaneously without any dependency on Laptop’s modem and without any degradation.
The equipment casing should be compact and capable of holding the mobile handsets securely in such a way that all mobile handsets are equally exposed to the outer environment for fair benchmarking. Most of the cabling should be fixed and reliable. The cabling that needs to be done by the end-user should be minimum and easy. The tool should be easy to carry around and can be used in any vehicle.
The system should have the ability to load Geo Maps, Google Maps, tab/shape and network files etc. Any parameter can be exported in multiple formats like CSV, txt, tab, KML/KMZ etc. both as image and point.
Following is the list of QoS KPIs/ parameters which has to be provided in addition to other RF related KPIs/parameters for voice, SMS and Data services for all technologies (2G/3G/4G) by both Data Collection and Post Processing Tool: NGMS Licensed QoS KPIs
(1) Network Downtime
(2) Grade of Service
(3) Service Accessibility
(4) Call Connection Time
(5) Call Completion Ratio
(6) Mean Opinion Score (Average of A2B and B2A, POLQA/PESQ)
(7) Inter System Handover
(8) SMS Success Rate
(9) SMS End-to-End Delivery Time
(10) Data Throughput (3G & 4G)
(11) Signal Strength (RSCP & RSRP)
(12) RAB/E-RAB Setup Success Rate
(13) Session Abnormal Release Rate,
Other QoS KPIs
(1). Drop Call Rate (DCR)
(2). Inter System Handover Success Rate (CS)
(3) Inter System Handover Success Rate (PS)
(4) Call Setup Success Rate (CSSR)
(5) 2G Signal Strength RxLev (No of samples in customizable Bins)
(6) 2G Signal Quality RxQual (No of samples in customizable Bins)
(7) 3G Signal Strength RSCP (No of samples in customizable Bins)
(8) 3G Signal Quality Ec/No (No of samples in customizable Bins)
(9) 4G Signal Strength RSRP (No of samples in customizable Bins)
(10) 4G Signal Quality RSRQ (No of samples in customizable Bins)
(11). Number of Call Attempts
(12) Number of Calls Established
(13) Number of Calls Dropped
(14) Number of Calls Blocked
(15) Number of Soft Handover Failures
(16) Number of Hard Handover Failures
(17) Number of Intra RAT Handover Failures
(18) Number of Inter RAT Handover Failure
(19) Number of Intra Frequency Handover Failures
(20) Number of Inter Frequency Handover Failures
(21) Number of Total Handover Attempts
(22) CSFB Call Setup Time/Call Connection Time
(23) End-to-End SMS Delivery time
(24) SMS e2e Delivery Success Rate
(25) SMS Send Success Rate
(26) SMS Receive Success Rate
(27) SMS Send time
(28) SMS attempts
(29) Number of SMS attempts
(30) Number of successful SMS
(31) RLC Data Throughput (DL/UL)
(32) MAC Throughput (DL/UL)
(33) Application Throughput (DL/UL)
(34) Modulation Scheme(DL/UL)
(35) User Data Throughput (DL/UL)
(36) CQI
(37). SINR
(38) Session Abnormal Release Rate
(39) RAB Setup Success Rate
(40) E-RAB Setup Success Rate
(41) Round Trip Time (Latency)
(42) Web Page Access Success Rate
(43) Web Page Completion Success Rate
(44) Web Page Download Time
(45) Packet Loss
(46) Jitter
(47). FTP Throughput (DL/UL)
(48) HTTP Throughput (DL/UL)
(49) Streaming Service Non-Accessibility
(50) Streaming Service Access Time
(51) Streaming Reproduction Cut-off Ratio
(52) Streaming Reproduction Start Failure Ratio
(53) Streaming Reproduction Start Delay
(54) Streaming Setup Success Rate
(55) Streaming Completion Success Rate
(56) Streaming Audio Quality
(57) Streaming Video Quality
(58) Streaming Audio/Video De-Synchronization
(59) VoLTE Setup Success Rate
(60) VoLTE Call Setup Time /Call Connection Time
(61) VoLTE Call Completion Success Rate
|
cc/2021-04/en_middle_0021.json.gz/line2018
|
__label__cc
| 0.682745
| 0.317255
|
Albert Road Recreation Ground
space hire
11 a side | Grass
Albert Road, New Southgate, Haringey, N22 7XL
Bounds Green
Monday to Sunday: 08:00 - Dusk
Albert Road Recreation Ground in North London, boasts a two amazing 11-a-side grass pitch. The staff at Albert Road Recreation Ground really care for and maintain this pitch to a high standard. This venue is also the perfect place for an 11-a-side league in North London as matches would be played on grass. So whether you're an experienced 11-a-side team or you're just getting into the game, this facility is definitely worth checking out.
Facilities here can be booked on a pay as you play basis. This means that you do not have to be a member to make a booking here. Just decide when or how often you want to play and it's as simple as that.
Looking to set up regular games at Albert Road Recreation Ground? Enquire about making a block booking to ensure you secure the time slot you want to play at every week. Block bookings are perfect for teams who want to be assured that they'll be playing regularly. A block booking is a booking made for a set number of consecutive weeks, on average this is 10 weeks.
There are smart and spacious changing rooms available for customers, with well-maintained facilities. This means customers can come straight from work or head out straight after.
The venue is situated near Bounds Green station. From there it is a short walk to the facility which works out well for a gentle warm down after your booking.
If you’re driving then it is worth noting that there are...
Football Pitches
Albert Road
N22 7XL
Arnos Park
Waterfall Road, New Southgate, N11 1AP
Arnos Grove
Muswell Hill Playing Fields
Coppetts Road, Muswell Hill, N10 1JP
Bus Stop Osier Crescent
Brunswick Park, Barnet
Brunswick Park Road, New Southgate, N11 1JJ
New Southgate Recreation Ground
New Southgate Recreation Ground, Brunswick Park Road, Southgate, N11 1LB
Powerleague Finchley
Summers Lane, Barnet, N12 0RF
Bus - Sunny Way
|
cc/2021-04/en_middle_0021.json.gz/line2020
|
__label__wiki
| 0.667257
| 0.667257
|
Jobs network
Kativik Regional Government (KRG) jobs
share-facebook share-print
Registered Office: Kuujjuaq, Quebec
Business type: Regional Administration
Activity sector: services
The Kativik Regional Government (KRG) covers the Kativik region, which covers an area of ??500,164 km2 in Northern Quebec and has 11,000 residents in 14 communities. The KRG's services, funded by the Government of Quebec (50%) and the Government of Canada (25%), cover a wide variety of services such as airport management and marine infrastructure maintenance. Local and regional economic, police services, employment, training, child care, sports and recreation.
The Kativik Regional Government employs 400 people across ten departments (eg, administrative, financial, legal, public safety, recreation). Regardless of the Kativik Regional Police Force (KRPF), KRG employees are close to 65% Inuit and women represent more than 44% of the workforce. More than 50% of them work in communities other than Kuujjuaq.
In keeping with the principle of employment equity - which the KRG adheres to - and the James Bay and Northern Quebec Agreement, priority can be given to the hiring of Inuit candidates. Some benefits are granted, such as living expenses (minimum $ 8,500 per year), a food allowance (minimum $ 3,453 per year) or three annual trips.
The KRG develops social initiatives by funding community and economic projects, through a job creation fund for northern villages. Here are some examples of initiatives supported by the KRG: financing infrastructure projects, setting up a project for local cultural committees or building youth centers.
Contact us P.O. Box 9 Kuujjuaq, QC J0M 1C0
Industry Public administration
View this employer’s website
View this employer’s Career section
Jobs available at Kativik Regional Government (KRG)
January 17 2021 Special Advisor - Telecommunication
The Kativik Regional Government (KRG), a supra municipal body with jurisdiction over the territory located north of the 55th parallel, is now looking for a self-motivated and dynamic individual interested in joining the KRG to work in the capacity
Kativik Regional Government (KRG) Kuujjuaq, QC accountingjobs
Kuujjuaq, QC
SaveRemove Share share
Share share-facebook share-twitter share-linkedin share-google share-email Close
January 16 2021 Project Manager - Water Infrastructure
The Kativik Regional Government (KRG), a supra municipal body with jurisdiction over the territory located north of the 55th parallel, is now looking for a self-motivated and dynamic individual interested in joining the KRG to work in the capacity of:
January 16 2021 Project Manager - Infrastructure
About PMjobs.ca
Browse by Employer
Education, Training
Environmental, Energy
Consulting, Business analyst
Accounting, Finance, Banking, Economics
Community, Social Services, Nonprofit
Proudly made and taxed
in Montreal, Qc, Canada
© 2021 jobWings Careers. All rights reserved.
Jobs.ca network
Hrjob
Callcentrejob
accountingjobs
Healthcarejobs
Temporaryjobs
Summerjobs
LogoWinterjobs_CMYK
Winter Jobs
|
cc/2021-04/en_middle_0021.json.gz/line2022
|
__label__wiki
| 0.971216
| 0.971216
|
Back-of-the-pack Dutch under fire for slow coronavirus vaccine rollout
No one has yet been vaccinated in the Netherlands.
Dutch Prime Minister Mark Rutte has admitted to frustration with the pace of vaccinations in the Netherlands | Robin Utrecht/AFP via Getty Images
The Dutch government's vaccine strategy has been flawed, Prime Minister Mark Rutte said Tuesday as he admitted watching on with frustration as other countries' citizens were given a jab against the coronavirus.
“Because the government's approach was not agile enough, vaccination will start later than in other European countries,” Rutte said during a debate in parliament.
The Netherlands will only vaccinate its first citizen, a care home nurse, on Wednesday — making it one of the last countries in the EU to begin giving coronavirus vaccines.
Rutte said the Netherlands had assumed the Oxford/AstraZeneca vaccine, which does not require storage at extremely low temperatures, would be the first to get EU approval and that the vaccination program could have been rolled out via family doctors.
However, the BioNTech/Pfizer vaccine was the first to be approved by the European Medicines Agency (EMA), on December 21, and it is more difficult to use in small-scale vaccination centres because it must be stored in dry ice. It can be stored in a normal refrigerator for just five days.
Rutte added that the Dutch rollout campaign was further complicated because approval of the vaccine happened sooner than planned.
“Looking back, it would have been better if I had asked the GGD [Dutch health authority] myself to start earlier with setting up large, central vaccination points,” Rutte said. “We weren’t able to get the GGD spots up and running fast enough.”
Lawmakers lamented the slow rollout, slamming it as “chaotic” and “confusing.”
Far-right politician Geert Wilders, the leader of the biggest opposition party, called on Health Minister Hugo de Jonge to resign. “You are not the right man in the right spot,” he said.
“We lost valuable weeks, and that is unacceptable,” said GreenLeft leader Jesse Klaver. He asked Rutte to appoint a special minister for testing policy to ensure de Jonge could focus on other parts of his job — a suggestion the prime minister later rejected.
The European Commission has warned countries since October that they should prepare for different rollout scenarios in terms of storage and infrastructure.
However, the Dutch lagged behind in planning. One of the main delays was the upgrading of an IT system to allow the GGD to track appointments as well as which vaccine was used on different patients. The GGD also needed to establish at least one mass vaccination point in each of its 25 regions.
De Jonge said Monday that it may have been possible to start vaccinating people “a few days earlier” if he had asked the GGD to begin scaling up preparations at an earlier date.
The minister said he hoped that the vaccination program would be completed by the third quarter of 2021, although much depends on deliveries, he said. “That determines the speed at which you can vaccinate, in both the Netherlands and the rest of Europe,” he said in a letter to parliament on Monday.
The number of positive tests and hospitalizations in the Netherlands is still high, despite a hard lockdown that started on December 15. The public health agency RIVM said on Tuesday that 56,440 people tested positive for COVID-19 in the past week.
At the moment only the BioNTech/Pfizer vaccine has been approved for use in the EU. The EMA may issue its ruling on a vaccine candidate from Moderna on Wednesday, and is expected to receive more information from a rolling review of the Oxford/AstraZeneca candidate this month.
Jillian Deutsch contributed reporting.
More from ... Eline Schaart
3 EU commissioners self-isolate after meeting Portuguese minister
By Maïa de La Baume
Europe walks a tightrope as it waits for virus immunity to take hold
By Carlo Martuscelli
Coronavirus Doctors Dutch politics Infectious diseases Patients Public health Vaccines
Geert Wilders Jesse Klaver Mark Rutte
European Commission European Medicines Agency (EMA)
|
cc/2021-04/en_middle_0021.json.gz/line2023
|
__label__wiki
| 0.746147
| 0.746147
|
'Force Majeure' Is Gender-Biased Junk
Bill Gibron
That's some view... of modern marriage.
Director: Ruben Östlund
Cast: Johannes Kuhnke, Lisa Loven Kongsli, Clara Wettergren, Vincent Wettergren, Kristofer Hivju, Fanni Metelius
Rated: Unrated
Studio: Magnolia Pictures
US release date: 2014-10-24
So... a man runs away from an impending avalanche, leaving his wife and two young children behind.
That's it. That's the basis for this talky, incomprehensibly narrow minded "view of modern marriage" being touted as some brilliantly enlightened masterpiece. Indeed, Force Majeure (Latin for "superior force", though typically translated as "unavoidable accident") is making the arthouse rounds in preparation for an end of the year run at the Best Foreign Language Film Oscar next February and what an over-praised pile of yellow snow it is.
The main thesis here is that someone, acting out of self-preservation and fear, needs to be reprimanded and made to feel guilty for doing so. Really guilty. End of their rope guilty. That not standing by his wife and kids as a potential threat arrives turns an otherwise caring husband into a partnership question mark. Perhaps those without experience in relationships can coo and caw over such an idea, but for anyone whose suffered through far more trivial tirades with their significant other, it's all cinematic bullshit.
Force Majeure is a one-off conversation between couples amplified into a near two hour anti-male screed. It makes men out to be selfish pigs while women are grounded goddesses doing what's right for the biological clan (or themselves, as one affair-bragging wife and mother suggests). Add a oversized dude in a dress and you'd have the makings of a Tyler Perry movie. In the us vs. them dynamic established, our females are all fine with their self-aggrandizement. The guys, on the other hand, have to feel shame for simply being human.
Take, for example, a side story featuring family friend Mats (Kristofer HIvju) and his new 20 year old concubine Fanni (Fanni Metelius). Naturally, she is on the side of Ebba (Lisa Loven Kongsli) who believes her husband Tomas' (Johannes Kuhnke) cowardice demands addressing, and while engaging in a bit of pillow talk, she scolds her older lover for "not taking care" of his own kids. Mats explains he has an ex-wife, she has custody, and that he spends as much time with his former family as he can. Her response? So why didn't he bring them to the mountains for this skiing weekend? The obvious answer can be seen as the couple quasi-canoodle, half dressed, in their resort bed.
But it goes further than this. Tomas is dismissed as a breadwinner, always "too concerned" about work and his cellphone to spend time with his grade school age kids. There's hints of past problems, since the children are concerned that their parents "will divorce", but it's all innuendo. It's all "let's blame Dad for taking on the role society demands that he take" while simultaneously condemning him for instinctually reacting to a nature disaster playing out before his eyes. Sure, the end result is that everyone was/is safe (-- the avalanche is "controlled" by the ski lodge, all the tourists there have to suffer through is a mist-like snow cloud -- but who would know that at the time?
So why celebrate the mother for taking her kids and hiding under the table? Why paint father as a fiend for not doing so? Certainly, Force Majeure wants to have the discussion, to argue dedication to self ends when you biologically bring other lives into this world. And yet, this conversation really isn't about protecting the kids. It's about Ebba's ongoing emasculation of her man. She realizes he took off because of fear, pats herself on the back for not doing so, and even quasi-understands his reaction.
And yet for the next hour, all she does is hound and harass him, making sure he "gets" how "wrong" he was. It's the cold shoulder. It's the silent treatment. it's even the movie going meta, offering a scene where Tomas is told by a drunken snow bunny that he's handsome, only to horribly humiliate him moments later by saying she was mistaken. It all ends in a pitiful crying jag, Tomas is so broken by Ebba's endless taunts that he dissolves into a pool of self-pity. While the kids try to comfort him, Ebba sits back, aghast at what she accomplished (and yet secretly satisfied, one imagines).
The only problem is, she's just as selfish. During the finalé, a logistically challenged bus driver threatens everyone on board their shuttle to the airport, mostly due to his inability to navigate his massive motor along the winding mountain roads. Just when it looks like he will drive the vehicle off one of the many embankments, Ebba freaks out. She immediately gets off the bus -- without her kids -- and flees, refusing to step foot back on the transport. She even convinces most of the passengers (including her husband, Mats, and Fanni) to follow her. Feeling a small sense of retribution, Tomas smokes a cigarette in defiance. Wow. Point made. Two hours lost.
The chilly French Alps setting provides a bit of subtext, but director Ruben Östlund (who got his start making skiing films) can't translate pretty pictures into actual ideas. We're just constantly reminded that this part of Europe is beautiful, and that technology has taken most of the guess work out of keeping visitors safe from avalanches.
But we are supposed to be stunned -- and humored, as this is pitched as a "black comedy" -- by what happens over this five day holiday. We are supposed to side with Ebba, condemn Tomas, and then giggle with recognition when she herself gets a comeuppance. It's an idea with a lot of potential, none of which this movie explores.
Instead, Force Majeure allows a gender-bias to take over, turning everything into an episode of The View. Winning the Jury Prize at Cannes means very little when your efforts don't translate into actual entertainment. Force Majeure make have spoken to those voting for various awards, but as a statement about marriage, parenthood, and responsibility, it's artificial and superficial.
Force Majeure Official Trailer (2014) HD - YouTube ›
Force Majeure (2014) - Rotten Tomatoes ›
Force Majeure (2014) - IMDb ›
Force Majeure - Official Trailer - YouTube ›
Force Majeure (film) - Wikipedia ›
turist ruben östlund comedy drama film review short cuts short ends and leader force majeure
|
cc/2021-04/en_middle_0021.json.gz/line2027
|
__label__wiki
| 0.993991
| 0.993991
|
Port Macquarie News' trusted source for property
NewsLatest News
news, latest-news, tyrell, william-tyrrell, kendall, tyrrell-missing, coronial-inquest-tyrrell
Two former friends have told conflicting stories to the William Tyrrell inquest about whether a driver was seen pushing something down into a car footwell the day the three-year-old went missing. William vanished while playing at his foster grandmother's home in Kendall on September 12, 2014. Kendall man Tim Palmer told the coronial inquest into the child's suspected death on Wednesday he had a conversation with friend Michael McInally in 2018 in which Mr McInally said he needed to get something off his chest. He said on the day William Tyrrell went missing he saw a white sedan driving "crazily" down Batar Creek Road and the driver using his left hand to push something into the passenger side footwell, Mr Palmer said. "He said if I was to tell anyone this story, he would deny it," Mr Palmer told the NSW Coroner's Court. Mr McInally then addressed the inquest and disputed several elements of Mr Palmer's story. He said in fact, he had been driving down Comboyne Street when he saw a person holding their left hand up as if to get better phone reception. Asked by the coroner why he would tell a story in 2018 about how he saw someone in 2014 trying to get phone reception, Mr McInally said: "I don't know". "I was in a drunken state," he said. "I don't remember half of the conversation." But Mr Palmer's version was wrong, he said. Mr McInally said he remembered the car as he had never seen it in the area before. Mr Palmer said he believed his decision to tell police about the 2018 conversation led to the long-time friends falling out. The inquest resumes on Thursday, August 15, in a closed court. Earlier this week, Deputy State Coroner Harriet Grahame ruled to close the court in the interest of justice for some witnesses to give evidence behind closed doors. A handful of the 54 people on a draft witnesses list have been assigned pseudonyms and granted permission to give evidence before just the coroner, lawyers and court staff. Public scrutiny of the court and its processes was an important factor in delivering justice, Ms Grahame said, but publication had the potential to frustrate its operation. "It may seem unusual (to close the court) ... but it is a regular process," Ms Grahame said. "Not on a daily basis but it happens from time to time. Closing the court is a difficult step but it is sometimes necessary." Read more: William's foster and biological families give evidence A further 45 witnesses will be called in the next three weeks, including persons of interest who will appear before the Coroner when the inquest travels to Taree Courthouse from Monday, August 19. So far, witnesses have included William's biological and foster families and emergency services personnel on the ground the day the toddler disappeared. Counsel assisting the coroner Gerard Craddock said last week the absence of eyewitnesses and forensic evidence makes the investigation into William's suspected abduction among the hardest cases in the world to solve. He reinforced that people called to give evidence will simply help put the pieces of the puzzle together and are not on trial. All of the evidence collected by Strike Force Rosann is being presented before the Coroner who will determine if the three-year-old was abducted by someone. There is evidence yet to conclude that William is dead.
/images/transform/v1/crop/frm/ppNWdZhTTkjhqMUVsrRSd4/9be6a201-8552-4661-a45f-9bcdcd5381bf.jpg/r0_279_2025_1423_w1200_h678_fmax.jpg
William Tyrrell inquest: Conflicting stories about car driving "crazily" on day Tyrrell disappeared
Luke Costin
Inquest continues: William Tyrrell was three-years-old when he went missing.
Two former friends have told conflicting stories to the William Tyrrell inquest about whether a driver was seen pushing something down into a car footwell the day the three-year-old went missing.
William vanished while playing at his foster grandmother's home in Kendall on September 12, 2014.
Kendall man Tim Palmer told the coronial inquest into the child's suspected death on Wednesday he had a conversation with friend Michael McInally in 2018 in which Mr McInally said he needed to get something off his chest.
He said if I was to tell anyone this story, he would deny it.
Tim Palmer
He said on the day William Tyrrell went missing he saw a white sedan driving "crazily" down Batar Creek Road and the driver using his left hand to push something into the passenger side footwell, Mr Palmer said.
"He said if I was to tell anyone this story, he would deny it," Mr Palmer told the NSW Coroner's Court.
Mr McInally then addressed the inquest and disputed several elements of Mr Palmer's story.
He said in fact, he had been driving down Comboyne Street when he saw a person holding their left hand up as if to get better phone reception.
I was in a drunken state. I don't remember half of the conversation.
Michael McInally
Asked by the coroner why he would tell a story in 2018 about how he saw someone in 2014 trying to get phone reception, Mr McInally said: "I don't know".
"I was in a drunken state," he said. "I don't remember half of the conversation."
But Mr Palmer's version was wrong, he said.
Mr McInally said he remembered the car as he had never seen it in the area before.
Mr Palmer said he believed his decision to tell police about the 2018 conversation led to the long-time friends falling out.
The inquest resumes on Thursday, August 15, in a closed court.
The search of the area around Benaroon Drive in the days after William disappeared.
Earlier this week, Deputy State Coroner Harriet Grahame ruled to close the court in the interest of justice for some witnesses to give evidence behind closed doors.
A handful of the 54 people on a draft witnesses list have been assigned pseudonyms and granted permission to give evidence before just the coroner, lawyers and court staff.
Public scrutiny of the court and its processes was an important factor in delivering justice, Ms Grahame said, but publication had the potential to frustrate its operation.
"It may seem unusual (to close the court) ... but it is a regular process," Ms Grahame said.
"Not on a daily basis but it happens from time to time. Closing the court is a difficult step but it is sometimes necessary."
Read more: William's foster and biological families give evidence
A further 45 witnesses will be called in the next three weeks, including persons of interest who will appear before the Coroner when the inquest travels to Taree Courthouse from Monday, August 19.
So far, witnesses have included William's biological and foster families and emergency services personnel on the ground the day the toddler disappeared.
Counsel assisting the coroner Gerard Craddock said last week the absence of eyewitnesses and forensic evidence makes the investigation into William's suspected abduction among the hardest cases in the world to solve.
He reinforced that people called to give evidence will simply help put the pieces of the puzzle together and are not on trial.
All of the evidence collected by Strike Force Rosann is being presented before the Coroner who will determine if the three-year-old was abducted by someone. There is evidence yet to conclude that William is dead.
What else is making news?
Laurieton put on the world map after Hollywood crash landing
Big dry persists and there's no end in sight
Is complacency creeping in as region eyes nine months COVID-free?
Top town girl and jetty boy still shine on 60th wedding anniversary
Man escapes serious injury after skydiving accident
Lifeline Mid Coast seeks more people to "answer the call"
Port Macquarie News
|
cc/2021-04/en_middle_0021.json.gz/line2030
|
__label__wiki
| 0.906747
| 0.906747
|
By Frank Lewis - flewis@civitasmedia.com
Members of James Dickey Post 23 of the American Legion fire a 21 gun salute at the Memorial Day service held Monday in New Boston.
With New Boston Mayor Junior Williams out of town, New Boston Village Administrator Steve Hamilton, with the approval of Williams, took the opportunity Monday to hold a Memorial Day service. Hamilton chose Monday because New Boston schools were scheduled for final exams Tuesday and Wednesday.
“I wanted to get the school involved to do something with the kids from the school, have some veterans, and maybe some people there that have had children in the armed forces,” Hamilton said. “It was a thing I put together with the school because I knew the mayor wasn’t going to be there. I invited all the (Village) Council members.”
Hamilton told those in attendance about his great uncle, Jesse Anderson, who is still missing in action while serving in the Chosin Reservoir in the Korean War.
“December 6, 1950 is when he went missing in action,” Hamilton said. “My grandmother died, but she always thought he’d come walking through the door one day, but they never sent back any military tags. They never sent back anything.”
Hamilton said, when he was speaking, “you could hear a pin drop.”
“They really listened and they really took it in and they thanked me,” Hamilton said. “I thank the teachers for allowing the kids to come down.”
Hamilton had a direct message for the students in attendance.
“I told the young women and men, if you want to go in the military, that’s fine, but set your goals now and try not to get off that path,” Hamilton said.
James Dickey Post 23 of the American Legion performed a 21 gun salute as a part of the event.
“We wanted to do the observance before school was out so the students could see it and more importantly be a part of it,” New Boston Village Councilman Mike Payton said. “The Glenwood New Boston Band played and the chorus sang. We feel this not only serves as a memorial to our veterans but also allows our community to promote good morals and values to our young people. We are very grateful to the school district for participating.”
http://portsmouth-dailytimes.aimmedianetwork.com/wp-content/uploads/sites/28/2017/05/web1_NBMEMORIAL1.jpgMembers of James Dickey Post 23 of the American Legion fire a 21 gun salute at the Memorial Day service held Monday in New Boston.
http://portsmouth-dailytimes.aimmedianetwork.com/wp-content/uploads/sites/28/2017/05/web1_NBMEMORIAL2.jpg
By Frank Lewis
flewis@civitasmedia.com
Reach Frank Lewis at 740-353-3101, ext 1928 or on Twitter @flewisPDT.
Hi! A visitor to our site felt the following article might be of interest to you: . Here is a link to that story: http://www.portsmouth-dailytimes.com/news/16201/16201
|
cc/2021-04/en_middle_0021.json.gz/line2031
|
__label__wiki
| 0.890111
| 0.890111
|
Home » Gore Pedals Releases the Cult Germanium Overdrive, Filth Fuzz, and Gross Distortion
more... Gear • New Gear • Gore Pedals • Effects • Distortion • Fuzz • Overdrive
Gore Pedals Releases the Cult Germanium Overdrive, Filth Fuzz, and Gross Distortion
San Francisco, CA (July 5, 2016) -- Gore Pedals announces the release of three new distortion effects for guitar: Cult Germanium Overdrive, Filth Fuzz, and Gross Distortion.
Gore’s pedals share a common theme: extreme dynamic sensitivity. They are designed to telegraph every nuance and variation of the player’s touch.
“After writing reviews of hundreds of stompboxes over the years, there were always a few pedals that I wished existed,” says Gore. “So I built them.”
Gore views the Cult Germanium Overdrive as a mutant grandchild of the germanium boosters of the 1960s. According to early adopter Richard Fortus (Guns N’ Roses, Crystal Method, Pink, Dead Daisies), “This is the first overdrive I’ve heard in a long while that has its own voice. It pushes your amp in the perfect way. It’s more expressive than anything else I’ve encountered. It’s instantly become an essential part of my tone.” Guitar Player magazine called it “the most dynamic overdrive we’ve heard.” The MSRP is $199.
Filth Fuzz was created to deliver a vast array of fuzz colors via a simple interface. “Filth is amazing,” says guitarist David Torn (David Bowie, John Legend, Jeff Beck, Madonna, and solo artist). “I love it. So many, many sounds. I dig the way they feel, and how changeable that feel is.” Producer Joe Barresi (Queens of the Stone Age, Slipknot, Soundgarden, Bad Religion) is more succinct: “Filth is pretty f’in great.” The MSRP is $269.
Gross Distortion began as a self-imposed design challenge: How many distortion colors could coexist in a single stompbox? “My goal was 144 tonal variations—that’s why it’s called ‘Gross,’” says Gore. “I managed to get 158 tones via a network of switchable clipping diodes. I find it indispensible for studio work, especially for overdubs and doubling.” The MSRP is $279.
All models are now shipping. Joe Gore pedals are available in the U.S. through Vintage King Audio, and outside of the U.S. through M1 Distribution’s network of dealers.
Gore Pedals
Watch a clip from NAMM '16 that shows some of these stomps in action:
NAMM '16 - Joe Gore Pedals Filth, Duh Remedial Fuzz, Cult & Boring Demos
Joe Gore Gross Review
NAMM '18 - Joe Gore Pedals Purr Vibrato, Cult, Screech Octave Fuzz, and Porkolator Demos
Source Audio Releases the L.A. Lady Overdrive, Kingmaker Fuzz, and Aftershock Bass Distortion
Fender Releases the Engager Boost, Pelt Fuzz, and Full Moon Distortion Pedals
|
cc/2021-04/en_middle_0021.json.gz/line2032
|
__label__wiki
| 0.93396
| 0.93396
|
Masego Releases “Mystery Lady” ft. Don Toliver
Studying Abroad EP Out Friday Via EQT Recordings And Capitol Records
LIVESTREAM SHOW CONFIRMED FOR NOVEMBER 17TH AT 12 PM PT & 3 PM ET
Today, Masego releases “Mystery Lady” ft. Don Toliver. The track is the final single off his upcoming EP, Studying Abroad, out this Friday, November 13th via EQT Recordings and Capitol Records. Crisp and flirty, “Mystery Lady” is a joyride through love-filled dreams featuring Masego’s breathy croons and Toliver’s slick wordplay.
Listen to “Mystery Lady” here: https://Masego.lnk.to/MysteryLadyPR
Studying Abroad is a concept experience that lyrically chronicles a relationship from sultry start to its explosive finish. The highly-anticipated six-track collection shows Masego evolving in real-time, an expansion both in terms of production choice and collaborative partners. Sonically, it explores uncharted territory by sampling from an international palette of sounds and styles. Featuring an eclectic group of producers like D’Mile (Usher), Jack Dine (Stormzy), Jonah Christian (Nicki Minaj), IzyBeats (Mala Rodríguez) and Kojo Asamoah (Ari Lennox), who have their own unique sounds and influences, Studying Abroad shows a new and reflective side of the "musical polyglot" (LA Times).
Pre-save Studying Abroad here: https://Masego.lnk.to/presavePR
To celebrate the release, Masego has announced a special live stream set where he will perform songs off Studying Abroad for the first time. Tune in on Tuesday, November 17th at 12 pm PT / 3 pm ET via YouTube.
Previously released singles “Passport” (Vice Music’s “Best Songs to Usher In Fall”) and “Silver Tongue Devil” (ft. Shenseea) will appear on the adventurous new EP. The tracks together have already accumulated over 6.5M global streams combined across platforms.
Learn more about Masego through GQ’s 10 Essentials: https://www.gq.com/video/watch/10-essentials-10-things-masego-cant-live-without
Studying Abroad is the official follow up to Lady Lady, Masego’s 2018 debut that firmly put the singer/producer/multi-instrumentalist on the map – or, all over the map, to be precise: In the almost two years since its release, Masego has toured the world, headlining sold-out tours and starring on festival stages across every continent but Antarctica. The album was no less of a success with listeners: "Tadow," the lead single, has surpassed half a billion streams and been certified gold by the RIAA; that same song has been used in over two million videos creates on TikTok; and the project cemented him as a name to watch in the burgeoning generation of like-minded Black musicians, with features and collaborations across marquee projects from the likes of Kehlani, Dreamville, KAYTRANADA and more.
PRAISE FOR MASEGO:
“musical shapeshifter, the creator of a blueprint for a new kind of sound" — NPR Music
"Sophisticated" — Pitchfork
"smooth and lavish energy that's become his musical signature" — Vogue
"a musical polymath who’s equally funny, flirtatious, and sensitive" — FADER
“truly pushing boundaries" — Highsnobiety
masego.lnk.to/MysteryLadyPR
November 11, 2020 5:45pm ET by Shore Fire Media
Shortlink to this content: https://bit.ly/2UdXvwH
|
cc/2021-04/en_middle_0021.json.gz/line2033
|
__label__cc
| 0.509932
| 0.490068
|
Man and Sin by Piet Schoonenberg (1964) 2.3 I
Man and Sin by Piet Schoonenberg (1964) 2.3 H-2
[The single actuality that encompasses valves and boilers emerges from and situates two potentials that seem to have nothing to do with either boilers or valves.
The single actuality underlies the two normal contexts that describe the normal functioning steam engine.
It also belongs to a context that seems to have nothing to do with the mechanics of an engine. The normal context for the single actuality is the running of the engine.
That normal context is informed by the perspective of transportation in figure 2.3G.]
[Of course, trains are well and good until something goes wrong.
Did the know-it-alls who named ‘the engine bearing unit of a train’ the ‘locomotive’ also know that the word ‘loco’ is slang for ‘crazy’? Word historians take note!
When something goes wrong, the actualities of the boiler and the valves merge into a single problem. The piston does not work!
What could the issue be? The fuel? The flow of water and steam? The pressure? The regulators and valves?]
Man and Sin by Piet Schoonenberg (1964) 2.3 G
Man and Sin by Piet Schoonenberg (1964) 2.3 F
[The piston of the steam engine could accomplish work.
What type of work?
‘Work’ has a technical definition in physics. Here, I mean ‘getting a task accomplished’ in contrast to ‘wasting effort’.
This goes with the perspective level of a steam engine.
The perspective level of the piston may interscope with higher nested forms.
The result is another interscope.]
Man and Sin by Piet Schoonenberg (1964) 2.3 E
Man and Sin by Piet Schoonenberg (1964) 2.3 D
[For those trained in psychoanalysis, please do not blow a gasket.
I am only letting off a little steam.
After all, valves and boilers function like Freud’s ‘unconscious’. But, they know not what they do.
Three interscoping forms describe an engine that powers a locomotive.
On the content level, steam is produced. The ancient Greeks had a toy that spun from the emission of steam. They never thought to turn it into an engine. The mechanical philosophers of the West did, around 2000 years later.
They did so by altering the steam’s situation. The pressure of the steam could force a piston to move. Valves were necessary to do this. One valve opened to let water in. That valve shut and the piston moved from volume produced by steam. Then another valve opened to release the steam.
The valves, then, operated in the normal context of ‘moving a piston’. The moving piston then could be used for work.]
Man and Sin by Piet Schoonenberg (1964) 2.3 C-2
[How about this metaphor?
The person’s psyche is like a steam engine.
Perhaps, the normal contexts of think and law act like regulators. Conscience and dispositions act like fuel.
Sigmund Freud, one of the founders of psychoanalysis, started with a picture of the unconscious as a steam engine powering a locomotive.
Freud wrote between 1890 and 1950 AD (7690-7750 U0′).]
Posted in Our current Lebenswelt is not the Lebenswelt that we evolved in, The science of Original Sin |
[This raises the question: Do the models built of interscoping and intersecting nested forms apply to the development of the hardened heart?
Come to think of it, most other models of the hardened heart are metaphors.
So do the models built of interscoping and intersecting nested forms apply to these metaphors?]
Man and Sin by Piet Schoonenberg (1964) 2.3 B
The inclination to evil is a sequel to sin. The human (who was not undergone an interior conversion under the influence of grace) will always be self-centered and selfish. These will guide his first actions. These actions will have consequences. The person will look for some way out. His heart will then harden into pride and despair.
|
cc/2021-04/en_middle_0021.json.gz/line2040
|
__label__wiki
| 0.783239
| 0.783239
|
Parliamentary briefing
RCP response to House of Lords Science and Technology Committee inquiry on future of UK life sciences
The NHS must ensure that patient care remains at the heart of the Brexit negotiations to ensure that UK patients can continue to access the latest treatments.
RCP response to Migration Advisory Committee call for evidence on EEA-workers in the UK labour market
The RCP’s response calls on the government to introduce a positive and welcoming migratory system for doctors to ensure a sustainable and safe NHS.
Consultation response: Expanding undergraduate medical education
The RCP's consultation response to the UK government's proposal to expand undergraduate medical education.
Consultation response: Brexit and health and social care
The RCP responds to the Health Select Committee's inquiry on the priorities for health and social care in the negotiations on the UK's withdrawal from the EU.
Consultation response: autumn statement 2016
The Royal College of Physicians’ (RCP) representation to the Treasury for the government's autumn statement on 23 November 2016.
Winter preparedness in Wales 2016-17
The RCP in Wales has responded to the National Assembly for Wales Health, Social Care and Sport Committee inquiry into winter preparedness in Wales 2016-17.
Consultation response: Long-term sustainability of the NHS
The RCP has responded to the House of Lords select committee inquiry on the long-term sustainability of the NHS.
Consultation response: Review of data security, consent and opt-outs
This consultation seeks views on the proposed data security standards and the consent/opt-outs model as set out in the review by the national data guardian.
Consultation response: Planning for winter pressure in accident and emergency departments
This submission identifies some of the work undertaken by Future Hospital Programme development sites to relieve the pressure on A&E departments this winter.
|
cc/2021-04/en_middle_0021.json.gz/line2042
|
__label__wiki
| 0.965546
| 0.965546
|
Voiceover Reels
CINDY ROBINSON
RDHDSD Productions
A fresh audio perspective...
BROADWAY // BIO
Cindy Robinson began her career in the brilliant footlights of Broadway when Stephen Sondheim cast her in the original 1988 Broadway production of Into The Woods where she not only covered Cinderella, Rapunzel and Little Red Riding Hood, but portrayed Snow White in the PBS taping of Great Performances.
Immediately after, she was cast as Wendy in the 1990 revival of Peter Pan where she also understudied the role of Peter Pan, becoming at that time only the 8th woman in history to perform the role on Broadway. The next bit of serendipity was being cast as the cover to Julie Jordan in the 1994 multi-Tony Award winning revival of Carousel at Lincoln Center directed by the legendary Nicholas Hytner and the production that discovered the amazing talents of Audra MacDonald.
Cindy Robinson sings
the finale from her one woman show, "Black and White."
Regionally, she has starred as some of the prolific characters in musical theatre history including Annie Oakley in Annie Get Your Gun at Casa Mañana in Fort Worth, TX, Emma in Andrew Lloyd Webber’s Song and Dance in Florida, Oklahoma City and Los Angeles, Florence in Chess at the Ford Amphitheatre, Essie Whimple in the Goodspeed Opera House’s production of Redhead, Cunegonde in The Alliance Theatre’s production of Candide just to name a few.
She created her first cabaret series titled For Once in My Life and followed it up 2 years later with her one woman show entitled Black and Whites.
Cindy has performed for sold out/SRO crowds across the United States and Europe. Her new theatrical endeavor is an original podcast musical called, Kabuki Marge. She truly hopes you will join her in this new venture.
CINDY on Broadway
Carousel, Lincoln Center Theatre, 1994
Song and Dance, Deaf West Theatre 2007 —
Peter Pan, TUTS — with Cathy Rigby Mccoy
The World Goes 'Round
Into The Woods, Lyric Theatre, 1993 (?)
Cindy on Stage
Chess, Ford Amphitheatre, Sept
Song and Dance, Deaf West Theatre, 2007
Peter Pan, Nat'l Tour/B'way 1990 — with
Into The Woods, Martin Beck Theatre, NYC
And The World Goes 'Round Lyric Theatre
Song and Dance Lyric Theatre of OK 1999
Peter Pan Nat'l Tour/Broadway 1989 — wit
Into The Woods Martin Beck Theatre, NYC
The Rocky Horror Show Carpenter Square
Pippin Lyric Theatre of OK 1986
Annie Get Your Gun Casa Manana, Dallas,
Pippin Lyric Theatre of OK 1986 — with L
Peter Pan Nat'l Tour — with Courtney Wyn
EVITA European tour 1992? — with Erin St
CANDIDE Alliance Theatre 1988 Atlanta, G
CANDIDE Atlanta, GA Alliance Theatre, 19
CANDIDE Atlanta, GA Alliance Theatre 198
CANDIDE Alliance Theatre, 1988 Atlanta,
© 2018 Cindy Robinson & RedHeadSaid Productions
|
cc/2021-04/en_middle_0021.json.gz/line2043
|
__label__cc
| 0.648034
| 0.351966
|
PREACHING THE TRUTH
Pope Francis Gets A Lecture From A Devout Married Couple About Welcoming Gays In The Church
By John Gallagher October 8, 2014 at 6:10am · 12 comments
The Vatican’s synod on family is underway, and it’s not exactly going as planned. In a surprise that clearly discomforted a number of bishops, an Australian couple hand-chosen to talk to the bishops about the importance of marriage gave an impromptu lecture about the importance of loving gay people–and about sex.
Ron and Mavis Pirola, an Australian couple, have been married for 55 years. They have four children and eight grandchildren and are practicing Catholics. In short, everything the Vatican would like to tout as the ideal couple. So no doubt, the couple’s statement at the synod was about as welcome as a, well, a gay couple.
“Friends of ours were planning their Christmas family gathering when their gay son said he wanted to bring his partner home too,” the Pirolas recounted to the 200 assembled bishops (and one nun). “They fully believed in the Church’s teachings and they knew their grandchildren would see them welcome the son and his partner into the family. Their response could be summed up in three words, ‘He’s our son’.”
Not content to stop there, the Pirolas then told the bishops that they should follow that example: “What a model of evangelization for parishes as they respond to similar situations in their neighborhood! It is a practical example of what the Instrumentum Laboris [the Synod’s working document] says concerning the Church’s teaching role and its main mission to let the world know of God’s love.”
But that wasn’t all. The Pirolas also spoke eloquently about the joy of sex, which had the group of (presumably) celibate clerics squirming. “Gradually we came to see that the only feature that distinguishes our sacramental relationship from that of any other good Christ-centred relationship is sexual intimacy, and that marriage is a sexual sacrament with its fullest expression in sexual intercourse,” the couple said.
As for Church teaching on sexual matters, the Pirolas politely described it as “from another planet.”
The bishops somehow mustered a round of applause for the Pirolas, though perhaps it was an attempt to get them to shut up. What the episode proved, however, is that the Vatican is out of touch with many of its most faithful members. The question is, will it deign to do anything about it?
Catholics Mavis Pirola pope francis Religion roman catholics Ron Pirola Vatican
Subscribe to Queerty for a daily dose of #catholics #mavispirola #popefrancis stories and more
Hopefully, when truth speaks to power, truth wins.
Leonard Woodrow
Bravo that couple! They are more Christian than the Pope and his peers.
Paul Nadolski
“…the Vatican is out of touch with many of its most faithful members.”
My niece will be baptized Catholic next month. (I’d rather she wasn’t but whatever, it’s not up to me). However, I know for a fact that her parents (my sister and brother-in-law) will raise her to love her gay uncle (me) just as much as her other aunts and uncles.
This is the problem that Churches like the Catholics and the Mormons have. Under the old Pope especially they were so out of touch with their parishioners, that they needed to get rid of him because he was killing off the church. Attacking people for using birth control when something like 90% of American Catholics use it.
Now this couple, the model of a good Catholic couple is lecturing them on how out of touch they are. Good for them!
October 8, 2014 at 10:10am
Saint Law
@Cam: That is exactly why they got rid of the sclerotic old kween – because they understood that within a couple of generations the Catholic church – in Europe and probably America too – would be finished.
Truth is that when it comes to homosexuality the liberals have won.
The conservatives will be dead before they realise this fact, but then it was ever thus.
Clearly, having an active sex life, they’ve used birth control and took control over their own family planning.
Welcoming a gay son and his partner as part of the family is also telling.
One nun on the panel?
How can any of these celibate nitwits have any meaningful insight into family dynamics in general, and sex in particular? They are so far removed from any notion of family and sex, it’s absurd.
Unless of course, they know a lot more about sex and relationships than they are letting on. If that’s the case, they need to come out of the closet and do away with cecilacy all together.
krandall
On the other hand…The very fact that they were allowed to make these comments and finish them rather than being ushered out of the room by the Swiss Guards, say a great deal that is good about the current pope. Not long ago they would have been shut down and made to leave before they finished what they had to say.
Like every other injustice, it is merely a matter of time before it is undone. And in the end, I believe history will show that Pope Francis played an important part in changing the way the church operates and what it teaches. Unlike Pope Benedict, Pope Francis is a pastor, not an administrator. We should all support him when he does things we approve of that make our lives better. In fact, I am going to write to him thanking him for allowing this couple to express their views in what must have felt like a hostile environment and for directing the bishops to listen and learn from the lay members who would be talking to them. He does not have an email address (neither would I, if I were pope) but you can send a letter to
His Holiness, Pope Francis PP.
00120 Via del Pellegrino
Citta del Vaticano
Shocking as it is, he not only reads a lot of them, he actually calls people when he’s moved by their letters. He recently called a 19 year old Italian guy in Padua after he left a letter for the pope when he went to mass at the Vatican. The guy wouldn’t say what he wrote. Once I looked at his face I felt I had a good idea of what he wrote about. I just wish I could have heard that phone conversation.
The Pirolas are very courageous and we owe them our gratitude. We must try to follow them and support them when they return home and are maligned and made scapegoats by ignorant and unenlightened members of their parish.
Lance Mullholland
Please give this new pope a break! He’s already confronted mafia money laundering (and traveled multiple times to Sicily) in the Vatican Bank. He’s just now beginning to break a stride as a progressive pope (and as a liberation theology Jesuit from South America). Can’t re-build Rome in a day, folks. It’s a big ship to turn around. Would you travel on a plane with this man ? I wouldn’t. He’s not just kissing babies and deformed people – he’s deeper than pure PR spin.
As an Old Catholic priest, I say God preserve and bless him + For us, he is still the bishop of Rome, may eventually help our Roman mother church catch up with us.
SteveDenver
@Lance Mullholland: “Would you travel on a plane with this man ? I wouldn’t.” What a bizarre statement, where is your “faith.” Of course you wold, you would carry his shoes in your mouth like a puppy and crawl on all-fours.
Too bad this couple didn’t say, “We were discussing this last night and decided to leave the church and it’s bizarre bu||sh!t. You all know this is a big lie, but you have your pretty robes and hats, and love to parade.”
Oh ye of little faith and knower of All Things. God gave us a brain to use, and (unfortunately) a small percentage of it at that.
Broad generalizations about whose shoes I would lick said in a mean way. Why is GayWorld so freakin’ coarse and rude ?
Bless your heart, as we say in the South…
@Lance Mullholland:
I give him a break, but part of his behavior is no doubt a response to the fact that the Catholic Church was dying a fast death under the previous Pope. Ratzinger seemed to prefer a hyper orthodox church that was much much smaller, angrier, and not interested in any good works. This Pope is walking the only path to recovery that could have possibly saved the church and seems to be doing a good job of it so far.
He also seems to be weeding out the crazy orthodox followers of the previous Pope one by one. It will be interesting to see what the church becomes under him, but it already seems to be heading in a far better direction.
|
cc/2021-04/en_middle_0021.json.gz/line2051
|
__label__cc
| 0.67869
| 0.32131
|
can we create Proxy for the WCF Service?
IIS-hosted WCF service
What is Difference between WCF and Web service?
What are basic steps to create a WCF service ?
Why returning dataset or data table from WCF service is not a good practice?
What is the difference between Web Service and WCF Service?
posted Feb 4, 2014 by Asmita Agrawal
Web Service in ASP.NET
A Web Service is programmable application logic accessible via standard Web protocols. One of these Web protocols is the Simple Object Access Protocol (SOAP). SOAP is a W3C submitted note (as of May 2000) that uses standards based technologies (XML for data description and HTTP for transport) to encode and transmit application data.
Consumers of a Web Service do not need to know anything about the platform, object model, or programming language used to implement the service; they only need to understand how to send and receive SOAP messages (HTTP and XML).
Windows Communication Foundation (WCF) is a framework for building service-oriented applications. Using WCF, you can send data as asynchronous messages from one service endpoint to another. A service endpoint can be part of a continuously available service hosted by IIS, or it can be a service hosted in an application. An endpoint can be a client of a service that requests data from a service endpoint. The messages can be as simple as a single character or word sent as XML, or as complex as a stream of binary data.
answer Feb 6, 2014 by Atul Mishra
When and How?
Could the IIS-hosted WCF service make use of HTTP transport security if the IIS virtual derectory that contains the service does not support it?
Any example will help.
What are the alternatives ?
|
cc/2021-04/en_middle_0021.json.gz/line2052
|
__label__wiki
| 0.96649
| 0.96649
|
EndSessions
Gregr
Nicole Alvarez
Megan Holiday
Latest from 107.7 The End
Heat Waves
audio from 107.7 The End
One Oh Seven Seven The End
Waitress saves 11-year-old boy from abuse by sending a secret message
This week in Nerd Talk
Chris Cornell's daughter marks an anniversary with a touching tribute
Feel It Sell: Portugal. The Man have launched their own cryptocurrency
Foo Fighters, Bruce Springsteen added to Joe Biden Inauguration special lineup
Home / 107.7 The End / News / Surviving Nirvana Members Reunite With Beck, St. Vincent, Violet Grohl
Surviving Nirvana Members Reunite With Beck, St. Vincent, Violet Grohl
Watch the performances in L.A.
By Bob Diehl
January 6, 2020 01/06/2020 9:50 am
Dave Grohl, Krist Novoselic and Pat Smear don’t get together to perform Nirvana music that often, but when they do it’s something to remember.
The surviving members of one of the most influential bands of all time shared the stage at The Art of Elysium’s “Heaven is Rock and Roll” gala at the Hollywood Palladium. They were joined by Beck and St. Vincent, as well as Grohl’s daughter, Violet.
Frances Bean Cobain Launches 'Kurt Was Here' Apparel
The 5-song set began with St. Vincent on vocals for “Lithium” from Nirvana’s culture-shifting album Nevermind. By the time the powerful chorus kicked in, the crowd was already mentally back in the early 90s. Beck then took the mic for “In Bloom” and “Been a Son” before Violet Grohl mesmerized the black tie crowd with her rendition of “Heart Shaped Box.” The performance ended with Beck back on vocals for “The Man Who Sold the World” – the David Bowie song Nirvana made their own on “MTV Unplugged.”
Grohl was surprisingly quiet during the set, but Novoselic told the crowd he and his former bandmates can’t resist the temptation to get together every once in a while. He then said he wanted to acknowledge late frontman Kurt Cobain and asked for a cheer.
The surviving members of Nirvana last played together at Cal Jam 2018. After Grohl and Smear completed their set with the Foo Fighters, Novoselic joined them to perform six Nirvana songs. Deer Tick’s John McCauley handled vocals on “Serve the Servants,” “Scentless Apprentice” and “In Bloom,” while Joan Jett sang on “Breed,” “All Apologies” and “Smells Like Teen Spirit.” Jett also performed with the surviving Nirvana members at their 2014 Rock and Roll Hall of Fame induction.
Jeff Bridges says his tumor has ‘drastically shrunk’ following lymphoma diagnosis
Dream job alert! Here's how you can get paid to watch Netflix and eat pizza
Rare chance to see distant planet Uranus next week, NASA says
'Sopranos' prequel film 'The Many Saints of Newark' gets a new release date
Joanne Rogers, widow of Fred Rogers, dies at 92
107.7 The End | Seattle's New Music Discovery
Listen to 1077theend Contact Us EEO Public Inspection File Contest Rules FCC Applications Advertise with Us
|
cc/2021-04/en_middle_0021.json.gz/line2054
|
__label__wiki
| 0.5885
| 0.5885
|
POLITICS: Tehran Conservatives Pressure Commerce Ministry to Relocate Expo and Conventions Center
July 28, 2004 - Big financial gains may be at stake in Tehran conservative municipal government’s pressure on the reformist commerce ministry to vacate the choice real estate in northern Tehran, which for the past fifty years has been occupied by the permanent international trade fairs and conventions center, a Tehran journalist told Radio Farda’s broadcaster Nima Tamadon on the condition of anonymity. The city council evicted the conventions center from the premises by passing a law which cited traffic congestion as the reason for the eviction. Claiming that he plans to build a women-only park in the city property, Tehran’s conservative mayor Mahmoud Ahmadi-nezhad proclaimed the present motorbike trade show as the center’s last. The planned international pastry and chocolate exhibit and a major carpet exhibit are both looking for new venues, even though the fairs and conventions center’s director has asked interior minister to veto the city council’s legislation.
|
cc/2021-04/en_middle_0021.json.gz/line2055
|
__label__wiki
| 0.795867
| 0.795867
|
Content and creative providing a revenue boom for Golin Singapore
August 03, 2015 by Gary Scattergood
Video case studies, multimedia blog content and brand identity work helping drive new business, according to creative boss
Ice work: Golin Singapore created these social media visuals for Cornetto
Golin Singapore’s content and creative work will grow from "negligible" to accounting for 15-20 per cent of overall revenue this year, in what has been described as a "coming of age" for the company’s G4 structure in the country.
According to executive creative director Shouvik Prasanna Mukherjee, the firm’s creative and content capabilities are now allowing it to pitch for work that would not be undertaken by a traditional PR firm.
"This is keeping with our ambition to be an integrated communications agency with public relations and digital at our core," he told PRWeek Asia.
"We started by creating social media posts and infographic press releases to taking on pieces of design work like designing tray mats for McDonalds, and currently we are getting a lot of content work from developing video case studies (an example of video work can be seen below), brand identity content and multimedia content for blogs. These are over and above the written content including essays, articles, blog posts, advertorials, anniversary booklets and conference show dailies," he added.
Under Golin’s G4 model, the team is structures along the lines of strategists, creators, connectors, and catalysts.
Mukherjee said the creative side of the agency was increasingly driving new business and then harnessing the expertise in the other "communities" to execute campaigns.
He pointed to additional content work being secured from existing clients such as McDonalds, Panasonic, Changi Airport and local public agencies.
New mandates undertaken by the team in Singapore - which is led by managing director Tarun Deo - include regional content work from Samsung and Volvo Trucks. It has also undertaken social media visual work for Magnum (see below).
"With the proliferation of digital, mobile and non-traditional channels, brands are increasingly seeing the potential to create interesting content to engage with their customers, employees and other stakeholders.
"This trend seems to be industry agnostic and we are catering to clients from consumer electronics, B2B technology, FMCG, healthcare to public sector agencies," Mukherjee said.
"Our content and creative work should make up about 15-20 per cent of our overall revenue this year. This was negligible at the start of 2015," he said.
The increase in workload has resulted in the creative team doubling in size to eight people, with more hires expected as business continues to grow.
"Our strategy has focused on pursuing the right opportunities and then it has been down to flawless execution so that you develop that key element of trust when the work speaks for itself. We are now seeing work won here being a feeder to traditional PR work, which is great for the team and the office in general," Mukherjee added.
Stay on top of all the latest Asia-Pacific PR news, views and insights: Follow PRWeek Asia on Twitter and sign up for our weekly email news bulletins
Golin
Asia Promotions
Grab hires Golin as PR lead
Nespresso Singapore takes on Golin as PR lead
|
cc/2021-04/en_middle_0021.json.gz/line2057
|
__label__wiki
| 0.87087
| 0.87087
|
KEVIN REED
SPIRITUAL ARTICLES/BLOG
Plants don’t have feelings and aren’t conscious, a biologist argues
Post author:Kevin Reed
Lincoln Taiz and colleagues lament the rise of ‘plant neurobiology’
NOT THE SAME Plants have no need for the brains, or the awareness, that animals have, researchers say.
By Laura Sanders
Lincoln Taiz is peeved. Over the last decade or so, the retired plant biologist has watched the rise of the field of “plant neurobiology” with growing dismay.
That controversial field, which debuted in a 2006 article in Trends in Plant Science, is based on the idea that plants — which do not possess brains — nonetheless handle information in ways that resemble sophisticated animal nervous systems. This thinking implies that plants could feel happiness or sorrow or pain, make intentional decisions and even possess consciousness. But the chances of that are “effectively nil,” Taiz and colleagues write in an opinion piece in the Aug. 1 Trends in Plant Science.
“There’s nothing in the plant remotely comparable to the complexity of the animal brain,” says Taiz, of the University of California, Santa Cruz. “Nothing. And I’m a plant biologist. I love plants” — not because plants think like humans, he says, but for “how they live their plant lives.”
THORNY SUBJECT Plant biologist Lincoln Taiz pushes back against the field of “plant neurobiology,” arguing that plants aren’t conscious, nor do they need to be.L. TAIZ
Some plants are capable of sophisticated behavior. Wounded leaves can send warning signals to other parts of the plant, and noxious chemicals can deter munching predators. Some plants may even have a version of short-term memory: Tiny sensing hairs that line Venus flytraps’ insect prisons can count the touches that come from a bumbling insect (SN Online: 1/24/16). But plants perform these feats with equipment that’s very different from the nervous systems of animals, no brain required, Taiz contends.
He and colleagues point out methodological flaws in some of the studies that claim plants have brainlike command centers, animal-like nerve cells and oscillating patterns of electricity that are reminiscent of activity in animal brains. But beyond the debate over how these studies are conducted, Taiz’s team argues that plant consciousness doesn’t even make sense from an evolutionary point of view.
Sophisticated animal brains evolved in part to help an organism catch a meal and avoid becoming one, Taiz says. But plants are rooted to the ground and rely on sunlight for energy, a sedentary lifestyle that doesn’t require quick thinking or outwitting a predator — or the energetically expensive nervous systems that enable those behaviors.
“What use would consciousness be to a plant?” Taiz asks. The energy required to power awareness would be too costly, and the benefit from such awareness too small. If a plant fretted and suffered when faced with a threat, it would be wasting so much energy that it wouldn’t have any left to do anything about that threat, Taiz says.
Imagine a forest fire. “It’s unbearable to even consider the idea that plants would be sentient, conscious beings aware of the fact that they’re being burned to ashes, watching their saplings die in front of them,” Taiz says. The horrifying scenario illustrates “what it would actually cost a plant to have consciousness.”
Besides, plants have plenty to do without having to be conscious, too. With sunlight, carbon dioxide and water, plants create the compounds that sustain much of the rest of life on Earth, Taiz points out. “Isn’t that enough?”
L. Taiz et al. Plants neither possess nor require consciousness. Trends in Plant Science. Vol. 24, August 1, 2019, p. 677. doi:10.1016/j.tplants.2019.05.008.
E.D. Brenner et al. Plant neurobiology: an integrated view of plant signaling. Trends in Plant Science. Vol. 11, August 2006, p. 413. doi:10.1016/j.tplants.2006.06.009.
20 Mysteries Actually Solved by Psychics
Why people with celiac disease suffer so soon after eating gluten
Learn Tantra – explains Kundalini Energy!
A simple strategy to improve your mood in 12 minutes
Nostradamus terrifying predictions for 2021 – brain chips in soldiers and asteroid hits earth
2021 Numerology: Our Predictions By Life Path Number
What 2021 Has in Store for You, Based on Your Chinese Zodiac Sign
Horoscope 2021: Astrological predictions for the New Year, what’s in store for Leo, Virgo, Scorpio, Sagittarius and other zodiac signs
Psychic Cafe 2021 We’re back!
Greerton Community Hall
|
cc/2021-04/en_middle_0021.json.gz/line2058
|
__label__wiki
| 0.668663
| 0.668663
|
Posts tagged with "churches"
Bishop of Lahore Speaks to Pukaar News in Wake of Church Bombings
March 17th, 2015 Bishop of Lahore, the Rt Revd Irfan Jamil condemns Sunday's terrorist attack on two churches in the cities Youhanabad neighbourhood in Pakistan. Around 100,000 Christians live in the neighbourhood of Youhanabad according to officials. Up to 4,000 people took to the streets following the attack, many armed... By March 17th, 2015 0 comments
15 Killed in Pakistan Church Bombings
March 16th, 2015 At least 15 people have been killed and another 70 wounded after two churches were bombed in Lahore, Pakistan on Sunday. The two churches in the neighbourhood of Youhanabad, were attacked by Taliban suicide bombers during Sunday service. Scene Outside Church in Lahore Minutes After Deadly... By March 16th, 2015 0 comments
Lead Theft Continues to be a problem for Leicestershire Churches
November 20th, 2014 The theft of lead from church roofs continues to be a major problem in Leicestershire. Just this week over 3 tonnes of lead was stolen from St. Mary's Church in Cotesbach near Lutterworth. Liz Hudson, communications director for the Diocese of Leicester said "Fundamentally it has a huge impact on finances, the lead cannot... By November 20th, 2014 0 comments
Pukaar Magazine
Leicester resident’s homemade masks
Bollywood Dance Star’s first Visit to Leicester
Dock is “worth every penny”: £5.8million innovation centre opens
PUKAAR NEWS
We are a leading independent Leicester news agency based in the Midlands with head office in Leicester, providing news to television channels worldwide and provides PR solutions for a range of businesses. Pukaar News covers local and international news, including Europe, the UK, India and Pakistan. Producing online news for pukaarnews.com and pukaarmagazine.com along with news for distribution to other well known news broadcasters.
Facebook Twitter YouTube+ LinkedIn
Disclaimer: Pukaar News holds copyright to all text and media. We cannot accept responsibility for any material received and any views expressed by advertisers or contributors may not be those of the publisher. All materials sent out to Pukaar News are assumed to be copyright free unless otherwise advised.
Pukaar News UK LTD
|
cc/2021-04/en_middle_0021.json.gz/line2059
|
__label__cc
| 0.525024
| 0.474976
|
Category: activism
Encouragement, ideas, props to help the activist make the world a better place for animals.
Back in May of 2017, Hillsborough County said “no more” to puppy stores, but grandfathered the three puppy stores in. Which in our eyes is no ban, of course.
But the puppy mill paradigm reared its ugly head last September when 300 puppy mill dogs had to be rescued in Hillsborough County in deplorable condition.
Who let the dogs out? Hillsborough County says puppy mill rescues now ready for adoption
More than 300 dogs were rescued in mid-September from terrible conditions inside a Valrico puppy mill. They will be put up for adoption in a few weeks.
These are four of the puppies rescued from a puppy mill in Valrico as they wait to be checked by veterinary staff at the Hillsborough County Pet Resource Center. More than 300 small-breed dogs were rescued in September and will soon be put up for adoption. [MARTHA ASENCIO-RHINE | Times]
Just like Reno’s errant puppy store’s Grand Jury indictment got Reno to entertain a ban in earnest once again, so to the terrible ways of the puppy mills and the stores that sell them (all retail stores, as you should know by now) always seem to inflame animal rights and consumer protection activists to get bans passed in their cities, counties, states and even entires countries.
We track jurisdictions that have passed strong restrictions rather than full bans because we believe their inherent flaws will eventually lead to full bans being passed. This is a great example of why jurisdictions should just pass a full ban, no grandfathering and be done with the whole hot mess.
Dog and cat retailers banned in Hillsborough, commission rules
The change prohibits all commercial cat and dog sales in the county, which could force Hillsborough’s three remaining pet shops out of business.
Author puppymillfree_ws7hqtPosted on March 5, 2020 March 5, 2020 Categories activism, Bans, bans with stores, update, websiteLeave a comment on Hillsborough County passed a ban in ’17, but allowed 3 stores. Today they said, “Shut them all down!”
After a 3 year hiatus commencing with the Trump Administration’s takeover of the Department of Agriculture, USDA puppy mill inspection reports are back online after a legislative act forced the public information be given back to the public the reports are meant to serve.
Official USDA announcement.
Author puppymillfree_ws7hqtPosted on February 18, 2020 Categories activism, nationalLeave a comment on USDA Inspection Reports Back Online
Just weeks after puppy store Puppy World opened in Olympia Washington, activist and veterinarian council member Lisa Parshley led the charge at the city council which passed a ban unanimously in a first reading on 2/11/20.
Council Member and Veterinarian Lisa Parshley
Puppy World is part of a small, but clearly interested in expanding, franchise called PuppyLand which operates in Puyallup, WA; Olympia, WA (but only until amortization expires next September); and Meridian, Idaho.
This passage brings the count to 7 bans in Washington.
One wonders if activists in neighboring Oregon just don’t care…. They are the only state on the west coast to not have a single ban anywhere in the state.
To be fair, the state legislature entertained a state-wide ban in the 2018 session, but without a single town or city making a statement, it’s hard to get states to sign on.
See all 23 states without a single local ban.
Jurisdictions with puppy stores in them when bans were passed has now increased to 72. Two in a row now with the fantastic news from Naperville, Illinois, whose ban passed 1/2020 after 6 years of fighting to get it done.
Legend for our GOOGLE MAP OF INTERNATIONAL BANS & RESTRICTIONS.
Author puppymillfree_ws7hqtPosted on February 16, 2020 February 19, 2020 Categories activism, Bans, bans with stores, update, websiteLeave a comment on Olympia WA tells new puppy store: No Thank You!
Heart strings across the globe where tugged when the news broke of poor Lucy, the puppy farm breeder dog with a deformed back who was rescued from a puppy farm in Wales.
Lucy, recused.
The good news from that sad story is that it sparked the first countrywide ban in the world. England passed its ban in the summer of 2019 to become affective April Fools’ Day, 2020.
Welsh activists have long hoped a similar ban in Wales could actually pass before England’s went into effect. But often the wheels of law turn slowly. Wales had its public comment period completed last summer and the law will be “laid” sometime in the near future, but the nightmare of BREXIT has put a lot of UK laws on the back burner until they figure out the path forward.
The Wales Parliament has met this month and projected a laying if the law, but not before Spring.
Scotland, too, has started the process. A little bit of a surprise as there were some important players in the animal welfare realm in Scotland that were actually against the law for some perplexing reason. But, speaking of reason, reason prevailed and Scotland is moving forward. Though they not only have a Brexit to contend with, but a growing movement for independence from the UK which has an urgency at the moment.
That left Northern Ireland as the only UK member country to not take a position on England’s passage of Lucy’s Law. Calls for action and passage continue to come in. One in August 2019 and now, 1/2020, the Belfast City Council is demanding parliament take action sooner than later.
Links and latest news can be seen in our UK section. Click the details arrow for information.
Author puppymillfree_ws7hqtPosted on January 17, 2020 January 18, 2020 Categories activism, Bans, coutrywide, InternationalLeave a comment on Belfast City Council Calls For Lucy’s Law Ban in Northern Ireland
New Jersey bans total well over 100. Not easy to track when some city, borough, township and village names are the same and some counties have cities with the same name in them.
But the fight over ordinance passage in the township of Washington (not to be confused with Burlington City, both of which are in Burlington County, or nearby Burlington, Connecticut, or the capital of Vermont) ended with a win.
The Mayor was absent when the council unanimously passed Washington’s retail animal sales ban. But when the law crossed his desk, he said no. “Vetoed!”
The Council was having none of it and promptly vetoed the veto.
X. VETO OVERRIDE: O13 – 2016: ORDINANCE RESTRICTING THE SALE OF DOGS AND CATS FROM PET SHOPS
Agenda, 8/24/2016
Happy ending for a lot of suffering dogs and cats!
Author puppymillfree_ws7hqtPosted on November 3, 2019 Categories activism, anomalies, BansLeave a comment on Mayor tries to veto ban, Council says forget it
This is an ongoing post to be updated through the months…
7 States with statewide bans on the table.
Update: 1/2020
1 down! 6 States with statewide bans on the table.
Maine Governor Janet T. Mills moved the 6/2019 legislation to law on 1/12/2020. Details under the Maine section below.
House bill 800: An Act banning the retail sale of cats and dogs in pet shops
Senate bill 175: An Act banning the retail sale of cats and dogs in pet shops
At a time where there are healthy and loving pets waiting to be adopted from animal shelters statewide, there is simply no reason to allow the sale of puppy mill animals. Puppy mill animals are mistreated from birth, and often develop behavioral or physical health problems later in life despite their high price tags. This bill would encourage the adoption of dogs, cats and rabbits and ensure that animals no longer have to face the cruelty, physical and psychological abuse to which the puppy mill supply chain subjects animals.
Assembly bill status New York
Prohibits retail pet store from selling or offering to sell dog other than dog acquired from animal shelter, humane society, dog control district or nonprofit corporation that provides rescue services.
House bill 4045.
This bill prohibits a pet store from selling dogs and cats beginning on January 1, 2020. A person who violates this prohibition is subject to a civil forfeiture of up to $10,000 for the first offense and up to $25,000 for the second or any subsequent
offense.
An Act amending Title 18 (Crimes and Offenses) of the Pennsylvania Consolidated Statutes, providing for transfer and sale of animals.
Maine was the first state to pass a ban on sale of dogs and cats through their legislature, but controversial governor LePage refused to sign the bill. It’s now in the hands of new governor Mills, but it’s not clear if she will sign.
Gov. Janet Mills should sign L.D. 1311. It will effectively impact puppy mills by shrinking the marketplace and drive Maine’s pet market towards more humane sources.
Pet store law would protect animals
A person may not advertise for sale, sell or exchange for value more than one cat or dog under the age of 6 months in a 12-month period unless that person has a valid animal shelter, kennel, or breeding kennel or pet shop license or a valid vendor’s license issued under this section.
Sec. 11. 7 MRSA § 4153. Sale prohibited
Legislators and the Gubernatorial mansion ally against puppy mills.
“I’m honored to be partnering with First Gentleman Reis to shed light on the abhorrent conditions at puppy mills,” said Rep. Duran, D-Wheat Ridge.“Every dog deserves to live in happiness and safety. Our furry friends demand very little in exchange for unconditional love and attention, and I look forward to taking action to address the inhumane treatment of animals in our state.”
First Gentleman Reis and Representative Duran are exploring legislative proposals to ensure the health and safety of dogs and cats.
On Puppy Mill Awareness Day, Rep. Duran & First Gentleman Reis Draw Attention to the Need to Protect Our Canine Friends. Article.
But after a recent exposé of sick and dying puppies at a store that has had puppy deaths not long after sales dating back to 2002, legislation ending puppy and kitten sales in Colorado now seems to be on a fast track.
Pet Store Ban? Talks Underway After More Than A Decade Of Complaints About Sick Puppies
Other states bringing up the issue so far include Nevada. State Legislature there meets only every two years. Next legislative session, February 2021.
A Bill Draft will be submitted to end the sales of dogs, cats, rabbits in retail stores in the state of Nevada by Senator Julia Ratti.
Arizona doesn’t have a state ban in the pipe, but there is a provision to end the statewide prohibition of local bans, which would allow the two bands in Phoenix and Tempe, which are still written into their municipal code, to become immediately enforceable. Tucson, Arizona, was on the eve of passing a local ban when the state law took effect. Ending the state prohibition of local bans would see passage of the Tucson ban occur soon thereafter.
…Includes a repeal of the prohibition of local retail store bans. Phoenix and Tempe city ordinances are still on the books, made unenforceable by state law. If 2329 passes with repeal intact, Phoenix and Tempe will not only enforce, but Tucson has been holding a city ordinance in the ready for when they will be able to enforce it.
Author puppymillfree_ws7hqtPosted on October 4, 2019 January 15, 2020 Categories activism, Bans, bans with stores, statewideTags pending, statewideLeave a comment on Landslide of Statewide Bans if OR, CO, WI, MA, PA, ME, & NY Pass Pending Bills
From Wales online:
The ‘wonky’ Welsh puppy who is Boris Johnson’s new Downing Street dog
The little Jack Russell cross puppy with a misaligned jaw was abandoned by a puppy farmer
Who on earth would kill adorable Dilyn?
The new dog set to reside at Downing Street has been rescued from the South Wales Valleys.
At just 15-weeks-old, the little Jack Russell cross puppy named Dilyn nearly found himself being shot or drowned after being abandoned by a Welsh puppy farmer.
Author puppymillfree_ws7hqtPosted on September 14, 2019 Categories activism, International, UKLeave a comment on England PM’s dog is a puppy mill rescue
The Deep South of the state of California has been trying to rid itself of multiple store owner David Salinas for six years.
San Diego was the first to throw one of his stores out in 2013.
Then Encinitas and San Marcos in 2015.
Then Oceanside and Carlsbad in 2016.
Solana Beach, Vista and Del Mar passed preventive ordinances to make sure he didn’t come there.
Then the great state of California passed a comprehensive ban of retail sales of dogs, cats and rabbits in October 2017, effective 1/1/19.
But he’s still at it.
Activists have had enough.
National City still has 2 puppy stores open and doing the business of passing on the progeny of tortured, malnourished, sickly, spirit-broken dogs onto unknowing customers for a substantial premium.
Salinas is not going easily into that good night. He surely doesn’t want to let go of his easy money stream so he is hanging on with all his might to the last torn threads surrounding the state’s language loopholes.
But activists are there to virtually tar and feather him every step of the way.
Thank you southern California activists, for leading the way on fighting these stores to the bitter end and showing the rest of the country the steps they might have to take when their states pass a comprehensive retail animal sales ban.
Author puppymillfree_ws7hqtPosted on September 6, 2019 Categories activism, Bans, bans with stores, updateLeave a comment on Salinas simply won’t go away
Wales Publishes Responses to Proposed Dog & Cat 3rd Party Sales Ban
Yesterday the government of Wales published the long-awaited document reviewing submissions of comments (“consultations”) by the public. Remarks were submitted by 458 agencies, organizations and individuals in the open period from 19 February – 17 May 2019.
The results are quite as expected. Near unanimous support with a few eye-rollers: the typical fatuous argument that a ban won’t completely end the industry so why bother to do anything at all.
Blue Cross, an animal rescue and rehoming agency active in Wales, Scotland and England since 1897, had this to say:
We don’t agree that just introducing a ban on thirdparty sellers will have any impact on those sellers that make large profits and choose to operate outside the licensing regime. We believe that before introducing a potentially knee jerk piece of legislation, the government must assess the scale of the third party trade in puppies and the impact any such ban would have on licensed large scale breeders.
Blue Cross submission to the Gov’t of Wales Call for Consultation on ending third party sales of dogs and cats.
Emphasis ours.
They go on about stricter regulations being the best course. We in the ‘States know this strategy simply does not work as most governments are unwilling to put additional staffing and revenue/expense burdens on those budgets already stretched, which the route of strong restrictions causes en masse.
Flag of Wales
New York City is a showcase for this. NYC’s strong restrictions of dog and cat retail sales have proven near-completely unenforceable and sales go on largely unchecked, while their outright ban of rabbit sales has put a stopper on the rabbit overpopulation problem by directly ending impulse purchases in pet stores.
The English ban is set for enforcement on 1 April 2020. The law was deemed Lucy’s Law after news about a spaniel in a typical puppy mill horror situation achieved viral status in the UK. Lucy was imprisoned in a puppy mill in Wales.
Lucy tugged at the Brit’s heartstrings when photos of her fused hips and curved spine from years of living an empty life of nothing but breeding went viral on social and news media. This image is from a Sky News May 19, 2019, article: ‘Lucy’s Law’ puppy farm ban set to be confirmed.
Welsh activists have called on their government to “beat the English to it.” With Lucy’s Law laid in the spring of this year the Welsh government would have to move swiftly, mandating enforcement in less than 8 months, to win the race of taking this critical step in ending animal cruelty in the British Isles.
Either way, England and Wales are now the de facto model to the world of how a countrywide ban can be enacted through the determination of activists to bring about change.
End the suffering.
Author puppymillfree_ws7hqtPosted on July 19, 2019 July 19, 2019 Categories activism, International, UKTags activism, countrywide ban, UKLeave a comment on Wales Publishes Responses to Proposed Dog & Cat 3rd Party Sales Ban
|
cc/2021-04/en_middle_0021.json.gz/line2060
|
__label__wiki
| 0.523129
| 0.523129
|
We asked Canadian and US officials for the same border closure docs — but Trudeau's Liberals are stonewalling
By Sheila Gunn Reid
We asked Canadian and US officials for the same border closure docs
Help fund our ATIPs
Help cover the cost of our access to information requests.
We’ve been working for months filing dozens of requests with federal government agencies, provincial agencies, and even American states to dig up information about the COVID-19 related closures of the Canada-US border.
If an agency had any relation to the border or if a state touched the border, we wanted to know what they knew about the border closures and when they knew it.
Getting our hands on 91 documents from Washington state was easy, but those internal emails didn’t reveal anything of note other than a cringe-worthy email signature about "gender equality" used by the Consul General of Canada to the Pacific Northwest of the United States.
Sadly, our efforts were much less successful with our own governments — federal and provincial.
Agency after agency used the pandemic as an excuse not to hand over documents until 2021.
The CBSA took a 180-day extension, saying our requests would unreasonably interfere with the operations of their agency.
Public Safety Canada required an extension of 165 days saying they need to conduct “consultations with program experts and other departments.”
The Cabinet Office of Ontario took an 8-month extension and required a $675 fee. We won't see those documents until at least June 19, 2021!
The Office of the Solicitor General in Ontario took an extension of 60 days and sent us a bill for $795.
Transparency is an important part of a well-functioning democracy. Without it, we can't be asked to trust the direction the government is taking us in.
So why was a U.S. state more open and transparent with Canadian journalists than Canada itself was?
Coronavirus Immigration Washington State Rebel News Exclusive
Scottish Lockdown: Arrested and fined at an Edinburgh rally
By Benjamin Loughnane
Ticketed for protesting at Doug Ford's house
By Tamara Ugolini
Pro Wrestler's COVID Fine, Cancel Culture Nabs Real Estate Agent
“We'll never know” if Cdn soldiers brought COVID back to Canada | Conservative MP Bob Benzen
Trudeau had two jobs to handle COVID-19 and he failed both — so where are the Conservatives?
Biden announces $1.9 trillion relief package, including new stimulus checks
|
cc/2021-04/en_middle_0021.json.gz/line2061
|
__label__wiki
| 0.624429
| 0.624429
|
NJ second homeowners in limbo a year after Sandy
From the Chamber: The joy of Jean
Firefighters put out blaze on Barber Road in Harwinton
Animal control: Small dog found dead, dumped in Harwinton
Winsted seeking new ZEO: Think permits, zoning enforcement and blight
Emergency room moving to new HHC center in Winsted
Winsted dog training facility plan set for public hearing
League of Women Voters to present history speaker Jan. 24
Torrington Lions Club makes holiday donations
Rep. Cook sworn in for seventh term
‘A perfect storm’: COVID, family death force fitness studio...
Katie Zezima The Associated Press
Oct. 26, 2013 Updated: Aug. 27, 2017 3:01 p.m.
This Friday, Oct. 18, 2013 photo shows the vacation home of Cora Hoch, left, in Lavallette, N.J. The home, which was damaged by Superstorm Sandy, has been gutted and no repairs have been made to it while neighbor homes are up and running again.Julio Cortez — The Associated Press
STAFFORD TOWNSHIP, N.J. >> The Jersey shore’s small vacation bungalows and cottages have for decades staked out little plots of paradise where families who scrimped and saved could while away summer evenings, parents having drinks on the deck and kids working the ice cream stand or stealing a first kiss under the boardwalk.
Now, nearly a year after Superstorm Sandy blasted through, countless middle-class families whose tiny vacation homes were once the place to make precious memories are finding them to be a financial albatross.
While billions of dollars in federal relief have helped primary homeowners rebuild after the storm, second homeowners find themselves stuck in limbo: not eligible for enough money to rebuild or even demolish their homes while they remain on the hook for mortgage payments and fatter flood insurance fees for houses they can’t even use.
“We thought we were good for the community, and to suddenly be labeled this second homeowner like it was a derogatory statement, it was like a smack in the face,” said Benita Kiernan, a retired nurse who with her retired New York City firefighter husband sank every spare cent into a small cottage on an inlet in Stafford Township.
“We became the scarlet-S second homeowners.”
For decades, the Jersey shore has been a place where police officers, plumbers, teachers and other working-class families can save up and put a down payment on a small beach bungalow to spend their summers “down the shore,” as it is called. In many cases the properties are passed down through families.
Even before Sandy tore the Kiernans’ home down to a wooden shell, it was not the palatial estate conjured by the phrase “vacation home.” But even then the modest 1,000-square-foot house had been a financial stretch — the family skipped dinners out and vacations to be able to afford it.
The sacrifice has been worth it, Kiernan said. The shore is where their grandchildren played, their four daughters packed in with their friends and the couple was considering moving full time because they viewed the community as a second hometown.
“It was low-key fun,” Kiernan said.
But the little house offers mostly heartache now. The Kiernans received about $100,000 from their insurance company, but that’s less than half of the amount of their policy and nowhere near enough to pay the mortgage and shoulder the cost of demolishing and rebuilding.
“This was our investment,” John Kiernan said as his wife wiped away tears.
Even tearing down the house and selling the lot is no easy way out — while homes have been selling on the Jersey shore, values are not what they were before the storm.
“Do I build it, do I leave it? I can’t even sell the property because properties have been downgraded that much,” he said.
Second homeowners are not eligible for a suite of relief options available to primary homeowners. Federal Emergency Management Agency rebuilding assistance, $1.8 billion in rebuilding funds the U.S. Department of Housing and Urban Development gave to New Jersey or low-interest loans from the Small Business Administration. Second homeowners will also see their flood insurance rates go up because they are not grandfathered in like primary homeowners.
In Lavallette, the skeleton of Cora Hoch’s sea glass-colored vacation bungalow remains, its foundation tipped, wiring exposed, doors missing and “do not enter” spray-painted on the side.
“We put our life savings into that little house,” said Hoch, a school nurse from Kearny, N.J. “We can’t afford to fix it, and FEMA will not give us anything.”
FEMA said the assistance money is meant to be a one-time stopgap measure to help people get back into their primary homes as soon as possible. Congress, FEMA said, set the rules.
“It was designed for those who don’t have a roof over their head or a place to live,” said Tom McDermott, a FEMA mitigation specialist. “I guess they said if they can afford a second home or a camp, and don’t take this the wrong way, it isn’t necessary that they get back up so they can enjoy a weekend or a week away.”
Second homeowners said the problem is that insurance doesn’t fully cover the price of the options for these homes. Rehabbing and, in many cases, lifting them or demolishing them and rebuilding from scratch.
“Everybody is in limbo because you can’t proceed to the next step,” said Benita Kiernan, whose neighborhood is now a patchwork of vacant damaged homes, freshly leveled lots and small ranch homes boosted up on stilts in an effort to keep them out of the water the next time a massive storm strikes.
Many are waiting to see if they can qualify for any other assistance, but aside from private charities there is little help. Some are dipping into their retirement funds.
Michelle and John Novella are rebuilding their Stafford Township home on their own, putting everything on credit cards.
“First homeowners should be the priority,” Michelle Novella said, but she feels second homeowners who patronize the seasonal businesses and make up the lifeblood of the Jersey shore should get something.
“Otherwise,” she said, “it’s going to make the Jersey shore very different.”
Follow Katie Zezima at www.twitter.com/katiezez
|
cc/2021-04/en_middle_0021.json.gz/line2066
|
__label__cc
| 0.630808
| 0.369192
|
Car Rental United Kingdom
Car Rental llanelli
Why rent a car?
The best way to discover Llanelli is by renting a car. Renting a car is easy and affordable way of transportation. With your rent a car you can explore the beautiful surroundings of Llanelli. Rentalcargroup.com works with numerous rent a car companies in Llanelli.
A rental car for every occasion
Just for a visit or going to a meeting/convention with colleagues; There are several types of rental cars available for you. We can supply a rental car for 1 person or even up to 9 persons. Cheap economic cars or more exclusive cars; there will always be the right car of your choice.
Where to rent a car
Rentalcargroup.com offers car rental in more than 35000 locations, at all major airports and cities and railway stations. Below on this page you see a map with all the car rental companies we work with in Llanelli.
I am traveling abroad but I do not know how to get to my car rental destination
Most car rentals offer a GPS navigation system to navigate your way to your destination. It has an extra fee which is described in the terms and conditions. Please be advised as GPS navigation systems are subject to availability of the car rental companies.
Where to go with my rental car
When renting a car, you are free to drive wherever you want as long as you keep to the local traffic rules which can be different that you are used to. Always keep to the maximum speed limit and be a responsible driver. Watch out if you want to cross the border into another country as there might be restrictions and/or extra fee's to be paid. If you want to take the car on a ferry, please always check with the local car rental agent if this is allowed as not all car rental companies allow it or extra fees might be applicable.
Useful Information Llanelli
Near Llanelli
Popular car rental locations in United Kingdom
Belfast Airport
Glasgow Car Rental
London Airport
Rent a car companies in Llanelli
Facts about car rental in Llanelli
Last month, the average car rental length in Llanelli was 1 days.
The average rental car length in Llanelli is 6 days.
The most booked rental car type currently in Llanelli is COMPACT cars.
Last year, the most booked rental car type in Llanelli were COMPACT cars.
How much does it cost to rent a car in Llanelli? Last month, the average car rental price was 162 USD.
Last year, how much did it cost to rent a car in Llanelli? Last year, the average car rental price was 224 USD.
What is the current average daily price to rent a in Llanelli? Last month, the average rental price was 162 USD per day.
How much did it cost to rent a car in Llanelli over the past 12 months? Last Year, the average rental price was 35 USD per day.
The car rental companies available in Llanelli are: .
Llanelli Rental Car Reviews
See below last 5 customer reviews. Our customers rated LLanelli Car Rental with an average of 6 based on 10 ratings.
|
cc/2021-04/en_middle_0021.json.gz/line2067
|
__label__wiki
| 0.933283
| 0.933283
|
Toshiba completes acquisition of OCZ Storage
The Silicon Valley SSD maker is now part of Toshiba but will continue to operate independently
Martyn Williams (IDG News Service) 22 January, 2014 01:11
Toshiba has completed its acquisition of OCZ Storage Solutions, a failed Silicon Valley maker of solid-state drives, the company said Tuesday.
Solid-state drives are storage components built with flash memory that are intended to replace spinning disks in laptops, desktop computers and servers. They offer lower power consumption and better performance but are typically more expensive per gigabyte than hard drives.
OCZ said in November last year that it had defaulted on a loan agreement after its business was hit because it was having trouble buying enough flash memory chips for its drives.
Revenue had fallen to US$33.5 million in its most recent quarter, down from $88.6 million in the same period a year earlier. But despite the sharply lower revenue, its losses shrunk to $26.1 million from $33.2 million a year earlier.
At that time, Toshiba said it had offered to buy the company as long as it could maintain the value of its business and keep its employees.
Financial details of the acquisition were not announced.
OCZ will continue to operate independently and be based in San Jose, California. Toshiba is a major manufacturer of flash-memory chips, so it should be able to supply OCZ's SSD manufacturing operations with enough silicon.
The acquisition brings Toshiba OCZ's enterprise and client SSD customers, both markets it intends to keep serving, the company said in a statement.
Martyn Williams covers mobile telecoms, Silicon Valley and general technology breaking news for The IDG News Service. Follow Martyn on Twitter at @martyn_williams. Martyn's e-mail address is martyn_williams@idg.com
Tags Mergers and acquisitionsbusiness issuesmemorystorageSSDtoshibaComponentsDrivesOCZ Storage Solutions
|
cc/2021-04/en_middle_0021.json.gz/line2069
|
__label__wiki
| 0.583265
| 0.583265
|
Microsoft Edge can now auto-generate passwords, but only via phone
For now, the password auto-generation feature requires users to sign up for new accounts via phone, not PC
Mark Hachman (PC World (US online)) 17 December, 2020 06:17
Credit: Dreamstime
One of the benefits of Google’s Chrome browser is that when users create a new account on a website, it can generate a unique password, then store and autofill it when they visit the site again. Microsoft Edge will now do the same, though the process is much more complex and uses its mobile Authenticator app instead.
The new capabilities are part of a public preview of password management and autofill functions within the Authenticator app for iOS and Android, which already serves as a two-factor authenticator (2FA) solution for websites. Until now, however, you were required to come up with your own password for those sites, which Edge could store if you so chose.
Now, Authenticator can be used to generate a unique password, store it for you, and then autofill it when you visit the site again.
Still, it’s a bit of a clunky process. Within Chrome, for example, automatically creating a strong, unique password is very easy: Simply click the “password” text box when creating a new account. You’ll then have the option of allowing Chrome to suggest a strong, unique password—this works whether you’re using the Chrome desktop browser or Chrome for Android. Passwords are automatically created, stored, and saved.
By comparison, auto-generating passwords within Microsoft’s ecosystem only works via the Authenticator app within a mobile environment, at least for now. In other words, if you sign up with a new account, you’ll need to do so on a phone, not a PC.
Authenticator will then create the unique password, store it, and then sync it with your Edge browser for your desktop PC. (You can sync with Chrome, too, via this plugin.) The desktop version of Edge doesn’t include the password-generating feature yet.
In part, that’s because Microsoft believes that your passwords are best protected via 2FA, which cross-checks a device you’re known to own, like a phone (one-factor authentication) with a password you know (a second factor of authentication). And while that’s true, it’s also somewhat inconvenient for those without a phone handy or those who simply don’t want to stop working on their PC just to complete this minor task.
To enable this capability, you’ll need to make Authenticator an autofill provider on your phone:
iOS: Open Settings —> Search for “Autofill Passwords” —> Click on “Autofill Passwords” —> Select “Authenticator”
Android: Open Settings —> Search for “Autofill” —> Select “Auto-fill service” —> Click on “Auto-fill service” on next screen —> Select “Authenticator”
There’s one more hitch, too. For now, the default setting is that this new password-generating capability is turned off for those who use Authenticator as a 2FA solution for enterprise accounts.
So if your employer’s IT department makes you use Authenticator as a 2FA solution to secure your work email, this public preview of Authenticator won’t allow you to use the password-generating feature without a special set-up.
As you can see, this preview of Authenticator is useful—but it’s also accompanied by some rather strict shortcomings. Over time, we hope to see automatic password generation more closely integrated within Edge, across the phone as well as the PC.
Tags Microsoft
|
cc/2021-04/en_middle_0021.json.gz/line2070
|
__label__wiki
| 0.74708
| 0.74708
|
Single: The Skids/Borrowed Time
on February 16th, 2019 at 20:28
Posted In: Gigs, Reviews, Ross
The Brook, Southampton
It’s a mild February night in Southampton as The Brook plays host to one of Punk’s leading lights, Dunfermline’s finest The Skids. A brief unplanned detour down the M27 means we miss the first 20 minutes of support act Borrowed Time’s set. We catch them playing “No Way Hostile” and it’s deafening – admittedly we are by the speaker! The Brook stage is so overloaded with kit frontman Rob is finding it difficult to move. His knee jerks and jumps seem to be confined to one foot square around him. His voice, however, is crystal clear. Borrowed Time play 2nd Wave Punk and take no prisoners. Their all-round sound is tight; complimented by two guitarists (Cliff and Glenn) and Elmer (drums) who keeps a furious beat in the engine room, not forgetting Steve (bass) of course. “Minute to Midnight” precedes the brilliant “Day We Broke The World”. It’s a chunky bass-driven number with a catchy yet anthemic chorus. Rob ventures down into the pit area, but on arriving there hasn’t realised the height of the stage for his return. A punter gives him a leg-up as they depart on their self-titled “Borrowed Time”. Elmer takes centre stage this time and they leave to good applause.
Borrowed Time 1–2–3–4
At bang on 9pm The Skids stride onstage one by one. Richard Jobson (vox) arrives last with a beaming grin and rabble-rouses this Southampton crowd into action. They open with a note-perfect ‘Animation” before Jobson beckons us to get more involved. His wishes are heeded as the crowd comes alive. “Of One Skin” gets a few punters moving before ‘Charade’ gets the desired reaction. Once again Jobson enthuses their return to these parts and describes how the set will contain some new and old, beginning with recent single “Kings of The New World Order”. Again Jobson celebrates the achievement of securing the number 2 chart position of their recent album, bettered only by one Leo Sayer – a mixed bag of groans and banter follow. Jobson is in a playful mood tonight but less talkative than their previous visit some two years previously. Ok; so we get the now well-rehearsed Top of The Pops story, but one canít blame him for grabbing a breather.
“One Last Chance” soon follows before they return to the older material. The humorous band introduction then takes place before they launch into crowd favourite “The Saints are Coming”. He harmonises and gets everyone singing in unison before launching into the song proper – this crowd reacts with wild abandon. At the end, we are encouraged to perform another singalong of the chorus. Cue more grins from the stage as they are now in full swing. He then talks of the relevance even today of the next song “Working For the Yankee Dollar”, and amends the chorus to “Working For the Virgin Dollar”. With this enthusiastic crowd now in full voice Jobson asks for assistance with the chorus of “Hurry on Boys”, and we don’t disappoint him. Staying with the harmonising “A Woman in Winter” is a wonderful prelude to a haphazard “Circus Games”.
The Skids 1–2–3–4–5–6–7
They are now in the zone as they hit us with the biggies. “Masquerade” sees an energetic reaction before an explosive “Into the Valley”, where this venue quite literally comes alive. An anthemic “Out of Town” follows as the hits keep on a coming, and ‘Happy To Be With You’ is more than apt. It’s at this point that Jobson says “it’s time for a bit of cabaret”. He asks for requests before Simpson (bass) bellows the opening lines of “TV Stars”. It’s a popular choice as Jobson amends the lyrics to include current MP’s. However what follows next is totally unexpected. A Punk mash-up in the shape of Pistols/Buzzcocks covers. A shortened version of “Pretty Vacant” precedes a tribute to Mr. Pete Shelley in the form of “What Do I Get”. It’s a popular choice as the band depart the stage leaving Jobson to conduct one more chorus of “Saints”. Then rather amusingly he has to be guided by the guitar tech to the stage exit!
Loud calls see the band return for a two-song encore. Live favourite ‘The Olympian’ sees this Brook crowd go wild one more time before they decide to play “Saints” once more. A chap behind me shouts “we’ve heard this one”, but the remainder of this audience seem happy. As the band departed with a bow Jobson is at pains to thank us for all coming to the show and looks forward to their return. And with an acoustic album in the pipeline, it will be interesting to see how this comes across in the live arena. But for now, we all leave drenched in sweat from what was a monumental Skids show that had a bit of everything. Which begs the question, why weren’t they touring 10 years ago? It would appear that The Skids love playing in Southampton and if their legacy is that the local football team come onto the pitch to one of their songs, then that in itself is a worthy achievement. I had heard on the grapevine that this is to be their last “full electric” tour. If that’s the case then I’m mighty glad I came tonight. This show I feel will live long in the memory for many.
Borrowed Time
Standed
No Way Hostile
Minute to Midnight
The Day We Broke the World
The Skids
Of One Skin
Kings of the New World Order
The Saints Are Coming
Working for the Yankee Dollar
Hurry On Boys
A Woman in Winter
Into the Valley
Pretty Vacant (Sex Pistols cover)
What Do I Get? (Buzzcocks cover)
The Olympian
http://www.the-skids.com
https://www.facebook.com/borrowedtimepunk/
Words by Ross A Ferrone
Pictures & Videos by David Chinery (Chinners)
|
cc/2021-04/en_middle_0021.json.gz/line2077
|
__label__wiki
| 0.556274
| 0.556274
|
Cement Overview
The cement industry is the building block of the nation's construction industry. Few construction projects can take place without utilizing cement somewhere in the design. Annual cement industry shipments are currently estimated at $7.5 billion for 2012; up from $6.6 billion in 2011.
Cement Encyclopedia
IntroductionHistorical Background and Scientific FoundationsImpacts and IssuesBibliographyCement is a rocky powder that can be mixed with water and molded to any desired shape, after which it hardens to a rock-like consistency. It is used worldwide both as a mortar to join bricks and blocks together and as an ingredient of concrete, which is mixture of crushed rock, sand, and cement that is used to construct buildings, bridges, roads, pipes, dams, and other structures. Cement manufacture releases large amounts of carbon dioxide (CO2), the most important greenhouse gas. The cement manufacturin
Cement Wikipedia
OverviewCement industry in the worldHistoryModern cementsSetting, hardening and curingSafety issuesEnvironmental impacts
In 2010, the world production of hydraulic cement was 3,300 million tonnes (3.2×10 long tons; 3.6×10 short tons). The top three producers were China with 1,800, India with 220, and USA with 63.5 million tonnes for a total of over half the world total by the world's three most populated states. For the world capacity to produce cement in 2010, the situation was similar with the top three states (China, India, and USA) accounting for just under half the world total capacity.
Wikipedia · CC-BY-SA 许可下的文字
Information about the US Cement Information
Aug 30, 2009· The cement industry statistics and facts are described. Of the 100 cement plants in operation in 37 states, the top five cement companies in terms of volume produce 51.2% of the cement in the U.S. Over 80% of the cement capacity in the country is owned by foreign companies. Annual cement shipments are worth over $10 billion per year. In terms of volume, the U.S. uses over 100
A Note on Cement 2 Probe42-Probe Information
Jul 15, 2020· A Note on Cement 2. July 15, 2020. Vijay S. no comments. India is the second-largest cement producer in the world with the installed capacity of 509 MTPA and accounts for over 8.0% of the global installed capacity. A total of 210 large cement plants together account for 410 MT of installed capacity in the country, while 350 mini cement
Cement Market in the U.S. 2020-2025: Market Size and
Jun 15, 2020· Cement Market in the U.S. 2020-2025: Market Size and Volume, Domestic Production, Exports and Imports, P Dynamics and Turnover
Cement Market Size, Share, Trends and Forecast to
Producing of cement is done by combining these key constituents in a rotary kiln at a temperature of 1450 ̊C which leads to the production of clinker, an granular intermediate which is
The cement industry at a turning point: A path toward
Like industries from aviation to financial servs, the cement business has been on a “big is beautiful” march over the past five decades. A rush of expansions, mergers, acquisitions, and consolidations has reshaped the industry. The model has not necessarily created value for companies or their investors.
How cement companies create value: The five elements of a
Know what’s really happening in the market. The CEO should begin by acquiring comprehensive
U.S. Portland Cement - Plant Information Summary
"The Wall" Impact on Cement Consumption, February 2017; Stronger Sentiment, Higher Interest Rates, January 2017; State Highway Paving, January 2017; Monitor Outlook Plus; Construction InVue; More Reports. U.S. Cement Annual Yearbook; U.S. Portland Cement : Plant Information Summary; Competitive Materials Report; Labor-Energy
Jul 15, 2020· Cement production in India increased from 230 MT in 2011-12 to 337 MT in 2018-19. The majority of the Indian cement industry constitutes domestic companies, however, the Indian cement industry has some multinational giants including Holcim and Lafarge, which have an interest in companies such as ACC, Ambuja Cement, and Lafarge Birla Cement.
Cement Manufacturing Sector Information Sector-Based
While the Cement Manufacturing sector is exploring and beginning to implement less polluting means of producing cement, Portland cement remains the industry’s primary product and a key component in the making of concrete. Portland cement is the generic term for a fine gray powder that binds sand and gravel into concrete. It is produced by
Cement powder can cbe ategorized as hydraulic and non-hydraulic cements among which hydraulic cements contributes to over 95% of the global cement market, portland cement an example of hydraulic cement is the largest contributor to the global cement industry., The continuously growing population which is leading to the increasing need for the
Cement & Concrete Product Manufacturing Insights
The US industry is fragmented: the top 50 companies account for about 45% of industry revenue. Products, Operations & Technology Major products include ready-mix concrete (about 50% of industry revenue), cement (15%), concrete block, brick, and pipe (15%), and items such as concrete beams, girders, and wall panels.
Cement Statistics and Information USGS.gov
Cement Statistics and Information. Subscribe to receive an email notification when a publication is added to this page. Monthly Publications. Mineral Surveys. Cement PDF Format: 2020: Jan Feb Mar Apr May Jun Jul 2019
mobile crushing station india 4mw5v5 crusher
mining equipment for sale in rajasthan
mining hammer mill supplier
potassium feldspar united
ball mills to make glaes canada
rate of ball mill in delhi india
hp cone gold ore plant mfg in india
mobile crashing station peter
jaw crusher sudan svmho5 antique
wet magnetic separator for sale
ebay auction bucket screens and bucket crushers
jaw crusher shafting dan pitman
mining engineering inserv training 2013
well presentation on aggregate crushers ksa
impact crusher schematic diagram coal russian
grinders machines gold
4 6l h capacity spiral chute
statistic statistic research topic in mineral processing
effect of iron oxide in the beneficiation of bauxite
tantalite ore analysing equipment
|
cc/2021-04/en_middle_0021.json.gz/line2080
|
__label__wiki
| 0.811973
| 0.811973
|
Feed-O-Matic
Transports&Streets
Subway and trains
Phot-O-Matic
Services > Feed-O-Matic > 89849 🔗
Sunday 10 January 2021 07:01
Rome's new bins get thumbs down from smokers
Rome unveiled new-look bins at the Pantheon but it seems that smokers are not happy.When Rome's mayor Virginia Raggi unveiled the city's new-look trash bins last month, many people were impressed and saw the new prototype as an improvement on the old 'transparent bag' variety.The bins were installed in the historic centre on an "experimental basis," against a backdrop none other than the Pantheon, with applause from the mayor. However rubbish collection is a serious matter in Rome and the new design soon courted mixed views from Romans. A noi piacciono. È proprio il nostro stile. pic.twitter.com/kCMpyqFyTs — TAFFO (@taffoofficial) December 15, 2020 Some suggested the bin evoked the shape of an ancient Roman amphora, others thought it resembled a funeral urn. The latest criticism of the bins comes from smokers who claim they have nowhere to put out their cigarettes. Rome rolls out new-look trash bins in the centre "It is already full of butts on the ground" comments the chairman of the environment committee in the city's central Municipio 1, Stefano Marin, who along with several other councillors from the centre-left Partito Democratico (PD) has put forward a motion calling for a redesign of the bins to accommodate the needs of smokers. The bins have been described by Rome refuse collection agency AMA as "sober and minimal." Critics suggest the bins are so minimal that they have no ashtray feature to allow smokers to extinguish cigarettes before disposing of them safely. The current version with the loose bags was introduced several years ago, replacing the old cast-iron bins, for security reasons in line with elevated anti-terrorism levels. However, as Raggi points out, these exposed bags often break, "causing the rubbish to fall to the ground." Rome to get new rubbish bins Apart from blowing in the wind, the main problem encountered by these bins has been the city's seagulls which peck away with ease at the bags. The design of the latest version of Rome's bins has taken years and this is the first model to meet the demands imposed by the police (for security), by cultural authorities (for aesthetic reasons) and by the refuse agency AMA (for practicality of rubbish collection). However it seems that smokers were not included in this criteria and now it looks like it could be a case of "back to the drawing board" to modify the design of the new bins before they are rolled out across the historic centre. Cover photo La Repubblica
#news #city
read the news on Wanted in Rome - Rome's local English news
When Rome's mayor Virginia Raggi unveiled the city's new-look trash bins last month, many people were impressed and saw the new prototype as an improvement on the old 'transparent bag' variety. The bins were installed in the historic centre on an "experimental basis," against a backdrop none other than the
, with applause from the mayor. However rubbish collection is a serious matter in Rome and the new design soon courted mixed views from Romans. A noi piacciono. È proprio il nostro stile.
pic.twitter.com/kCMpyqFyTs
— TAFFO (@taffoofficial)
Some suggested the bin evoked the shape of an ancient Roman amphora, others thought it resembled a funeral urn. The latest criticism of the bins comes from smokers who claim they have nowhere to put out their cigarettes.
Rome rolls out new-look trash bins in the centre
"It is already full of butts on the ground" comments the chairman of the environment committee in the city's central Municipio 1, Stefano Marin, who along with several other councillors from the centre-left Partito Democratico (PD) has put forward a motion calling for a redesign of the bins to accommodate the needs of smokers. The bins have been described by Rome refuse collection agency AMA as "sober and minimal." Critics suggest the bins are so minimal that they have no ashtray feature to allow smokers to extinguish cigarettes before disposing of them safely. The current version with the loose bags was introduced several years ago, replacing the old cast-iron bins, for security reasons in line with elevated anti-terrorism levels. However, as Raggi points out, these exposed bags often break, "causing the rubbish to fall to the ground."
Rome to get new rubbish bins
Apart from blowing in the wind, the main problem encountered by these bins has been the
city's seagulls
which peck away with ease at the bags. The design of the latest version of Rome's bins has taken years and this is the first model to meet the demands imposed by the police (for security), by cultural authorities (for aesthetic reasons) and by the refuse agency AMA (for practicality of rubbish collection). However it seems that smokers were not included in this criteria and now it looks like it could be a case of "back to the drawing board" to modify the design of the new bins before they are rolled out across the historic centre. Cover photo La Repubblica
most readead
English language bookshops in Rome
⤷ back to Feed-O-Matic
©1999-2021 Roma-O-Matic
This site uses technical cookies, including from third parties, to improve the services offered and optimize the user experience. Please read the privacy policy. By closing this banner you accept the privacy conditions and consent to the use of cookies.
|
cc/2021-04/en_middle_0021.json.gz/line2081
|
__label__cc
| 0.535715
| 0.464285
|
ABOUT THE RYSK GROUP:
Facebook. Equifax. Yahoo. Cambridge Analytica. Uber. eBay. Target. Chase. Playstation. What do these companies have in common? They were all victims of some of the biggest cyber security breaches and attacks in the last decade.
Cyber Security might just be a trending buzz phrase to some, but our team lives, breaths and executes cyber and information security on a daily basis. Formed by a group of security engineers with over 30 years of combined experience working with both private corporations and government agencies in the areas of cyber security, networking, infrastructure and systems and networks administration, The Rysk Group has the experience needed to not only respond to security threats and breaches, but also mitigate their effects on your company and, in some cases, even prevent them altogether.
Cyber criminals, malicious insiders, foreign governments, business rivals, "hack-tivists", and even curious individuals with technical knowledge, all present a threat. And now that cyber crime has become a multi-billion dollar enterprise, threats to the business world are only becoming more common and malicious.
The most effective way to mitigate this threat is through a three-tiered approach: end user-training, regular backups, and effective ingress filtering, and The Rysk Group is here to help your company implement this defense. In infosec, there is always a new threat on the horizon, and we diligently study the risk environment so we can provide you with effective, timely and necessary solutions.
Know Your Rysk. Reduce Your Rysk. Call The Rysk Group today.
RELEVANT NAICS CODES:
CHRISTOPHER MELIA
Managing Partner/Principal Security Engineer
chris@ryskgroup.com
| 866.797.5699 Ext 701
Mr. Melia is the Managing Partner and Principal Security Engineer at The Rysk Group. Prior to founding The Rysk Group, he worked as Principal Cyber Engineer for Raytheon and was assigned to the joint NOAA/NASA Polar Satellite System program. As a member of the C3S segment, he was responsible for ensuring confidentiality, integrity, and availability of communications between geographically separated data centers, ground stations, and weather satellites.
He also served as an Information Assurance/Computer Network Defense Engineer for the US Army in Bagram, Afghanistan, and held a DISCO TS/SCI security clearance. Additionally, he served as Senior Network Engineer for Triple Canopy, whom he joined while working in support of Operation Iraqi Freedom. Mr. Melia supported US DoD and DoS programs throughout the Iraqi AO. He was also employed as the Senior Network Admin at the US Embassy in Baghdad, Iraq.
The Rysk Group has decades of combined experience in the Information Technology and Information Security fields. We are passionate about InfoSec, and only employ consultants who feel the same way.
Our consultants have earned the following technical certifications in addition to their experience, so you can be sure they are familiar with the subject matter:
GWAPT
Microsoft Systems Engineer
GPEN
Source Fire Certified Professional
CISCO CCNP - Security
Microsoft Systems Administrator
SUBSCRIBE TO OUR NEWSLETTER TODAY:
info@ryskgroup.com
OVER 30 YEARS OF EXPERIENCE...
...working with both private corporations and government agencies in the areas of cyber security, networking/infrastructure and systems and networks administration.
- Penetration Testing
- Remote Monitoring
- Security Engineering
- Security Integration
- Vulnerability Management
- Regulatory Compliance
- Incident Response
#KnowYourRysk
#ReduceYourRysk
© 2018 by The Rysk Group
|
cc/2021-04/en_middle_0021.json.gz/line2092
|
__label__cc
| 0.657773
| 0.342227
|
Beans and Pulses
Hoppin' John Recipe
Amethyst Ganaway
17 Printer-Friendly Version
A staple of the Southern table, Hoppin' John is famously eaten on New Year's Day, but is just as good any other day as well. This version features tender and earthy field peas cooked with fluffy rice and rich and smoky ham hocks.
[Photographs: Jillian Atkinson]
There are a lot of stories behind Hoppin’ John, and probably even more versions of the recipe. I grew up in the Deep South, where Hoppin’ John—a dish made with rice and peas—was always served on New Year's Day alongside our greens and cornbread. But it wasn’t relegated to just that one day of the year.
While Hoppin' John was meant to bring prosperity and good luck for the New Year, one-pot rice dishes made with just about anything were a part of the table on a regular basis, and cowpeas of all sorts were always in our diets. I didn’t find out until I got much older that cowpeas aren't familiar to most people outside of the Deep South. It also wasn't until I got older that I realized the Hoppin’ John I grew up eating and what other people call Hoppin' John are vastly different.
Not only had I never had the dish made with the black-eyed peas many use, but I’d never had it not made with the rice, meat, and peas all cooked together. Plain boiled rice with peas on top was just...rice with peas on top, and mixing them in together after the fact just seemed like it defeated the purpose of making them separately.
I’d also noticed that we—people from the Low Countries of Georgia, South Carolina, and other nearby areas—made rice that had more color to it because we used field peas to make our Hoppin’ John. Often called “Southern peas,” field peas are black-eyed peas' close cousins; both are types of cowpeas, though the naming and classification can get confusing since different regions use the terms differently, and frequently interchangeably.
But to me, they aren't all the same. The brownish red skins of the field peas I grew up with provide a beautiful almost ruddy color to the rice, and their flavor is a bit sweeter and more nutty than that of black-eyed peas. Cooking them all together with a flavorful broth made from smoked meat and aromatics imparts impactful taste into whatever long grain white rice you choose to use.
It took some time for me to learn there was a reason why most people now use black-eyed peas instead of field peas. During the Great Migration out of the Deep South by Black folks, people still carried their traditions, even when they couldn’t carry the ingredients. Cowpeas of all shapes, sizes, and colors are found across the country, but these very specific field peas were only found in the South. So when the people moved, they adapted and used a different, although familiar, replacement in the form of the black-eyed pea.
Over the years, I’ve seen other adaptations, in which people make the classic dish their own way to fit their lifestyle. Some people swear by bacon in their Hoppin’ John, and while I don’t feel it’s necessary given the smoked meat already in there, you should feel free to add some rendered crispy bacon at the end while you fluff the rice, so that a bit of its crunchy texture remains. Or you can use bacon in place of the smoked ham hock called for in the recipe, or add them both together! I didn’t grow up eating much or any pork at all, so we used smoked turkey (necks, tails, wings, whatever you could find) instead of the ham hock or salt pork often found in recipes, and we'd add beef bacon (or no bacon at all) instead.
I’ve even seen vegetarian versions done that don’t include any smoked meat at all, and instead the the grains and legumes get their flavor from simmering the peas in vegetable broth.
My recipe starts by slow cooking the smoked meat in water so that it falls apart tender and leaves a broth that is not only deep and rich, but will make your entire house smell great. Then I cook the peas in that same broth with only a few seasonings and spices. The final step is adding parboiled rice and cooking the dish in the oven until the rice is fluffy, each grain dry enough to keep all the ingredients separate but still tender.
Even I haven't mastered the art of making Hoppin' John with the traditional Carolina Gold rice, which needs to be cooked differently than your average medium- or long-grain rice you find in the stores. I've found parboiled rice is one of the best options for fluffy grains that are tender but still dry enough not to glue together.
To that end, I also use the oven for the final stage of cooking. Even after years of practice, I still can't reliably do the entire process on the stovetop, where my rice sometimes turns to mush—something I am sure many, many grannies and aunties would shamefully shake their heads at me for. The oven, thankfully, delivers a more gentle heat that cooks the rice through from all sides without the risk of scorching or requiring any stirring or overcooking that could release starch and push the Hoppin' John in the direction of what we call a “bog." It also steers the rice clear of developing a soupy or risotto-like consistency where the grains are more wet and more liquid is left in the pot.
This recipe feeds six to eight people easily, and while it could be scaled down, it is a dish usually served with friends and family, especially during the holidays. The more you make (and eat), the more prosperity you’ll have in the New Year.
Using parboiled rice shortens the cooking time and ensures grains cook up fluffy, not sticky.
Cooking the beans and meat with the rice infuses flavor into every grain.
Read more: The Historic Problem With Hoppin' John
Yield:Serves 6 to 8
Total time:5 hours, plus overnight soaking
Rated: 3.625
1 smoked ham hock (about 1 1/4 pounds; 565g)
1 medium (8-ounce; 225g) yellow onion, peeled, quartered, and root end trimmed
1 1/2 cups (9 1/2 ounces; 270g) dried field peas (cowpeas), preferably not black-eyed peas, rinsed, picked over for debris, and soaked overnight (see note)
1 tablespoon Diamond Crystal (12g); for table salt use half as much by volume or the same weight
1 1/2 cups (10 ounces; 280g) uncooked parboiled long-grain white rice
In a 5-quart Dutch oven, combine ham hock, bay leaves, and quartered onion, and top with 3 quarts of water. Set over high heat, bring to a boil, then cook at a boil for 5 minutes. Reduce heat to maintain a gentle boil, cover with the lid slightly ajar, and cook until the ham hock is fork-tender, about 3 hours; top up with boiling water as needed to keep the ham hock covered. Discard bay leaves. Transfer ham hock and onion to a heatproof plate or bowl to cool. Measure 2 quarts (1.9L) broth and return it to the Dutch oven; save any remaining broth for another use.
Pull ham hock meat and skin from the bones. Roughly chop up any larger pieces, then return meat, skin, and bones along with the onion to the pot.
Drain field peas from soaking water, rinse, and add to the pot.
Add salt, pepper, garlic powder, and onion powder. Set over high heat and return to a boil. Lower heat to maintain a gentle boil, cover with the lid slightly ajar, and cook until peas are al dente, about 45 minutes. About 15 minutes before peas are al dente, preheat oven to 350°F (175°C). Add parboiled rice to pot, stir to combine, then return to a full boil over high heat and cook for 1 minute, then turn off heat.
Stir the pot well to incorporate the ingredients, cover fully with lid, and cook in oven for 30 minutes. Remove from the oven and let rest, covered, for 5 minutes.
Fluff with a fork, and serve right away.
There are many sources for field peas, but two good options available online are the ones from Anson Mills and Camellia. We recommend soaking beans in water salted with 1 tablespoon of kosher salt per quart.
Make-Ahead and Storage
Hoppin' John can be refrigerated in an airtight container for up to 5 days. Reheat in an oven-safe dish, covered, in a 325°F oven until warmed through.
More American Recipes
Ultra-Smashed Cheeseburgers
Pure and Simple Slow-Cooked Boston Baked Beans
Sous Vide Buffalo Chicken Wings
Hasselback Potato Gratin
Western Omelette With Bell Pepper, Onion, Ham, and Cheese
View All American Recipes
More Bean and Pulse Recipes
British-Style Beans on Toast
Easy French Lentils With Garlic and Herbs
Quick and Easy Pressure Cooker Chicken, Lentil, and Bacon Stew With Carrots
The Best Barbecue Beans
View All Bean and Pulse Recipes
More Pork Recipes
Frijoles Charros (Mexican Pinto Beans With Bacon and Chilies)
Sous Vide Carnitas for Tacos (Crispy Mexican-Style Pulled Pork)
Juicy and Tender Italian-American Meatballs in Red Sauce
The Best Japanese Pork and Cabbage Dumplings (Gyoza)
No-Waste Tacos de Carnitas With Salsa Verde
View All Pork Recipes
The Historic Problem With Hoppin' John
For over a decade, Amethyst has been working her way through the food and beverage industry. While earning her BA at the University of South Carolina, the North Charleston native began her career in restaurants as a server and cashier. After making her way through various corporate and fine dining management positions, Amethyst's resume now includes recipe development, catering, and food writing. So far, she has been published in Eater, Food and Wine, Plate Magazine, and The Post and Courier. In 2020, she was awarded the Les Dames International Legacy Culinary Award.
Show 17 Comments
The Best Yorkshire Pudding
Tall and light with a crisp shell and a lightly chewy center.
|
cc/2021-04/en_middle_0021.json.gz/line2103
|
__label__wiki
| 0.876431
| 0.876431
|
Barbara Walters on The View: We love Elisabeth
by Deirdre Kaye
Deirdre Kaye
Deirdre's Most Recent Stories
Who Is Irina Shayk? Everything to Know About Bradley Cooper’s Ex-Girlfriend?
Sarah Hyland Can Sing Like a Bird, but She’s Not the Only Actress With Pipes
Celebrate The Bachelorette Season 13 Premiere with Our Epic Drinking Game
March 11, 2013 at 11:33am AM EDT
It seems only Barbara Walters really knows what’s going on at The View.
“We have no plans for Elisabeth to leave the show,” Barbara Walters announced a mere 10 minutes into the show. “But right now the only person who can’t leave the show is me.”
Related story To Meghan McCain & Every Other Mom Returning to Work: It Gets Easier, Or You Get Stronger
The rumors flew last week as The View said a possible goodbye to multiple members of the shows… or did they? Joy Behar had the only official announcement that she was leaving, though it wasn’t particularly surprising — she’s been with the show for 16 years. On the heels of that announcement came the rumor that Elisabeth Hasselbeck was also on her way out of the door. Since no official announcement was made, no official reason was given.
However, the people at Us Weekly believed she was axed due to The View‘s drop in viewership, which many believe is connected to Hasselbeck’s ultra-conservative viewpoints. There were even rumors that Barbara Walters herself might be on the way out.
The View goes toe-to-toe with Chris Brown: Sounds dangerous! >>
As for the rumors about Elisabeth’s departure, she also told the audience and viewers, “The truth is we love Elisabeth, I like her personally and she’s just a wonderful person. But, beyond that we value and appreciate her point of view. It’s important to us because Elisabeth helps gives this show perspective and balance.”
The gossip never seemed all that legitimate. After all, they were also reporting that actress Brooke Shields was slated to take over for either Behar or Hasselbeck. Shields did an excellent job at the table while Walters was out sick with chicken pox. However, Shields is already pretty busy with her new role on Army Wives.
A pox upon her! Who gave Barbara Walters the chicken pox? >>
Luckily for all of us, Barbara Walters was there to clear things up for everyone!
|
cc/2021-04/en_middle_0021.json.gz/line2108
|
__label__wiki
| 0.964928
| 0.964928
|
Local HubsCrimePoliticsHealthBusinessVoicesUK NewsEnvironment
EducationFeaturesNostalgiaPropertyTransportFarmingMotorsWorld NewsDual The A5Sponsored articles
Find news for your town
‘Breakthrough’ personalised cancer treatment rejected for NHS use
UK NewsPublished: Aug 28, 2018 Last Updated: Aug 28, 2018
Personalised cell therapy which re-engineers a patient’s own immune cells to fight cancer is not recommended for NHS use.
A âÂÂnew generationâ cancer therapy has been rejected for widespread NHS use (PA)
A “new generation” cancer therapy has been rejected for widespread NHS use by health officials.
The National Institute for Health and Care Excellence (Nice) published draft guidance stating that axicabtagene ciloleucel, also known as Yescarta, is not recommended for NHS use for patients with aggressive sub-types of non-Hodgkin lymphoma.
The treatment, created by Kite Pharma – a subsidiary of Gilead Sciences – is a personalised cell therapy which re-engineers a patient’s own immune cells to fight cancer.
The Institute of Cancer Research, London (ICR), and the blood cancer research charity Bloodwise said the news was “disappointing” for patients.
NICE has made an early recommendation that a CAR-T therapy treatment should not be available on the NHS for lymphoma patients, saying that there are still questions over its effectiveness and cost.We hope that these issues can be addressed.Our response:https://t.co/vr8WBHEgm2
— Bloodwise (@bloodwise_uk) August 28, 2018
The ICR said the treatment was a “major advance in cancer treatment” which has cured some patients who would otherwise have died.
The treatment is the first of a new line of chimeric antigen receptor T-Cell (CAR-T) therapies which are specifically manufactured for each individual patient.
It involves taking some of the patient’s own white blood cells which are then re-engineered in a laboratory so they can recognise and attack cancer cells before being infused back into the patient.
The treatment is for patients with aggressive forms of non-Hodgkin lymphoma, including relapsed or refractory diffuse large B-Cell lymphoma and primary mediastinal large B-cell lymphoma, after they have already had two or more different types of treatment.
Bloodwise said that these patients currently have a very poor chance of survival when treated with intensive chemotherapy – current standard treatment in the UK.
Kite Pharma said that in clinical trials, 72% of the patients responded to therapy and 51% went into complete remission.
But Nice said that there is no direct data to compare it with the current standard treatment of salvage chemotherapy.
It said that cost of axicabtagene ciloleucel was also too high for it to be considered a cost-effective use of NHS resources.
The health body also considered whether the treatment should be made available to patients through the Cancer Drugs Fund, but concluded that the therapy would not be cost-effective under the scheme.
Meindert Boysen, director of the centre for health technology evaluation at Nice, said: “CAR-T is an exciting innovation in very difficult-to-treat cancers, with a promise of cure for some patients.
NEWS: ICR responds to @NICEcomms decision about CAR T immunotherapy for non-Hodgkin lymphoma https://t.co/5DuqXb8Lae pic.twitter.com/70n9jezgFN
— The ICR (@ICR_London) August 28, 2018
“We have been working with the companies involved, and with NHS England, with the aim of ensuring that patients in England are among the first to have access to these new treatments in Europe.
“Although promising, there is still much more we need to know about CAR-T, and unfortunately, in this case, we are not able to recommend axicabtagene ciloleucel for use in the NHS in England at the cost per patient set by Kite Pharma.”
Hilary Hutton-Squire, general manager, Gilead Sciences UK and Ireland, said: “Yescarta is a new generation of innovative cell therapy that is bringing a new option to patients who, in many cases, have run out of treatment options and literally have months to live.
“Our priority is to make axicabtagene ciloleucel available to patients in the UK as soon as possible, and as such we believe we will soon be able to reach an agreement.”
Commenting on the news, Professor Raj Chopra, head of cancer therapeutics at the ICR, said: “It’s disappointing that patients with non-Hodgkin lymphoma who have exhausted all other treatment options will not be able to access CAR T cell therapy – a brand new type of treatment for blood cancers.
“CAR-T cell therapy uses a patient’s own genetically modified immune cells to target their cancer.
“The technique is complex and expensive, but it is also a major advance in cancer treatment that has cured some patients who would otherwise have died.”
Dr Alasdair Rankin, director of research and patient experience at Bloodwise, added: “It’s extremely disappointing that people with advanced and highly aggressive blood cancers might not be able to access this breakthrough treatment that offers the genuine chance of a cure.
“CAR-T therapies are an entirely new type of treatment and are expensive, so it understandable that there will be a number of uncertainties and questions that need to be answered.
“We hope that over the coming weeks the NHS and the pharmaceutical company can work to address these issues and agree on a price so that patients can benefit.”
More than 4,800 people are diagnosed with Diffuse large B-cell lymphoma or Primary mediastinal B-cell lymphoma each year in the UK.
NHS receptionist who died after contracting Covid went ‘above and beyond’
UK News | Jan 16, 2021
All UK adults to be offered coronavirus vaccine by September, Raab says
Coronavirus | 11 hours ago
Covid-19 patients admitted to hospitals in England ‘every 30 seconds’- NHS boss
Sorry, we are not accepting comments on this article.
People in Wales urged to follow lockdown rules as vaccine rollout continues
Four more coronavirus deaths at Shropshire hospitals
Shrewsbury | 14 hours ago
More vaccination centres due to open in Shrewsbury, Ludlow and north Shropshire in coming weeks, council chiefs say
Shrewsbury | Jan 16, 2021
Food review: Bon appetit to French delights
Weekend | 18 hours ago
Medics want laws updated to protect health workers from Covid-19 legal action
Coronavirus | Jan 16, 2021
Brazilian coronavirus variant likely to be in UK already, top scientist warns
Lessons learned after diabetic bled to death at Shropshire hospital
Mark Andrews: Dogged persistency, or just more Blunders?
Figures reveal huge drop in burglaries during Covid lockdown
Bridgnorth | Jan 16, 2021
Suspended sentence for underage drinker who left landlord with broken ribs
Newport | Jan 16, 2021
Drive to keep Paul in Ludlow delivers result
Ludlow | Jan 16, 2021
More from the Shropshire Star
Toby Neal: Balancing big fat lies with freedom of speech
In-depth | Jan 16, 2021
Mark Andrews: The unfortunate return of Piers Morgan, the buzzword 'rolling out', and buying cars made in Britain
Domestic abuse incidents in West Mercia increased in 2020, police say
Crime | Jan 16, 2021
Big Town Festival set to put Shrewsbury on national stage
34-bed care home near Oswestry to be turned into family home
Oswestry | Jan 16, 2021
David Walliams sends video support message for Shropshire pupils
Shropshire school to hold first ever virtual open day
Telford | Jan 16, 2021
Special needs services improving after damning report, council says
UK & International News
UK News | Less than an hour ago
|
cc/2021-04/en_middle_0021.json.gz/line2113
|
__label__cc
| 0.659459
| 0.340541
|
HPA019878 - Anti-PPA1 antibody produced in rabbit
HPA019878 Sigma-Aldrich
Anti-PPA1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1
Synonym: Anti-Inorganic pyrophosphatase, Anti-PPase, Anti-Pyrophosphate phospho-hydrolase
Human Protein Atlas Number HPA019878 Human Protein Atlas - View RNA & protein expression data of this target
Related Categories Alphabetical Index, Antibodies, PP-PQL, PP-PZ, Prestige Antibodies,
Prestige Polyclonal Antibodies, Primary Antibodies
product line Prestige Antibodies® Powered by Atlas Antibodies
conjugate unconjugated
clone polyclonal
biological source rabbit
application(s) immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500
species reactivity mouse, human, rat
enhanced validation independent
Learn more about Antibody Enhanced Validation
form buffered aqueous glycerol solution
shipped in wet ice
packaging antibody small pack of 25 μL
antibody form affinity isolated antibody
antibody product type primary antibodies
immunogen sequence GFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAK
UniProt accession no. Q15181
Gene Information human ... PPA1(5464)
PPA1 (Inorganic pyrophosphatase 1) is a 32kDa protein consisting of an aspartate-rich region. It is expressed in all the tissues and mapped on chromosome 10.
Inorganic pyrophosphatase recombinant protein epitope signature tag (PrEST)
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org) and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Biochem/physiol Actions
PPA1 (pyrophosphatase 1) facilitates hydrolytic conversion of pyrophosphate to orthophosphate. Study shows its tumor-specific protein expression in gastric cancer cells, thus, it has been suggested that PPA1 can be a potential tumor-specific marker in gastric cancers. PPA1 is also involved in the regulation of pancreatic ductal HCO3- secretion. In addition, it also controls anion exchange (AE) activity by activating CFTR (cystic fibrosis transmembrane conductance regulator)/pendrin at the apical membrane and inhibiting the basolateral AE by cAMP agonists.
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
Corresponding Antigen APREST74716.
NONH for all modes of transport
View Sample COA
Antibody Explorer
IHC Procedure (80 KB )
Protein Array Procedure (79 KB )
Western Blot Procedure (0 KB)
Antibody Basics
Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy
Prestige Antibody® Immunofluorescence Procedure
Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations
Prestige Antibody® Immunohistochemistry Procedure
Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays
Prestige Antibody® Protein Immunoblotting Procedure
Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot
Prestige Antigens™-Blocking Protocol
Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot
Western Blot Protocol | Immunoblotting Protocol
Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot
Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies
Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot
|
cc/2021-04/en_middle_0021.json.gz/line2115
|
__label__cc
| 0.688634
| 0.311366
|
Open for business. 5-25% OFF most kits - Start Shopping.
We're here to help. Call us!
We’re here to help. Call us!
Booster Brands Booster Brands
All Booster Brands
Cel-Fi Cel-Fi
All Cel-Fi
For Home / Building
For Enterprise, Commercial Grade
For Public Safety
HiBoost HiBoost
All HiBoost
Home Boosters
Industrial Boosters
Vehicle Boosters
SmoothTalker
SureCall SureCall
All SureCall
For Car / Truck / RV / Boat
For M2M
zBoost zBoost
All zBoost
Antennas Expansion Kit
Building Antennas
Vehicle Antennas
Lightning Surge Protectors
Splitters, Taps, Filters
Premium Accessories
Home › Will rollout of 5G network make 4G signal boosters obsolete?
Will rollout of 5G network make 4G signal boosters obsolete?
No it won't, because the frequencies that cell carriers operate on today will be still be used in the future. Cellular carriers have spent a fortune on 4G LTE frequency spectrums currently used for data, talk, and text, and many of these frequencies will still be used for the 5G technology platform. Plus, 4G LTE networks will still be used as backup, similar to the way 3G networks are still in use. Importantly, 5G networks will initially only be targeting wireless data transfer.
5G is a new complex and yet to be totally concluded standard. Initially, it will be deployed on new frequency spectrum such as 3.5gHz, 6gHz, 28gHz and even higher. Besides, all 5G phones will be backward compatible to 4G and therefore when there's no 5G signal, the 4G signal boosters are what will keep the wireless communication lines open. Therefore, go ahead and get yourself a cell phone booster now.
Things to know about 5G in relation to signal boosters:
These frequencies have much higher free air losses than the regular cellular bands and are going to be deployed in densely populated areas with antennas being in very close proximity to each other.
At this time, there is no provision in the FCC "Consumer Wideband Signal Booster" standard that would allow the boosting of these frequencies, so not allowed.
At this time, there are very few devices/ phones on the market which have such frequencies in them.
There is debate by many in the industry as to what benefit the "consumer" would have over the current 4G technologies and speeds, even though theoretical speeds might be much higher with 5G vs 4G, there are very few applications where it would be noticeable.
At Mobile World congress Barcelona approx 1 month ago, the experts and standards associations forecast that by 2025, there would be only 15% of connected devices using 5G which includes "data only devices" or "IOT devices" which are not smartphones.
It is unlikely that the Cellular carriers will move from 4G to 5G on the current frequencies for quite some time as their 4G equipment is very new and works very well, but at the point that they do, our current boosters will work with 5G in our current booster frequency bands.
Therefore, if you're considering getting a cellular booster for your signal reception problems now, our opinion is that you can go ahead and make your purchase to solve those problems immediately. Keep in mind that 5G will not be replacing 4G LTE for some time. Existing 4G LTE networks will still be here for many years to come, delivering applications and providing services side-by-side with the faster 5G network. Perhaps, sometime in the future, you will need to change it out, but you will still be able to use todays cellular boosters in the foreseeable future.
Problems Of 5G Expansion.
There's little doubt that explosion in expansion and development of cell phone networks over the past 20 to 30 years has reimagined the face of commerce and industry. To facilitate the endless communication of data for non-stop simultaneous transactions numbering in the billions or even trillions, wireless carriers have had to step up to introduce the technology to allow this to happen. While this has undoubtedly proved beneficial for businesses and consumers alike, it has added a new layer of problems and difficulties from a technological standpoint.
Continuous access requires 24/7 network accessibility, making it simply unacceptable for a network such as 3G, 4G, and now 5G to run into technical difficulties or to experience downtime. Businesses and consumers alike often shudder at the thought of the impact it would have on businesses and people's livelihood should services relying on wireless communications such as vending machines, ATMs, and even energy distribution systems, fail to run for an hour, let alone a whole day. The repercussions of even a relatively short period of downtime could prove disastrous on many levels.
There's an old saying that a chain is only as strong as its weakest link. Unfortunately, humans remain the weakest link when it comes to wireless technology. Although manual labor is seemingly not required to dispatch data and information across a wireless network, humans are still ultimately crucial for maintaining and overseeing wireless networks to ensure they continue to operate at their optimum capacity. No matter how rapidly technology continues to evolve, humans will almost always be the dreaded weakest link.
To fix the problem of human error, new technological devices are released into the market at an astounding rate. Each device seeks to promise the fastest and most reliable wireless communications, with each product and each overseeing company jostling for visibility and market share. Given the rate of technological advancement in the past few years, today's new technology is considered outdated within a few months and more or less rendered obsolete within a year or two. It can take something as simple as the change of ownership of a cell phone tower, an upgrade to a system, or a new type of interference from a radio signal to cause what was once state-of-the-art technology to lose functionality or fail altogether. Therefore, 4G LTE networks are here to stay for the next decade, and beyond.
Read more about 5G & AT&T's 5G-E and learn everything else there's to know about 5G.
Read Recent Blog Posts:
10 Easy Fixes To Improve Weak Cell Phone Signal
In addition to buying a cell phone signal booster, here're...
Cell Phone Signal Booster Plus Installation Bundle
If you're looking for a cell phone signal booster plus...
How Much & Which Building Materials Block Cellular & WiFi Signals?
Have you ever wondered how much do various kinds of...
Register Cell Booster
In-Building Installation Service
In-Vehicle Install Estimate
Carrier Approvals
Public Safety DAS
Indoor Installers
Outdoor Installers
Become Reseller.
Join Affiliate Program.
Sign up for Latest News:
Clearance kits.
Refurbished kits.
Open box kits.
Residential signal boosters sold online. Please contact us for exclusive deals on open box, refurbished, new and unopened commercial signal boosters for businesses and buildings.
© 2021 SignalBooster.com | Privacy | Terms | Retailer, distributor and installer of wifi & cell phone signal boosters, amplifiers, repeaters and extenders. Brands include SureCall, Cel-Fi, weBoost and WilsonPro by Wilson Electronics. Finance your kit. No interest financing available. Choose "PayPal Credit" or "Klarna" at checkout for details. Call 1-855-846-2654 or email sales@signalbooster.com if you need any help.
|
cc/2021-04/en_middle_0021.json.gz/line2116
|
__label__cc
| 0.602191
| 0.397809
|
Smart appoints General Counsel (Pensions and Financial Services)
Prior to joining Smart, Mark Howard spent 14 years at Clyde & Co.
Smart has appointed Mark Howard as General Counsel (Pensions and Financial Services). Prior to joining Smart, Mark spent fourteen years at city law firm, Clyde & Co., most recently as Head of Pensions, advising pension schemes, employers and pensions professionals in all areas of pensions and associated areas.
“Smart is an exciting company with a strong focus on technology, which is the direction the pensions industry is going in, I’m delighted to be joining a leader in this space and looking forward to the new challenge.”
Claire Altman, Chief Corporate Officer at Smart Pension, said:
“Mark is a great appointment to this new role. His extensive industry experience will be extremely valuable to us as we continue on our journey moving from an auto enrolment scheme to a workplace pension provider.”
About Smart
Smart is a global savings and investments technology platform provider. Co-founded in 2014 by Andrew Evans, Group CEO, and Will Wynne, Group MD, it is one of the UK's largest providers of workplace pensions. Its award-winning master trust, Smart Pension, is overseen by independent professional trustees.
In 2020 Smart Pension was named Master Trust Offering of the Year at the Pension Age Awards. Other awards include DC Master Trust of the Year, DC Innovation of the Year and Retirement Innovation of the Year in the 2019 UK Pensions Awards. Smart Pension was also named European Pension Fund of the Year 2019 in the European Pension Awards.
Legal & General Investment Management (LGIM), J.P. Morgan, Link Group, Natixis Investment Managers and Barclays are all investors in Smart.
We tweet as @SmartPensionUK.
For media enquiries
Contact the Smart press office on 020 8016 2553 or email pressoffice@smartpension.co.uk
|
cc/2021-04/en_middle_0021.json.gz/line2121
|
__label__wiki
| 0.902592
| 0.902592
|
Rio 2016 Olympic Games: 'Super bacteria' found in Rio water
Updated June 11, 2016 — 9.47pm first published at 9.42pm
Scientists have found dangerous drug-resistant "super bacteria" off beaches in Rio de Janeiro that will host Olympic swimming events and in a lagoon where rowing and canoe athletes will compete.
The findings from two unpublished academic studies seen by Reuters concern Rio's most popular spots for tourists and greatly increase the areas known to be infected by the microbes normally found only in hospitals. They also heighten concerns that Rio's sewage-laced waterways are unsafe.
Wave of fear: Ipanema beach in Rio. Credit:Getty Images
The first of the studies, reviewed in September by US scientists, showed the presence of the microbes at five of Rio's showcase beaches, including the ocean-front Copacabana, where open-water and triathlon swimming will take place. The other four were Ipanema, Leblon, Botafogo and Flamengo.
The super bacteria can cause hard-to-treat urinary, gastrointestinal, pulmonary and bloodstream infections, along with meningitis. Health officials say studies show that these bacteria contribute to death in up to half of patients infected.
The second new study, by the Brazilian federal government, found the genes of super bacteria in the Rodrigo de Freitas lagoon in the heart of Rio and in a river that empties into Guanabara Bay. Waste from countless hospitals, in addition to hundreds of thousands of households, pours into drains, rivers and streams criss-crossing Rio, allowing the super bacteria to spread.
Renata Picao, the lead researcher of the first study, said the contamination of Rio's famous beaches was the result of a lack of basic sanitation in the metropolitan area of 12million people.
"These bacteria should not be present in these waters. They should not be present in the sea," Professor Picao said.
Cleaning the city's waterways was meant to be one of the Games' greatest legacies and a high-profile promise in the official 2009 Rio bid document. That goal has instead transformed into an embarrassing failure, with athletes lamenting the stench of sewage and complaining about debris that bangs into and clings to boats in Guanabara Bay.
The study shows that Flamengo beach, which hosts Olympic sailing, has the super bacteria in 90 per cent of samples taken. Ten per cent of Copacabana's samples had the microbes. Ipanema and Leblon beaches, the most popular with tourists, had samples that tested positive for super bacteria 50 and 60 per cent of the time, respectively.
Valerie Harwood, a US expert in recreational water contamination, said that if anything, things were getting worse, as the super bacteria naturally spread by infecting other microbes. These bacteria are opportunistic microbes that can enter the body, lie dormant, then attack at a later date when a healthy person may fall ill for another reason.
Super bacteria also infect otherwise-harmless bacteria present in the waters, turning them into antibiotic-resistant germs.
Most Viewed in Sport
|
cc/2021-04/en_middle_0021.json.gz/line2122
|
__label__wiki
| 0.520629
| 0.520629
|
Welcome to HER Voice
A new column examining gender bias and its impact within the outdoor industry
Alison Hill
The outdoor industry is a progressive one. It is filled with idealists, people in search of no less than a better world. We publicly take stands for environmental conservation, for clean water, and social justice. We risk our reputations, we speak out, and we moved our biggest retail show, based on these values.
Every day I am honored to be a part of this community, working toward our shared future.
But there are times when our industry doesn’t live up to our own progressive ideals.
We need to be more inclusive. We need to make access to the outdoors more equitable. And we need to hear from those people we’ve sidelined and underestimated—including the strong women leaders in our industry.
With that goal in mind, I am proud to announce a partnership between SNEWS and LifeStraw to bring the industry HER Voice: a monthly column that will focus on women's issues in the outdoor industry.
Our goal for this column is to continue adding to the rich conversation that already exists, to highlight new women leaders—engineers, activists, and change makers in the industry—and to continue to make progress on elevating women, and their collective voices, across the outdoor industry.
As a watchdog of our industry, The Voice continues to tackle relevant subject matter, much of which reveals disturbing gaps between perception and reality. In January, The Voice and #SafeOutside issued results of a landmark survey about sexual misconduct, power and gender bias in the outdoor industry. One of the statistics I found most telling was that while 65 percent of women believe gender bias exists in the outdoor industry, only 10 percent of men do.
I wish I could say this was surprising, but it’s in line with my own experience. As managing director of LifeStraw, I have attended numerous trade shows, have been a guest speaker at conferences, and participated in meetings at which I was mistaken for the administrative assistant of a male staffer. At a recent OR show, our head of brand, Tara Lundy received a compliment for being more knowledgeable than the traditional “booth babe.” In subtle ways, every day, women are put down, assumed to be junior and expected to be less knowledgeable than the men in the room.
This isn't unique to the outdoor industry, I know that.
But it stands in direct opposition to our values. We should all do better and do more.
What we aspire to do with this column, HER Voice, is raise the profile of women in the industry. So that next time you meet someone at a conference or out on the trail, you don’t assume she’s there as a sidekick to someone else. She’s likely there kicking ass, blazing her own trail.
Lifestraw#SafeOutsideHer Voice
Alison Hill is the Managing Director for LifeStraw, a social good water filter company that provides innovative clean water products for people in the outdoors and across the world. LifeStraw is one of three humanitarian enterprises of Vestergaard, a global company dedicated to improving the health of vulnerable populations around the world.
Women make cupcakes. Men make beer and gear.
Take a look around you. Whether you realize it or not, you’re likely surrounded by women who have started their own businesses. According to the 2018 study “State of Women-Owned Business Report,” commissioned by American Express, four of every 10 U.S. businesses are owned by ...read more
By Jen Gurecki
Industry Buzz: HER Voice, Toray, Nat Geo adventure competition, Fischer Skis, Sting, and more
Today we launched an exciting new column called HER Voice in partnership with LifeStraw. Managing Director Alison Hill kicks things off with an overview of the project: "Our goal for this column is to continue adding to the rich conversation that already exists, to highlight new ...read more
By Mady Koller
Women’s participation is up. Female bylines are still down.
This year, Nike released its first-ever female-specific skateboard shoe. The World Surf League now pays out equal prize money to men and women. Burton Snowboards just amended their athlete contracts to support and protect their female riders during pregnancy. We are in a unique ...read more
By Jennifer Sherowski
Why sponsoring women makes "cents"
Gaze around at contests such as the GoPro Mountain Games and Red Bull Rampage, and you might think that only men play sports—on a professional level, anyway. Women’s sport sponsorship lags well behind men’s, and although comparative data is scarce, the one nation that did study ...read more
By Kelly Bastone
Read the digital issue of The Voice, No. 2
The issues you hear in the hallways of trade shows and in conversations at your store or business? We explored those on paper. Our new trade journal, The Voice, dives into the big questions facing our industry. Read our latest issue online or subscribe to receive a hard copy. ...read more
By SNEWS Editors
Sex, power, and the outdoor industry, Part II
In 2005, Sarah* was wrapping up her fifth year as a seasonal guide for a wilderness camp in the South. Normally awkward and shy, she had blossomed there, growing into a gifted leader and teacher. She had spent the last five years fixing trails and teaching her young charges how ...read more
By Rachel Sturtz
Why onsite childcare benefits your business
For many new parents, attending Outdoor Retailer comes at a cost: leaving your kiddos behind. But, for Tessa Byars, the PR and communications manager at Patagonia, it was as easy as climbing into the cab of a truck. “Our daughter was six months so my husband joined,” Byars ...read more
By Heather Balogh Rochfort
Welcome to The Voice, issue #2
At the Outdoor Retailer Snow Show in January, we were so thrilled to drop the first issue of The Voice, our independent, unfiltered, engaged outdoor industry trade mag to critical acclaim. Subscribe to The Voice And now, as Summer Market approaches, we’re busy working on issue ...read more
By Kristin Hostetter
Body positivity isn’t enough
It was a simple case of mistaken identity: Earlier this year I was at The Outbound's Pursuit Series adult summer camp in North Carolina when an ultrarunner walks up and introduces herself: “Hi, Mirna, I follow you on Instagram.” I put my coffee cup down and shake her hand before ...read more
By Latria Graham
|
cc/2021-04/en_middle_0021.json.gz/line2123
|
__label__cc
| 0.610081
| 0.389919
|
Proof I Voted
I Voted on Monday, May 7, 2012
Polls opened at 8:00 a.m. at H.O. Nash School
Killnarney Constituency
I completed by voting at 8:15 a.m.
Barrington H. Brennen
155,804 Voted
These represented 90.5 % of registered voters who actually cast their ballots on that day.
75,806 for PLP - 48.6%
65,518 for FNM - 42%
13,186 for DNA - 8.4%
1,294 went to Independent Candidates - 0.83%
I VOTED MAY 2, 2002, IN THE BAHAMAS
On Thursday, May 2, 2002, 141,000 Bahamian voters went to the polls to vote in the general elections. Below you will see the proof that I did vote. The right thumb of every voter was dipped in a dye after voting. Election results coming soon.
Below Are Guidelines For Sharing the Information On This Site
Permission is granted to place links from these articles on social media like Google+, FaceBook, etc.. Permission is also granted to print these pages and to make the necessary copies for your personal use, friends, seminar, or meeting handout. You must not sell for personal gain, only to cover the cost to make copies if necessary. Written permission (email) is needed to publish or reprint articles and materials in any other form. Articles are written by Barrington H. Brennen, Counseling Psychologist and Marriage & Family Therapist.
P.O. Box CB-13019, Nassau, The Bahamas.
info@soencouragement.org
Phone contact is 242-327 1980.
Copyright © 1999-2020 Sounds of Encouragement. All rights reserved.
Click Here to Subscribe to Newsletter
"Dedicated to the restoration of life."
|
cc/2021-04/en_middle_0021.json.gz/line2124
|
__label__wiki
| 0.990815
| 0.990815
|
The Southern Star
West Cork Directory
Star Sport Podcast
Club backs idea to name stand after PD Mehigan
By Southern Star Team
Artist's impression: An aerial view shows what the redeveloped Páirc Uí Chaoimh and the adjoining all-weather pitch will look like.
BY KIERAN McCARTHY
ST James’ GAA Club is supporting a proposal to have a stand in the redeveloped Pairc Uí Chaoímh named after Ardfield-born PD Mehigan, who is regarded as one of the most influential figures in GAA history.
The Carbery club agreed to support the proposal at a club meeting and has sent a letter to the Cork County Board outlining why it feels Mehigan deserves to have a stand in Pairc Uí Chaoímh named after him.
All-Star Cork defender Melissa Duggan feels Rebels are closing the gap to Dublin
A journalist of note, Mehigan (born in Ardfield in 1884) is better known for his pseudonym ‘Carbery’ and in 2009 The Sunday Tribune’s list of the 125 most influential figures in GAA history, the West Cork man was listed number 17.
The Sunday Tribune wrote: ‘A veteran of two All-Ireland hurling finals himself, Mehigan’s radio commentary on the 1926 semi-final between Galway and Kilkenny was the first live broadcast of a sports event in Europe.
‘Using a nom de plume garnered from the West Cork barony where he grew up, his “Carberys Comments” column was a staple of the Cork Weekly Examiner for half a century while Irish Times readers cherished him as Pat O, the paper’s first GAA correspondent. A prolific chronicler of rural and sporting life in poetry, prose and books, his Carbery Annual was a fixture in households nationwide between 1939 and 1964. (1884-1965).’
St James’ GAA Club is urging all clubs and members of the public to support this proposal.
Urhan rugby star Laura Sheehan is looking for the extra edge after joining Exeter Chiefs
New Ilen Rovers senior football boss Jason Whooley knows the recipe for success
‘It’s very disappointing but it’s not surprising’
Consultation key to buy-in from people
Big success for West Cork’s young scientists
Bantry’s cultural treasure hunt reveals true gems
to our mailing list for the latest news and sport:
You have successfully been subscribed to SouthernStar newsletter!
Form submitting... Thank you for waiting.
Copyright 2021 Southern Star Ltd.
Developed by Square1.io and powered by PublisherPlus.com
|
cc/2021-04/en_middle_0021.json.gz/line2126
|
__label__wiki
| 0.877693
| 0.877693
|
Jazz maestro Nduduzo Makhathini hits high notes
25 February 2020 - 08:50
By Patience Bambalele
Jazz artist and trendsetter Nduduzo Makhathini/ Tshepo Kekana
When jazz maestro Nduduzo Makhathini takes to the stage tonight with Lincoln Centre Orchestra (LCO) and great trumpeter Wynton Marsalis in Vienna he will be marking another historical moment.
Makhathini - who signed one of the most incredible recording deals with Blue Note Records, the renowned American jazz record label owned by Universal Music Group - has two significant performances.
The first performance tonight with the LCO and Marsalis at Wiener Konserthuis in Austria will be dedicated to Thelonious Sphere Monk.
Monk, who died in 1982 at the age of 65, was an American jazz pianist and composer. He is renowned for a unique improvisational style and contributed to the growth of the American standard jazz repertoire.
FRED KHUMALO | SA piano wizard hits high note
Nduduzo Makhathini boards John Coltrane's music train
Speaking to Sowetan yesterday just a few minutes before flying to Austria, Makhathini said: "It is an honour not only to perform with LCO but to get an opportunity to interpret the music of one of the greatest pianists.
"I have so much respect for the LCO. Lincolin orchestra is one of the greatest jazz orchestras and I feel honoured to play with them."
The second day, tomorrow, will be dedicated to South African Songbook: 25 Years of Democracy. The performance will feature interpretations of music of artists such as Bheki Mseleku and Zim Ngqawana, who are both deceased, and Feya Faku.
"It is an exciting and proud moment for me and the country... all these are part of some of the dreams I had 30 years ago, now they are a reality."
|
cc/2021-04/en_middle_0021.json.gz/line2127
|
__label__wiki
| 0.887752
| 0.887752
|
ANCWL, ANCYL exhort youth not to forget Winnie’s struggle
By Penwell Dlamini - 09 April 2018 - 14:04
Winnie Madikizela-Mandela.
Image: Veli Nhlapo
The ANC women and youth leagues have urged the youth to use the mourning period for the late Winnie Madikizela-Mandela to reflect on her struggle and the baton that they have to pick up and take forward.
The leagues both delivered messages of support during the opening of the tribute wall for the late struggle stalwart outside Luthuli House on Monday.
Secretary general of the ANC Ace Magashule penned the first message on the wall.
“We must not forget who she was [and] her fight in the struggle of this country. We must always remember as young women that Mama fought for us with other women like Mama Albertina Sisulu and Mama Tambo.
“We must always remember as young people that the struggle for women still continues and we will always remember her [Mama Winnie] as our heroine. Throughout the country we will be celebrating her life. It is not a time to cry but to celebrate a life well lived‚” said Meokgo Matuba‚ secretary general of the ANC Women’s League.
Njabulo Nzuza‚ secretary general of the ANC Youth League‚ said the youth must learn from the fallen heroes and heroine of the struggle.
“They must learn that it is not just about themselves but also about the good of the country. Young people need to build their own political consciousness and understand that they have a role to play in this country…We hope that the ANC‚ from now on‚ will prioritise young people just like Mama Winnie emphasised on the priority of young people and identified problems faced by young people as a ticking time bomb…‚” Nzuza said.
There are a number of memorial services organised by the ANC and government which will take place across the country as it pays tributes to Mama Winnie.
Mother of the Nation, a daughter of the soil
Mama Winnie a lioness whose roar for liberation could not be silenced
“The secretary general of the ANC last week declared on our behalf that Tuesday is going to be the [day of] the national memorial service of the ANC. This now takes place in Bhizana [in the Eastern Cape. On Wednesday is the government programme [at the Orlando Stadium]. On Thursday‚ the ANCWL will join the women of Umanyano of the Methodist Church‚ a denomination that Mama Winnie belonged to. Friday is reserved to the MKMVA for the night vigil. All of us will join it there.
“The [ANC] Youth League has already advised us that a contingent of the league throughout the country will be arriving and filling Orlando [stadium] as of Friday‚” said ANC spokesperson Pule Mabe.
Born Nomzamo Winifred Madikizela‚ Mama Winnie died on April 2 after a long illness at the Netcare Milpark Hospital in Johannesburg. She was 81 at the time of her death. The funeral service for Mama Winnie will be held on Saturday at the Orlando Stadium in Soweto.
Ramaphosa hails late Bapedi king for striving to lead his people on ...
A mural memorial: Winnie's wall unveiled at Luthuli House
OPINION: She was no saint but still a shining light in Struggle
|
cc/2021-04/en_middle_0021.json.gz/line2128
|
__label__cc
| 0.66528
| 0.33472
|
The Power of Giving
At The Standard, caring about people is a core value reflected in our commitment to the communities across the United States where our employees live and work. From donating millions of dollars annually to volunteering thousands of hours each year with schools, food banks and other organizations, The Standard and our employees make a real difference in the communities we call home.
2020 Employee Giving Campaign
employees participated
raised from donations made by employees and retirees and matched by The Standard and Meiji Yasuda
nonprofit organizations and schools supported
Total 2019 Giving
Days of Caring events
senior leaders serving on nonprofit and civic boards
A Commitment to Community
Giving back is a part of our DNA. Learn how we partner with nonprofit organizations.
Our legacy of giving is grounded in a partnership between employees and the company to create opportunities and deliver results.
We Deliver Results
Volunteer Expos in Portland and Cincinnati help connect employees and the public with local volunteer opportunities.
How We Connect
Healthy environments create strong, vibrant communities — our sustainable practices hold fast to this vision.
See Our Practices
At The Standard, we believe engaged employees and a culture of caring is a winning combination for our communities and our customers. And we also believe compassion and the desire to give back are what make us The Standard.
J. Greg Ness, Chairman and CEO
Celebrating Our Employees' Good Work
The Standard established the Leo Award program in honor of our founder, Leo Samuel. Each year, the company recognizes four employee volunteers — nominated by their peers and determined by popular vote — who exemplify Leo Samuel's community spirit. Winners receive a cash award for themselves and a donation to their nonprofit from The Standard. In 2019, we honored these four exceptional employee volunteers:
American Cancer Society,
Central Virginia Chapter
Marcy David
Women in Insurance and Financial Services
Jon Shervey
Big Brothers Big Sisters of
the Columbia Northwest
Amy Frazey
ALS Association of Oregon
and Southwest Washington
See how we believe in giving back to our communities.
View the Report
The Standard Charitable Foundation 2019 Grant Highlights
My Sisters’ Place
$10,000 was awarded to My Sisters’ Place, which provides shelter and other services for individuals and families fleeing domestic violence and human trafficking. The grant will fill gaps in shelter funding and enable the organization to continue to provide vital services for the most vulnerable families in Westchester County, New York.
New Avenues for Youth
$15,000 was awarded to New Avenues for Youth for the Youth Opportunity Center. Located in East Multnomah County, Oregon, the center provides drop-in services, education, job training and employment services, housing referrals and outreach to younger youth that are geographically isolated, unstably housed and connected to a school.
p:ear
$10,000 was awarded to p:ear, which builds positive relationships with homeless and transitional youth through education, art, recreation and employment. This grant supported staffing for the p:ear Works job training program that provides youth hands-on, paid internships as well as employment opportunities and assistance with career goals and placement for transitioning into independent living.
QUAD, Inc.
$15,000 was awarded to QUAD, Inc., which fosters personal independence by providing affordable, barrier-free housing for people with severe physical disabilities. The grant supported the purchase of a resident lift system benefitting adults with disabilities living at four QUAD apartment buildings.
Tualatin Hills Park Foundation
$15,000 was awarded to Tualatin Hills Park Foundation for the Access for All Collaborative Investment Initiative, which is a three-year program that aims to expand social and recreational opportunities for people with disabilities. The Initiative is designed to support the engagement of diverse disability organizations for children, youth and adults living in the Portland metro area.
The foundation’s giving is separate from the corporate giving of The Standard. Since 2007, The Standard Charitable Foundation, The Standard and its employees and retirees have contributed more than $35 million in grants and social investments.
Award Highlights
The Standard and our employees were honored to receive recent awards from our community partners. Some of the highlights include:
Corporate Equality Index perfect score — Human Rights Campaign Foundation
Americans for the Arts BCA 10 Award
Trillium Family Services Mental Health Heroes Award
My Sister's Place Community Partner Award
|
cc/2021-04/en_middle_0021.json.gz/line2131
|
__label__cc
| 0.686314
| 0.313686
|
What Is The $500 Winloot Bonus Giveaway Sweepstakes?
Why is Winloot so popular? Because real people, just like you, win cash and prizes every single day! Winloot has had more than 79,000 winners to date and counting! Take a look at Winloot’s Winner’s Way page and you’ll see the many names and smiling faces of players who were so happy, they sent Winloot a selfie holding their prize-winning check! Winloot’s goal is to create many fun and exciting opportunities for members to enter for chances to win loot and cool prizes! As a result, Winloot has added yet another exciting sweepstakes for players to enter for chances to win $500 cash! As you play through the free daily Winloot sweepstakes games, you’ll unlock chances to enter the new $500 Bonus Giveaway Sweepstakes, which is 100% free to enter and is open for Winloot members to enter 5 times daily until the contest ends. The current contest runs until May 15, 2020, at which time a winner will be selected at random from the total number of entries received. Winloot’s last $500 Bonus Sweepstakes contest ended on January 15, 2020, with an exciting $500 Bonus Sweepstakes win for Lyndall M. in Vancouver, British Columbia! There’s nothing like opening your email to find you’ve won some loot! So, be sure to enter your main email address and keep checking for messages from Winloot. You certainly wouldn’t want to miss out on an important message, especially a prize winner notification! Winloot Bonus Giveaway Sweepstakes also offers additional chances for players to win some loot while they’re entering for chances to win the $500 Bonus Sweepstakes cash prize. This includes the $100 Instant Win scratch game where players can reveal cash prizes of $100, $25, $10, $5, or $1 by matching 3 numbers. Players who enter the Winloot Bonus Giveaway Sweepstakes also get additional chances to enter another Winloot bonus game called Winlootia, for chances to uncover the hidden $5, $10, or $500 jackpot treasure of loot! If you don’t uncover the hidden loot right away, you can still earn tokens which can be used to enter for other exciting prizes and cash on Winloot’s Token Prize page. These prizes include gift cards, fun electronics and, of course, more loot! Keep in mind, Winloot offers the winners the choice of how they would like their prize award paid. You can select a direct PayPal payment, an Amazon Gift Card, or a check in the mail. Just let the Winloot Prize Team know, if/when you receive a prize-winning email message, which method of payment you would prefer. So, if you would like chances to become Winloot’s next $500 Bonus Giveaway Sweepstakes winner, make sure to get all 5 of your daily entries in until the contest ends. Winloot will be announcing a winner and sending out that ever-so-exciting winning prize email notification after the end of the contest on May 15, 2020! Thank you to the many loyal players for entering all of the free Winloot Sweepstakes games. Winloot appreciates each and every one of you and wishes you all the best of luck in winning some loot! We hope to see your name on the list of many happy winners very soon, either for the very first time or as a multi-time winner! Winloot is most definitely one of the most exciting Sweepstakes sites out there, so get in on the fun and good luck winning some loot!
All prizes are sponsored by Winloot.com.
See official rules and privacy policy for details.
Prize Retail Value: Top Prize $500
End Date: May 15, 2020
« SweepsKing Sweepstakes
Win Big Prizes Instantly at Prizes-Now! »
|
cc/2021-04/en_middle_0021.json.gz/line2138
|
__label__wiki
| 0.507691
| 0.507691
|
New Customer Security Controls Policy published
Customer Security Programme,
Updated policy includes changes to self-attestation and independent assessments
SWIFT has updated the Customer Security Controls Policy document, which sets out SWIFT's policy with regards to the Customer Security Controls Framework (CSCF): a set of security controls which provide a security baseline for SWIFT users, as part of its Customer Security Programme (CSP). Self-attesting compliance with these controls is an essential step for customers to take towards securing their systems.
The refreshed policy includes the following changes:
Annual self-attestation, between July and December
As from CSCF v2019, self-attestations submitted between July and December will be valid until the end of the following year (replacing the current 12 months validity rule)
As from mid-2020, an independent assessment (either internal or external) will be required as outlined in the recently published Independent Assessment Framework
Policy and CSCF updates will follow an annual joint update cycle
Elements specific to the usage of the KYC-SA application have been moved to the KYC-SA user guide
You can access the new Customer Security Controls Policy here. (SWIFT login ID required).
CSCF v2019 on KYC-SA
As a reminder, KYC Security Attestation (KYC-SA) application for the CSCF v2019 has been available since early July and users can start to attest their level of compliance against this baseline. The deadline for attesting is 31 December 2019 and all SWIFT users must self-attest compliance with, at the minimum, the mandatory controls set out in SWIFT’s Customer Security Controls Framework v2019.
The CSCF v2019 is available in full here. (SWIFT login ID required).
|
cc/2021-04/en_middle_0021.json.gz/line2139
|
__label__wiki
| 0.851049
| 0.851049
|
Your web browser is outdated. Please use a modern web browser for a better experience.
Swiss perspectives in 10 languages
About SWI
Switzerland: How To
User profile Login
Swiss universities shine in global survey
In 13 subjects the federal institute ETH Zurich ranks among the top ten schools worldwide. © Keystone / Christian Beutler
Swiss higher education institutions, led by the Swiss federal technology institute ETH Zurich, continue to excel in the latest QS university rankings by subject.
This content was published on March 4, 2020 - 01:01 March 4, 2020 - 01:01
Keystone-SDA/sb
See in other languages: 3
Português (pt) Universidades suíças brilham em ranking internacional
中文 (zh) 瑞士高校在全球调查中大放异彩，出类拔萃
عربي (ar) الجامعات السويسرية تتألق مجددا في مسح عالمي
Only six universities have more courses in the top ten by subject than ETH Zurich, all of them in the United States and Britain.
In 13 subjects the Zurich federal institute ranks among the top ten schools worldwide. Over the past five years, it has come first in the ranking by subject for Earth and Marine Sciences.
Overall, 26 courses offered by eight Swiss higher education institutions featured in the respective QS top tens by subject. No other country in continental Europe provides such a high concentration of world-class degree programmes, QS said.
“Over the past five years, the performance of the Swiss university system has clearly improved,” QS research director Ben Sowter told the Keystone-SDA News Agency. Its biggest improvement was in academic reputation, with a survey of 94,000 university students worldwide showing that the Swiss system is enjoying growing prestige, he said.
Lausanne not left out
Elsewhere in the annual ranking, the federal institute of technology in Lausanne (EPFL) had the second highest number of top-ten courses of study – seven of its departments were among the world's best.
For Hospitality and Leisure Management studies, the EHL Ecole hôtelière de Lausanne was also ranked the best school in the world, QS reported.
Other hotel schools in French-speaking Switzerland were also marked highly. Les Roches Global Hospitality Education and the Glion Institute of Higher Education shared third place in this category, while the Swiss Hotel Management School moved up to fifth place.
Overall, the University of Cambridge led the subject rankings, with 38 courses in the top tens, followed by Harvard University.
QS first published their ranking in 2004. Along with the Times Higher Education and Shanghai rankings, it is one of the most cited indicators of university quality.
How important are university rankings?
This content was published on Nov 5, 2019 Nov 5, 2019 Swiss universities tend to do well in university rankings. But how are they regarded by the institutions themselves?
The ethics of artificial intelligence
The challenges are immense for Switzerland, which is one of the leading developers of artificial intelligence (AI).
This article was automatically imported from our old content management system. If you see any display errors, please let us know: community-feedback@swissinfo.ch
Swiss university system climbs to third in global study
This content was published on Feb 27, 2019 Feb 27, 2019 Thanks largely to the strong performance of ETH Zurich, the Swiss university system has entered the top three globally in the latest QS rankings.
ETH Zurich again makes top 20 universities worldwide
This content was published on Aug 15, 2018 Aug 15, 2018 Five Swiss universities are among the best 100 higher educational institutions worldwide, according to the latest academic ranking.
Swiss universities loved by foreign students
This content was published on Sep 16, 2017 Sep 16, 2017 More than half of those doing a doctorate in Switzerland come from abroad, according to the latest OECD education indicators.
Play SWI
SWI swissinfo.ch - a branch of Swiss Broadcasting Corporation SRG SSR
|
cc/2021-04/en_middle_0021.json.gz/line2140
|
__label__wiki
| 0.90899
| 0.90899
|
Meet ‘Luna’, Amazon’s New Twitch-Enabled Cloud Gaming Service
Amazon on Thursday introduced ‘Luna’ – a new cloud gaming service designed for instant play – at its 2020 virtual hardware event.
The new gaming service is powered by Amazon Web Services (AWS), which makes it easy to stream high-quality, immersive games. Players can enjoy Luna games on their favorite devices without extensive downloads or updates, expensive hardware or complicated configuration. They can even start playing on one screen and seamlessly pick up and continue on another.
“We created Luna to make it easy to play great games on the devices customers already own and love. It’s Day One for Luna—we are excited to work with gamers, streamers, and publishers like Ubisoft and Remedy Entertainment to build a great gaming experience for everyone,” said Marc Whitten, Vice President, Amazon Entertainment Devices and Services.
During early access, players can subscribe to the new Luna+ game channel, which will offer action games like Resident Evil 7, Control, and Panzer Dragoon; adventure games like A Plague Tale: Innocence and The Surge 2; platformers like Yooka-Laylee and The Impossible Lair and Iconoclasts; and fan favorites like GRID, ABZU and Brothers: A Tale of Two Sons.
The Luna+ service will be available for an “introductory price” of $5.99/month during the early access period, with more games set to be released over time. Also, Luna+ subscribers can play on two devices simultaneously and get resolutions of 4K/60fps for select games.
The company has also partnered with leading global video game publisher Ubisoft, accessible directly via Luna.
Players who subscribe to this channel will have access to their favorite Ubisoft titles in up to 4K resolution and mobile gameplay. When the channel launches, they will also be able to access new titles like Assassins Creed Valhalla, Far Cry 6, and Immortals Fenyx Rising, the same day they release. Besides, players will also be able to see Twitch streams for games in the service, and from Twitch, they will be able to instantly play Luna titles.
“We’re proud to be working alongside Amazon on Luna, utilizing the power of cloud gaming to provide our players with another way to access our games, wherever they are. Ubisoft’s channel on Luna will allow players to experience our new releases along with many of our catalog games, while enjoying player-friendly features like Alexa and Twitch integrations,” said Chris Early, SVP of Partnerships and Revenue, Ubisoft.
While players can play Luna with a keyboard and mouse, a Bluetooth game controller, the service also now offers a new Luna Controller featuring Cloud Direct technology. The controller is powered by Alexa and features a multiple-antenna design that prioritizes un-interrupted Wi-Fi for lower latency gaming.
Players can also easily switch between screens as the Luna Controller connects directly to cloud servers. Luna Controller is available at an introductory price of $49.99 during the early access period.
Luna will be initially available on Fire TV, PC, and Mac as well as iPhone and iPad (via web apps), with Android coming soon. There’s no word on international availability.
Interested users in the U.S. can request an invitation for early access to Luna by sending a request for an invitation to Luna today at https://amazon.com/Luna/.
|
cc/2021-04/en_middle_0021.json.gz/line2143
|
__label__wiki
| 0.514706
| 0.514706
|
Hugh Herr
Details About the talk
I'm an MIT professor, but I do not design buildings or computer systems. Rather, I build body parts, bionic legs that augment human walking and running.
In 1982, I was in a mountain-climbing accident, and both of my legs had to be amputated due to tissue damage from frostbite. Here, you can see my legs: 24 sensors, six microprocessors and muscle-tendon-like actuators. I'm basically a bunch of nuts and bolts from the knee down. But with this advanced bionic technology, I can skip, dance and run.
I'm a bionic man, but I'm not yet a cyborg. When I think about moving my legs, neural signals from my central nervous system pass through my nerves and activate muscles within my residual limbs. Artificial electrodes sense these signals, and small computers in the bionic limb decode my nerve pulses into my intended movement patterns. Stated simply, when I think about moving, that command is communicated to the synthetic part of my body. However, those computers can't input information into my nervous system. When I touch and move my synthetic limbs, I do not experience normal touch and movement sensations. If I were a cyborg and could feel my legs via small computers inputting information into my nervous system, it would fundamentally change, I believe, my relationship to my synthetic body. Today, I can't feel my legs, and because of that, my legs are separate tools from my mind and my body. They're not part of me. I believe that if I were a cyborg and could feel my legs, they would become part of me, part of self.
At MIT, we're thinking about NeuroEmbodied Design. In this design process, the designer designs human flesh and bone, the biological body itself, along with synthetics to enhance the bidirectional communication between the nervous system and the built world. NeuroEmbodied Design is a methodology to create cyborg function. In this design process, designers contemplate a future in which technology no longer compromises separate, lifeless tools from our minds and our bodies, a future in which technology has been carefully integrated within our nature, a world in which what is biological and what is not, what is human and what is not, what is nature and what is not will be forever blurred. That future will provide humanity new bodies. NeuroEmbodied Design will extend our nervous systems into the synthetic world, and the synthetic world into us, fundamentally changing who we are. By designing the biological body to better communicate with the built design world, humanity will end disability in this 21st century and establish the scientific and technological basis for human augmentation, extending human capability beyond innate, physiological levels, cognitively, emotionally and physically.
There are many ways in which to build new bodies across scale, from the biomolecular to the scale of tissues and organs. Today, I want to talk about one area of NeuroEmbodied Design, in which the body's tissues are manipulated and sculpted using surgical and regenerative processes. The current amputation paradigm hasn't changed fundamentally since the US Civil War and has grown obsolete in light of dramatic advancements in actuators, control systems and neural interfacing technologies. A major deficiency is the lack of dynamic muscle interactions for control and proprioception.
What is proprioception? When you flex your ankle, muscles in the front of your leg contract, simultaneously stretching muscles in the back of your leg. The opposite happens when you extend your ankle. Here, muscles in the back of your leg contract, stretching muscles in the front. When these muscles flex and extend, biological sensors within the muscle tendons send information through nerves to the brain. This is how we're able to feel where our feet are without seeing them with our eyes.
The current amputation paradigm breaks these dynamic muscle relationships, and in so doing eliminates normal proprioceptive sensations. Consequently, a standard artificial limb cannot feed back information into the nervous system about where the prosthesis is in space. The patient therefore cannot sense and feel the positions and movements of the prosthetic joint without seeing it with their eyes. My legs were amputated using this Civil War-era methodology. I can feel my feet, I can feel them right now as a phantom awareness. But when I try to move them, I cannot. It feels like they're stuck inside rigid ski boots.
To solve these problems, at MIT, we invented the agonist-antagonist myoneural interface, or AMI, for short. The AMI is a method to connect nerves within the residuum to an external, bionic prosthesis. How is the AMI designed, and how does it work? The AMI comprises two muscles that are surgically connected, an agonist linked to an antagonist. When the agonist contracts upon electrical activation, it stretches the antagonist. This muscle dynamic interaction causes biological sensors within the muscle tendon to send information through the nerve to the central nervous system, relating information on the muscle tendon's length, speed and force. This is how muscle tendon proprioception works, and it's the primary way we, as humans, can feel and sense the positions, movements and forces on our limbs.
When a limb is amputated, the surgeon connects these opposing muscles within the residuum to create an AMI. Now, multiple AMI constructs can be created for the control and sensation of multiple prosthetic joints. Artificial electrodes are then placed on each AMI muscle, and small computers within the bionic limb decode those signals to control powerful motors on the bionic limb. When the bionic limb moves, the AMI muscles move back and forth, sending signals through the nerve to the brain, enabling a person wearing the prosthesis to experience natural sensations of positions and movements of the prosthesis.
Can these tissue-design principles be used in an actual human being? A few years ago, my good friend Jim Ewing — of 34 years — reached out to me for help. Jim was in an a terrible climbing accident. He fell 50 feet in the Cayman Islands when his rope failed to catch him hitting the ground's surface. He suffered many, many injuries: punctured lungs and many broken bones. After his accident, he dreamed of returning to his chosen sport of mountain climbing, but how might this be possible?
The answer was Team Cyborg, a team of surgeons, scientists and engineers assembled at MIT to rebuild Jim back to his former climbing prowess. Team member Dr. Matthew Carty amputated Jim's badly damaged leg at Brigham and Women's Hospital in Boston, using the AMI surgical procedure. Tendon pulleys were created and attached to Jim's tibia bone to reconnect the opposing muscles. The AMI procedure reestablished the neural link between Jim's ankle-foot muscles and his brain. When Jim moves his phantom limb, the reconnected muscles move in dynamic pairs, causing signals of proprioception to pass through nerves to the brain, so Jim experiences normal sensations with ankle-foot positions and movements, even when blindfolded.
Here's Jim at the MIT laboratory after his surgeries. We electrically linked Jim's AMI muscles, via the electrodes, to a bionic limb, and Jim quickly learned how to move the bionic limb in four distinct ankle-foot movement directions. We were excited by these results, but then Jim stood up, and what occurred was truly remarkable. All the natural biomechanics mediated by the central nervous system emerged via the synthetic limb as an involuntary, reflexive action. All the intricacies of foot placement during stair ascent —
emerged before our eyes. Here's Jim descending steps, reaching with his bionic toe to the next stair tread, automatically exhibiting natural motions without him even trying to move his limb. Because Jim's central nervous system is receiving the proprioceptive signals, it knows exactly how to control the synthetic limb in a natural way.
Now, Jim moves and behaves as if the synthetic limb is part of him. For example, one day in the lab, he accidentally stepped on a roll of electrical tape. Now, what do you do when something's stuck to your shoe? You don't reach down like this; it's way too awkward. Instead, you shake it off, and that's exactly what Jim did after being neurally connected to the limb for just a few hours. What was most interesting to me is what Jim was telling us he was experiencing. He said, "The robot became part of me."
Jim Ewing: The morning after the first time I was attached to the robot, my daughter came downstairs and asked me how it felt to be a cyborg, and my answer was that I didn't feel like a cyborg. I felt like I had my leg, and it wasn't that I was attached to the robot so much as the robot was attached to me, and the robot became part of me. It became my leg pretty quickly.
Hugh Herr: Thank you.
By connecting Jim's nervous system bidirectionally to his synthetic limb, neurological embodiment was achieved. I hypothesized that because Jim can think and move his synthetic limb, and because he can feel those movements within his nervous system, the prosthesis is no longer a separate tool, but an integral part of Jim, an integral part of his body. Because of this neurological embodiment, Jim doesn't feel like a cyborg. He feels like he just has his leg back, that he has his body back.
Now I'm often asked when I'm going to be neurally linked to my synthetic limbs bidirectionally, when I'm going to become a cyborg. The truth is, I'm hesitant to become a cyborg. Before my legs were amputated, I was a terrible student. I got D's and often F's in school. Then, after my limbs were amputated, I suddenly became an MIT professor.
Now I'm worried that once I'm neurally connected to my limbs once again, my brain will remap back to its not-so-bright self.
But you know what, that's OK, because at MIT, I already have tenure.
I believe the reach of NeuroEmbodied Design will extend far beyond limb replacement and will carry humanity into realms that fundamentally redefine human potential. In this 21st century, designers will extend the nervous system into powerfully strong exoskeletons that humans can control and feel with their minds. Muscles within the body can be reconfigured for the control of powerful motors, and to feel and sense exoskeletal movements, augmenting humans' strength, jumping height and running speed. In this 21st century, I believe humans will become superheroes. Humans may also extend their bodies into non-anthropomorphic structures, such as wings, controlling and feeling each wing movement within the nervous system. Leonardo da Vinci said, "When once you have tasted flight, you will forever walk the earth with your eyes turned skyward, for there you have been and there you will always long to return." During the twilight years of this century, I believe humans will be unrecognizable in morphology and dynamics from what we are today. Humanity will take flight and soar. Jim Ewing fell to earth and was badly broken, but his eyes turned skyward, where he always longed to return. After his accident, he not only dreamed to walk again, but also to return to his chosen sport of mountain climbing. At MIT, Team Cyborg built Jim a specialized limb for the vertical world, a brain-controlled leg with full position and movement sensations. Using this technology, Jim returned to the Cayman Islands, the site of his accident, rebuilt as a cyborg to climb skyward once again.
(Crashing waves)
Ladies and gentlemen, Jim Ewing, the first cyborg rock climber.
|
cc/2021-04/en_middle_0021.json.gz/line2144
|
__label__cc
| 0.688842
| 0.311158
|
contact-lens-application
Request Appt.
Your Eye Care Team
What’s New Blog
Preventive Eye Care
Eyewear & Contacts
Home » How to Use Your Smartphone If You Have Retinitis Pigmentosa
How to Use Your Smartphone If You Have Retinitis Pigmentosa
Smartphones allow us to easily stay in touch with loved ones, listen to music, view entertainment, and manage finances — all with the touch of a finger. But for a person with vision loss due to retinitis pigmentosa (RP), using a smartphone can be challenging. Fortunately, by using low-vision aids and the phone’s accessibility features, people with RP can continue to use a smartphone no matter the extent of their vision loss.
What is Retinitis Pigmentosa?
Retinitis pigmentosa (RP) is a genetic eye disease that causes the light-detecting cells in the retina (light-sensitive lining at the back of the eye) to break down. The symptoms of RP include reduced peripheral vision and night-blindness and sometimes a loss of central vision. In its later stages, people with RP find it difficult to read, drive and engage in many other activities.
An estimated 1 in 4,000 individuals are affected by this sight-threatening condition, and about half of the people who have RP have a family member with RP as well.
Though there is currently no cure for RP, a low vision optometrist can provide low vision aids and devices to help patients with RP continue to function at the highest level possible. If you or a loved one has been diagnosed with RP, contact Dr. John Jacobi, for a low vision consultation.
How Can a Person with Retinitis Pigmentosa Use a Smartphone?
Many people with RP can benefit from a smartphone’s features — by utilizing low vision aids and the phone’s accessibility features.
There are several low vision aids and devices that can help one to read the screen of a smartphone; Dr. John Jacobi can help you navigate the differences of each and recommend which low vision aids best suit your needs.
Some low vision aids and devices that can help those with RP use a smartphone and see other objects close-up include:
Bioptic telescopic glasses
Low vision magnifying reading glasses
Prismatic reading glasses
Telemicroscope glasses
Reverse telescopic glasses
Custom-made optical systems
Digital magnifiers or close circuit television (CCT)
Hand-held magnifiers
Turn On Your Phone’s Accessibility Features
Most smartphones on the market have built-in software that makes their functionality accessible to the visually impaired.
Apple products tend to be popular among those with visual impairments, as all of them come with accessibility features that make the phone’s functionality not dependent on sight. Android products also have accessibility features, but not as fine-tuned as Apple’s.
By activating “VoiceOver” (on Apple products) or “TalkBack” (on Android products), you’ll be able to use your phone without needing to look at it. These settings can read all incoming messages and texts on the screen and allow the user to perform various tasks using tapping motions.
In the early stages of retinitis pigmentosa, when vision loss is at a minimum, a smartphone’s settings can be adjusted to:
Increase the contrast between your wallpaper and your icons. Simply put, a busy wallpaper can make it difficult to locate and differentiate between app icons. A solid-color wallpaper can be the solution.
Change font size and brightness on your phone.
Use “voice assistants” and “text-to-speech” features to write out text.
Learning to live with vision loss can be difficult, but we are here to help. If you or a loved one suffers from impaired vision due to RP, we can offer the best low vision aids to enable you to use your smartphone and continue to do the things you love and maintain your independence. Please contact us with any inquiries or to schedule an appointment with Dr. John Jacobi.
Low Vision Center At Suburban Eye Care serves patients from Metro Detroit, Plymouth, Ann Arbor, Dearborn, and throughout Michigan.
https://discoveryeye.org/low-vision-smart-phones/
https://equalentry.com/how-various-screen-readers-work-on-mobile-devices/
https://www.aao.org/eyenet/article/guide-to-vision-aid-apps-apple-android-smartphones
Suburban Eye Care - Located at 32415 Five Mile Rd, Livonia, MI 48154 Phone: (734) 525-8170 https://www.suburbaneyecare.com
Low Vision Patient able to read her newspaper again
Low Vision Patient able to see clear at a distance again with E-Scoops
Low Vision Patient able to see from a distance again
Low Vision Patient able to read for the first time in a long time
Low Vision Video Testimonial
We have new features and protocols in place to ensure your safety. To learn about these protocols, as well as to learn about new patient expectations for appointments, click here. Please call us to schedule your appointment or with any questions today! 734-525-8170.
|
cc/2021-04/en_middle_0021.json.gz/line2145
|
__label__wiki
| 0.930881
| 0.930881
|
Adjourned Prosecutors given more time to prepare case against man who allegedly hit LGBTQ activist with plank
Michael Quinn (29) is accused of hitting Izzy Kamikaze over the head with the plank after spotting her in a counter-protest to the demonstration against Covid-19 restrictions.
Michael Quinn is alleged to have hit Ruth O’Rourke with a large plank of wood wrapped in a Tricolour at an anti-mask demonstration
CollinsPhotoAgency
Andrew Phelan
PROSECUTORS have been given more time to prepare their case against a man who allegedly attacked an LGBTQ activist with a plank of wood wrapped in an Irish tricolour at an anti-mask rally outside the Dail.
He is facing trial but the formal directions of the DPP are required before he can be sent forward.
Judge Treasa Kelly adjourned the case to a date in February.
Mr Quinn, with an address at Malone Flats, Market Street, Ardee, Co Louth, is charged with assault causing harm to Ruth O’Rourke, who is known as Izzy Kamikaze.
The incident is alleged to have happened at Kildare Street on September 12 last.
Accused: Michael Quinn outside court. Photo: Collins
Serial compo claimants hatched 'grand scheme' to get insurance payout
Dad whose kids died in violent circumstances hits out at court naming ban
Today was the second time the case came before Dublin District Court and the judge heard the DPP's directions were not available yet.
Defence solicitor Edward Bradbury represented Mr Quinn, who was not required to be in court.
He asked the judge to adjourn the case. Mr Quinn was remanded on continuing bail.
When the accused first appeared in court in October, evidence of his arrest, charge and caution was submitted by certificate.
Outlining the prosecution's case, Garda Sergeant Gail Smith said the accused arrived at Kildare Street at 1.10pm to take part in a protest. At 3pm, the alleged victim arrived at the scene and Mr Quinn “noticed her presence."
It was alleged that the accused and some other people approached her and “the defendant struck the injured party on the head with a large plank of wood which had a large tricolour attached to it", Sgt Smith said.
This resulted in injuries to her head, it was alleged.
At the October hearing, Judge Brian O'Shea refused jurisdiction to deal with the case at district court level after hearing the outline of the alleged facts. The case will be sent forward for trial to Dublin Circuit Criminal Court when a book of evidence is ready.
However, Judge O'Shea said formal directions from the DPP for trial on indictment were needed before this can happen.
Bail was granted in the accused’s own bond of €100, with no cash lodgment required. Under conditions, he is to stay out of the Dublin 2 area and provide a mobile phone number to the gardai at which he is contactable at all times.
Legal aid was also previously granted after the court heard the accused was in receipt of disability allowance.
|
cc/2021-04/en_middle_0021.json.gz/line2147
|
__label__cc
| 0.614028
| 0.385972
|
Einan’s
Cremation Prices
Burial Prices
Infant & Youth Services
Infant & Youth Pricing
Questions to Consider
Personalize Your Services
Cremation Placement Options
Burial Placement Options
Cemetery Prices
Wake Services
Venue Catering
About Events at Sunset
Service information is posted on our website only with approval from the family.
If you are seeking information not listed below, please contact us.
Obituaries / 2014 / November / 04 / Faye Rebecca Bugbee
Sunset Gardens
Flowers Guestbook
Faye Rebecca Bugbee
From Richland, WA | Born in International Falls, MN
Passed away October 22, 2014 at Avalon Care Center in Pasco, Washington, surrounded by her family.
She was born in International Falls, Minnesota October 4, 1940. In 1950, her family moved to Seattle, Washington. She graduated from Highline High School in 1958. She was married to Jackie Weaver in 1962. Her daughter Rebecca was born in Germany in 1964.
In 1973 she married Roger Bugbee. Teresa joined the family in 1974. The family moved to Wenatchee, Washington in 1975. Two sons, Jeffrey and Michael, were born in 1975 and 1977.
Faye was a loving and caring Christian woman. She made friends easily and there were none she disliked. Among her many tasks and talents: executive secretary at Chemithon Corporation in Seattle, cake decorator, Girl Scout Volunteer, foster home mother, homeschool teacher, caregiver for her two mothers, a business owner, a delegate to a Republican state convention and a Malaga Community Counsel secretary.
Despite failing health in her last 8 years, she would inspire others with her faith and positive outlook on life. Her friends will truly miss her for the fun times of traveling to the ocean, playing cards or just talking and praying on the phone.
She was preceded in death by her parents, Harry and Augusta Dixson; her brothers, John and Harry Dixson, JR and her father and mother-in-law, Dan and Agnes Bugbee.
She is survived by her husband, Roger Bugbee; daughters, Rebecca (Tom) Reeves and Teresa Vargas; sons, Jeffrey (Megan) Bugbee and Michael (girlfriend, Jenny) Bugbee; her sister and family, Sherry Woods, Vince, Vince, Jr. and Sarah; grandchildren, Madox Bugbee, Eric and Alex Vargas, Sheila (Mathiew) Zilch and Shawna (Allen) Bailey as well as great-grandchildren, Hailey Zilch, Joseph Zilch, Isaiah Zilch and Ezekiel Zilch.
A Celebration of Life Gathering will be held Sunday, November 2, 2014 at 3 PM at Events at Sunset, 915 Bypass Hwy, Richland, WA. Memorial contributions may be made to the Disabled American Veterans, PO Box 14301, Cincinnati, OH 45250.
Guestbook for
PUBLIC ENTRY
Your guestbook entry will be visible to the public.
To Roger Bugbee Family,
Faye Bugbee was my best friend.We could share everything. We loved to talk about the Bible. I had the privilege for a few nights to read the Bible to her as we were on the phone together. Faye was a strong lady because she trusted her
best friend,Jesus to give her strength. To all the family who will miss her, I pray for strength, comfort, and encouraging words to help you at this time when you will miss Faye so much.
Psalms 46:l God is our refuge and strength, an ever present help in trouble. Lila Gilley and Family
Rebekah Gilley
Malaga, WA USA
Faye was a joy to care for. Her sunny outlook was so special. I looked forward to her visit each day. You are missed Faye.
kennewick, WA usa
Mom, it is mothers day today and I miss you so much. I grow weary of living in this flesh. You were so weary too. How I look forward to being with you again. Thank you for loving me so much more than I ever deserved. I love you too.
Rebecca Bugbee Reeves
A place for celebrating the memories of your loved one for years to come.
Einan's At Sunset
At Einan's, we want to help you to create a meaningful experience.
Cemetery At Sunset
Providing a place of solace for families to come for generations.
Events At Sunset
Our beautiful facility can accommodate groups from 10 to 250.
915 Bypass Highway
Richland, Washington 99352
info@einansatsunset.com
© 2017 Sunset Gardens
Join Us As We Say Goodbye
Get our latest obituaries delivered right to your inbox. Don't worry, we never send spam or junk.
|
cc/2021-04/en_middle_0021.json.gz/line2148
|
__label__wiki
| 0.966961
| 0.966961
|
News>Retail & Financial
Kroger Adds Share in Memphis
MEMPHIS, Tenn. — Kroger Co. will expand its dominance of this market with the planned acquisition of several Schnuck Markets stores here, as that company exits the region after a nine-year run. Cincinnati-based Kroger said it has agreed to buy nine of the 12 area Schnucks supermarket locations, and it plans to convert eight of them to the Kroger banner during the next few weeks and close the remaining
Donna Boss 1 | Sep 12, 2011
MEMPHIS, Tenn. — Kroger Co. will expand its dominance of this market with the planned acquisition of several Schnuck Markets stores here, as that company exits the region after a nine-year run.
Cincinnati-based Kroger said it has agreed to buy nine of the 12 area Schnucks supermarket locations, and it plans to convert eight of them to the Kroger banner during the next few weeks and close the remaining location. It also plans to buy eight of the Schnucks fuel centers in the market and convert seven to its Kwik Shop convenience-store banner.
Two of the acquired Schnucks locations will replace existing, smaller Kroger stores, the company said.
“Kroger has owned this market for a long time,” said one local industry observer, who asked not to be identified. “They owned this market before Schnucks came here, and they still own it.”
Schnucks has seen its market share decline in Memphis recently. It captured about 12.4% of the market last year, according to Metro Market Studies, Tucson, Ariz., compared with 15.8% in the preceding year. Kroger, meanwhile, grew its share from 29.1% to 30.4% in that time, and Wal-Mart, which operates four Neighborhood Markets and 13 supercenters in Memphis, grew its share from 23.6% to 24.6%.
Kroger currently has 37 stores in the Memphis area. It is buying the Union, Perkins, Germantown, Collierville, Stonebridge, Shelby, Bartlett, Truse and Horn Lake Schnucks stores. Schnucks said it will close its stores in Quince, Forest Hill and Southaven.
“Schnucks competes very favorably in other markets, but in the Mid-South, fierce competition including a growing number of non-traditional grocers and a lingering high-price perception was the one-two punch that brought us to today's announcement,” Schnucks Chairman and Chief Executive Officer Scott Schnuck said in a statement.
Sources said discounter Dollar General has been very aggressive in the market, which also has a strong presence from limited-assortment operators Aldi and Save-A-Lot and local discounters like Superlo.
Schnucks had entered the market in 2002 with the purchase of the 12-unit Seessel's chain, which had previously been acquired by Albertsons.
TAGS: Kroger
Circle K owner Couche-Tard explores acquisition of Carrefour
UNFI to see growth with unique mix of brands, services, says CEO Steve Spinner
E-commerce gives Target holiday sales boost
Albertsons keeps up sales momentum in third quarter
|
cc/2021-04/en_middle_0021.json.gz/line2151
|
__label__wiki
| 0.673295
| 0.673295
|
Funding Supported Housing
Funding & Property
Intensive Housing Management
8,400 households have been affected by benefit caps
The cap on the total amount of benefits a non-working household can receive has affected 8,400 household since its release date in April.
The gap was introduced by the government in April this year and means that no household can receive more than £500 a week in benefits. The Department for Work and Pensions says that 77% of people affected have lost up to £100 a week and over half of the households had between one and four children.
The figures are only representative of those first affected by the cap and do not cover the whole country. The ten week roll-out was completed last week.
The DWP have said that the full figures of those affected will not be ready for "probably another couple of month" reports the BBC.
Previously the DWP have said that 40,000 household will eventually be hit.
The cap takes money from housing benefit and the limit is based on adding up welfare payments such as JSA and child benefit.
For single adults the cap is £350 a week.
The Secretary of State for Work and Pensions, Iain Duncan Smith, said: "Benefits should be a safety net - but not something that gives claimants an income out of reach of many hard-working families.
"We have now successfully delivered a cap on benefits so that out-of-work households know they can no longer claim more than the average family earns and we have returned fairness to the benefits system."
Image source: http://www.sxc.hu/photo/1020195
By Laura Matthews
NHS BOSS SETS OUT A CASE FOR CASH BOOST
The speech by Mr Stevens at the NHS Providers' annual conference of health managers is being made at the time when three reputable health think-thanks- the Health Foundation, the King's Fund and the...
By Abimbola Duro-David
THERESA MAY PLEDGES TO REPLACE THE MENTAL HEALTH ACT 1983
According to Ms May, the new bill would introduce the following:According to the Tories, the proposals were described as the biggest change to mental health treatment law in over 30 years.Ms May...
THE PRESENT FIRST PRIME MINISTER OF SCOTLAND IS TO PLEDGE AGAINST ANY PLANS TO PRIVATISE THE NHS
It is also expected that Sturgeon will do the following as proof of her party's commitment to fighting against further austerity:Sturgeon said this before Tuesday's manifesto launch:"While the polls...
402 MILLION POUNDS WILL BE INVESTED IN COUNCILS WITH THE GREATEST HOMELESSNESS DEMAND FROM APRIL 2017
Presently, funding is only used for homeless households and not for the prevention of homelessness in the first instance.The funding by the Department for Communities and Local Government is set to...
RULES AROUND PERSONAL INDEPENDENCE PAYMENTS MAY CHANGE ON THURSDAY
Ministers have advised chief executives of over 30 charities which claimed that people will be left without vital financial support, to restrict access to a disability benefit.The Disability Benefits...
THE GOVERNMENT HAS BEEN URGED BY THE BMA TO INCREASE HEALTH SPENDING BY 10 BILLION POUNDS
This increase in health spending to a proportion of GDP that matched that of the 10 leading economies across Europe could pay for at least 35,000 extra beds a day and many more GP's, according to the...
MANY DOMESTIC VIOLENCE REFUGES AT RISK OF CLOSING DUE TO HOUSING BENEFIT CAP
Women who have been victims of domestic violence as well as their children are at risk of falling into the hands of their violent partners if the government caps housing benefit in the social sector...
Data on disability benefits refused by DWP
DWP officials have refused a second request for basic information on disability benefits using the “Section 22” exemption they used previously, reports The Independent.The Department had been...
UN to investigate how welfare reforms will affect disability rights
A disability charity in Scotland has said it’s been contacted by the UN’s Committee on the Rights of Persons with Disabilities as part of an inquiry into Britain’s treatment of people with...
Benefit cuts affecting 48,500 families in Liverpool
Analysis from Liverpool City Council has found that around 48,500 households are likely to lose their benefits due to new government reforms, reports the Liverpool Echo. Councillor Jane Corbett has...
Responding to the DWP Consultation: Housing Benefit Reform - Supported Housing "I thought this briefing was very good and very useful. The presentation was clear, well argued and I always find Michael gives me food for thought even if I don't agree with everything he says. I really like the way he facilitates a discussion in the room and I learn as much from other participants as I do from the presenter which is always good. Right length, right tone." R.P. - Richmond Fellowship
"RT @mpattersonltd: My new blog post from https://t.co/7iNaoHyKy0: (2 min read) Using Commercial & Retail Space for Reconfigured Supported H…" read more
"The latest Invest In Prevention! https://t.co/3LQqMNMAzg Thanks to @wookat1983 @paularobeson @Johnnyfstoke #covid19 #vienna" read more
Sorry this form requires that you have JavaScript enabled in your browser. Please enable it if you can and reload this page to proceed thanks.
Briefing Signup
* Please include this!
© 2021 Support Solutions UK - All rights reserved
Dove House
Tregoniggie Industrial Estate
TR11 4SN
info@supportsolutions.co.uk
T: 0333 332 1991 (Local rate)
Company Registration No. 08964700 - VAT No. 183727874 - Registered in England and Wales
|
cc/2021-04/en_middle_0021.json.gz/line2153
|
__label__cc
| 0.524965
| 0.475035
|
This website uses cookies to help us give you the best experience when you visit our website. By continuing to use this website, you consent to our use of these cookies.
- Any -NoYes
by Peter Kubelka, Fiona Duncan, Justin Polera, Tobias Rehberger, & Johanna Meyer-Grohbrügge
“In 1981, I had an interesting encounter with the design industrialist Alberto Alessi. He had invited me to his symposium in Berlin where he gave all the participants – people related to design such as Hans Hollein, Peter Cook, and Jean-Charles de Castelbajac – his coffee maker, the famous one designed by Richard Sapper, who was also there. I made coffee with it, and it was thin and watery, not really drinkable. Alessi didn’t believe me, but you could tell by his reaction that he had never made coffee with it. He said: The designer and the technician are also here, we’ll do a test now. We bet on the most expensive wine and started making coffee…”
– This text appears in Spike #59. You can buy it in our online shop –
Fiona Duncan
Justin Polera
Johanna Meyer-Grohbrügge
Installation View “what fruit it bears”, Peres Projects, Berlin; front: Vojtech Kovarik, Laocoon, 2020, Acrylic, spray paint and sand on canvas, 220 x 200 cm
New Fauves
“what fruit it bears” at Peres Projects, Berlin
Patrick Panetta, Café Durban, 2020, HD Video and sound, 00:04:05 min.
Daata Art Fair
COLIN LANG spent a few hours at the Daata Art Fair and thinks you should too!
Still from Ingmar Bergman, The Seventh Seal, 1957
THE DOWNWARD SPIRAL: 2020
DEAN KISSICK reviews a long year.
All images, Stills from Flavio Mogherini, The Pyjama Girl Case, 1977, 103 min. (Zodiac Produzioni)
Falling Out: Yellow PJs
COLIN LANG’s on the trail of Gialli, the Italian mystery/horror b-genre that spawned classics like The Pyjama Girl Case (1977). Timely or not, it’s a riot.
Coco Mademoiselle Perfume, Ceramics by Seth Bogart
FOR IMMEDIATE RELEASE: THE KAITLIN PHILLIPS HOLIDAY GIFT GUIDE
The holidays are upon us once again, and for this month’s column, KAITLIN PHILLIPS’s forty closest friends have the perfect thing in mind. Links included and you should definitely open them all!
Glitch Feminism by Legacy Russell
Legacy Russell’s Glitch-y CyberSomatics, A Fourth Wave Feminist Manifesto
Folio of Adam and Eve expelled from paradise from the Dispersed Falnama (Book of Omens), ca. 1550. Arthur M. Sackler Gallery, Washington, DC.
The Downward Spiral: Centrist Dad Ouroboros
A lot’s changed in New York since we last heard from Dean Kissick in October. A president was elected and fresh plywood added to store façades, quickly blanketed in new graffiti hearts. Hope and the 5G conspiracy are pretty tricky things.
Lorna Simpson, Woman on a Snowball, 2018. © Lorna Simpson. Courtesy of the artist and Houser & Wirth; all images © Palazzo Grassi, photography Marco Cappelletti
“Untitled, 2020. Three perspectives on the art of the present” at Punta della Dogana, Venice
Untitled, Hair, glue, 75 x 70 x 11 cm
The Things We Leave Behind
Michael E. Smith at the Vienna Secession
Installation view “On Adornments“, 2020, Spike Berlin
Between Friends – Interview with Marian Ivan & Olga Temnikova
Spike Berlin has been host to a collaborative show between Ivan Gallery, Bucharest, and Temnikova & Kasela Gallery, Tallinn. Before the final days of the group show, we spoke to the gallerists about the situation in their home countries, and how the show “On Adornments” came together.
Philip Guston, Riding Around, 1969, Oil on canvas, 137 x 201 cm; Courtesy Hauser & Wirth
Falling Out: There’s No Place Like America Today
There’s been a debate raging about the postponement of a massive Philip Guston retrospective at four different museums. So, naturally COLIN LANG has to throw his yarmulke into the ring.
Manage display
"My works are the most sincere and tragic things I have done in life"
"If I tell you I have to kill you with my laser vision"
Spike Events
Spike Editions
Here’s what we wanted: a deep, personal, painful appraisal of the art world as we know it. Some of us hate it, some love it, and many depend on its continued survival. When we posed this to our writers, they threw the kitchen sink at us: folklore, failure, fantasy, and wait for it ... God! It’s the Therapy Issue. And we’re still blaming...
#66 Winter 2020/21
Order 14 €
© 2021 Spike Art Quarterly
#59 Spring 2019
|
cc/2021-04/en_middle_0021.json.gz/line2156
|
__label__wiki
| 0.946802
| 0.946802
|
Global coronavirus cases surpass 60 million infections
People walk past Macy's Herald Square store in New York, on Nov 24, 2020.PHOTO: AFP
https://str.sg/JbRt
WASHINGTON (REUTERS) - The global tally of confirmed coronavirus cases hit 60 million on Wednesday (Nov 25), with the pace of new infections accelerating and the United States reporting record numbers of hospitalisations, according to a Reuters tally.
Officials in the US, the worst-affected country in the world, urged Americans to stay home for the imminent Thanksgiving holiday as soaring numbers of Covid-19 patients pushed medical professionals to the brink.
The United States has reported 1 million new Covid-19 cases in less than a week, taking its total reported infections to over 12.5 million and its death toll to 260,000, according to the Reuters data based on official statements.
Globally, infections stood at 60.005 million and deaths at 1.4 million. An analysis of the Reuters data showed the rate of new infections picking up globally. It took just 17 days to go from 50 million cases to 60 million, compared with the 21 days it took to go from 40 million to 50 million.
Around 580,000 cases have been reported each day over the past week and around half of all cases since the start of the pandemic were reported over the past 70 days.
In Europe, 1 million new cases were recorded over just five days, for a total of more than 16 million cases, including 365,000 deaths.
Governments across Europe are struggling to impose restrictions on public life while allowing families to celebrate Christmas without further fuelling outbreaks.
While a national lockdown in England is due to end next week, Germany, Spain, and Italy have all announced restrictions over the holiday period, including limits on house guests.
The Latin American region has the highest number of reported deaths in the world, representing about 21% of all global cases and over 31% of all global deaths reported.
Brazil last week joined the United States and India as the only countries to have recorded more than 6 million infections.
With almost 170,000 confirmed fatalities, Brazil has the world's second-highest death toll.
While India remains the second-worst affected country in the world with almost 9.2 million cases, it has continued to report a slowdown in new cases in recent weeks.
It has reported an average of around 44,000 cases a day over the past week, well down from a peak of just under 97,900 cases in mid-September.
Asia-Pacific countries such as China, South Korea, Singapore, Australia and New Zealand had shown how rapid, local, and intrusive steps can be effective in extinguishing outbreaks.
All travellers to S'pore need to take Covid-19 PCR test on arrival from Jan 25
Norway warns of Covid-19 vaccination risks for sick patients over 80
Should I get the Covid-19 vaccine? What you need to know
Britain orders all arrivals to quarantine, provide negative tests as Covid-19 deaths rise
WHO stops short of advising proof of Covid-19 vaccine shots for travel
WHO-led team in China will start meetings online from quarantine
Missionary school emerging as new Covid-19 hotbed in South Korea
Thailand offers its lush golf courses as quarantine centres to woo tourists
3 in 4 Covid-19 patients suffer from at least one symptom six months after infection: Study
Philippines extends travel ban to prevent spread of more contagious coronavirus variant
|
cc/2021-04/en_middle_0021.json.gz/line2160
|
__label__wiki
| 0.638623
| 0.638623
|
Freeview Records Biggest Sales Month Since Launch
Monday, 14 February 2011, 1:44 pm
Press Release: FreeView
PRESS RELEASE: 14th February, 2010
The popularity of free-to-air digital television and radio service, Freeview, continues to increase following the biggest month of Freeview sales since the company began in 2007.
Sales figures show 34,928 Freeview receivers were sold across the country during December. The majority of these were TVs with Freeview|HD® built-in, and sales of MyFreeview Digital Television Recorders also continue to grow progressively.
Sales for the last quarter of 2010 are also impressive, with 78,700 Freeview receivers sold, up from 58,417 in the third quarter of 2010. Of these, 11,706 were Freeview satellite receivers and 66,994 were Freeview|HD® receivers.
“The Government’s digital switch-over campaign launched late last year has had a positive impact on sales volumes. We’re encouraged by the strong progress made even though we are still over 18 months out from the start of the digital switch-over,” says Sam Irvine, General Manager, Freeview.
Freeview has grown the number of channels available on its platform to a total of nineteen with the recent launch of TAB Trackside on Freeview|HD®. This means thirteen or fourteen TV channels (depending on location) plus three radio channels are available on Freeview|HD®, and Freeview Satellite offers fifteen TV channels with an additional four radio channels Stratos will be launching in March on Freeview|HD® and both TVNZ and TVWorks are making changes to their digital TV offerings.
“It’s fantastic to see Kiwis embracing Freeview and enjoying crystal-clear pictures, new channels and world-class digital technology for free. This year Freeview users will get the added benefit of watching all 48 Rugby World Cup matches, with all the All Blacks’ matches being shown live and for free on Freeview. We have also partnered with a national installer group to provide a one stop set-up and installation service. So now its even easier for analogue viewers to get free digital TV installed in their home,” he adds.
Find more from FreeView on InfoPages.
|
cc/2021-04/en_middle_0021.json.gz/line2163
|
__label__cc
| 0.5499
| 0.4501
|
JANUARY @ SCT: THE BUSINESS OF TRANSFORMATION
With a new year comes change and the opportunity for new beginnings - and while we may not be penning and tracking resolutions, SCT is certainly in the business of transformation.
We believe in the transformative power of live theatre and that when we are all able to gather together in shared space to experience art, magic happens.
We believe in the power that comes with the ability to adapt and we applaud the families and artists who have so beautifully adapted to the changes in our world in the last year. To the teaching artists and educators who have found ways to keep creativity alive in a virtual space, we salute you!
Most of all, we believe that every child has the ability to grow through creativity, empathy, hope and joy. And we’re here to help!
With this we say to you: Happy New Year from SCT! May it be filled with magic, art, and more brilliant transformations to carry you onto the next. Read on to hear how SCT continues to grow and inspire transformation in the youth of our region.
HELP SCT FUEL TRANSFORMATION
Join SCT on February 5 to celebrate the legacy and bright future of Seattle Children's Theatre. We invite you to spend time with the actors, leaders, supporters, and friends of SCT for an evening filled with joy and enthusiasm for SCT.
What is Fueling Transformation? It is the power of storytelling and live theatre that fuels our young people to reach for the stars. A place where they learn empathy, ignite their curiosity and find inspiration.
6:00 p.m. Virtual Program Begins with host Don Darryl Rivera
Registration is free! With benefits for sponsors and sponsor ticket buyers.
TRANSFORM YOUR LIVING ROOM WITH WINTER DRAMA CLASSES
New Year, infinite possibilities. During a time when you may not be able to leave your living room, SCT Virtual Drama Classes are here to transport you to a different world. Join SCT Teaching Artists as they lead students on epic adventures built from play and creativity, all from the comfort of a zoom room! Trust us, this is the good kind of screen time.
Classes are running January 15 - February 6 and February 12 - March 6 with titles like:
Tablecloth Theatre
Creating Character
NEW MASTERCLASS SERIES: MEET YOUR INSTRUCTORS
Transform your professional skills and creative muscles this winter! This Master Class Series is for performers age 14-18 looking to enhance their performance skills and prepare for college and professional auditions. Students will be guided by professionals from across the nation covering the following topics: Audition and Casting Process, Monologue Preparation, Advance Acting Technique, and Business of the Business.
Meet Your Instructors Khalia Davis, Rudy Ramirez, Melissa Firlit, and Kristopher Thompson-Bolden.
SCT @ HOME: TRANSFORMATION ACTIVITIES
Some of our favorite characters from past SCT productions know all about what it means to transform! Check out these activities from SCT @ Home featuring The Very Hungry Caterpillar, The Miraculous Journey of Edward Tulane, and Where the Wild Things Are.
TRANSFORM A TEACHERS NEW YEAR WITH THE GIFT OF SCT
DID YOU KNOW? SCT’s Community Engagement programs bring actors, teaching artists, and other theatre professionals into schools, homes, and communities where they use theatre exercises to explore a variety of common core lessons, and we’re prepared to do it all in a virtual space.
That’s right, SCT can come right to your classroom! Say thank you to your teacher and give them the gift of SCT to start the New Year off right.
START THE ADVENTURE
Activity 1: Movement Activity for the whole family from The Very Hungry Caterpillar
In The Very Hungry Caterpillar, the hungry caterpillar eats its way through many foods to transform into a butterfly. In this exercise, everyone will build their imaginations by engaging in creative movement and play to learn the life cycle of a caterpillar.
Download the Activity
Activity 2: Drawing/Create Your Own Edward activity from The Velveteen Rabbit
In The Miraculous Journey of Edward Tulane, everyone who meets Edward transforms him into what they need him to be. By helping them through different challenges, he is rewarded with new experiences and learns to love others. Here is a china rabbit of your very own, waiting to transform and go on a journey.
We want to see your finished designs! Take a picture of your drawing and comment below or tag us with #sctathome to be a part of the conversation. In The Miraculous Journey of Edward Tulane, everyone who meets Edward transforms him into what they need him to be. By helping them through different challenges, he is rewarded with new experiences and learns to love others.
Here is a china rabbit of your very own, waiting to transform and go on a journey.
Activity 3: Mask Making activity from Where The Wild Things Are.
Transform your self with the help of a mask! These masks are waiting for you to bring them to life. Or you can draw a new one. Have fun coloring and decorating them. Then put one on and have a rumpus of your own.
We want to see your finished masks! Take a picture of your creations and comment below or tag us with #sctathome to be a part of the conversation.
12/15/2020 Comments
MEET YOUR INSTRUCTORS: Master Class Series
Build your professional skills and maintain your creative muscles this winter! This master class series is for young performers age 14-18 looking to enhance their performance skills and prepare for college and professional auditions. Students will be guided by professionals from across the nation covering the following topics: Audition and Casting Process, Monologue Preparation, Advance Acting Technique, and Business of the Business. *There are no prerequisites required, but we strongly recommend students to have taken Acting I and Acting II prior to this class.
KHALIA DAVIS
Khalia Davis (she/her) is a bicoastal multidisciplinary artist splitting her time between the San Francisco/Bay Area and New York. Recently named Artistic Director of Bay Area Children’s Theatre where she led the premiere of A Kids Play About Racism, based on A Kids Book About Racism by Jelani Memory, creating a new hybrid between live theatrical storytelling and film. This work brought together over 40 theater producing partners and was viewed on Broadway on Demand nearly 80,000 times during its limited run. Now it lives on as a free resource for educators and their students. Directed and devised other new works like the award-nominated world premiere, She Persisted the Musical, based on the popular children's book by Chelsea Clinton with Bay Area Children’s Theatre as well as other prominent theaters: Atlantic Theater Company’s Atlantic for Kids, New York City Children’s Theater, Disney Theatrical Group, Spellbound Theatre and more. As a producer, Ms. Davis has helped organizations reach hundreds of thousands of young people through, interactive “edu-tainment” with the nationally known Story Pirates, generating new digital pre-school content with Spellbound at Home, and a new children’s web series chronicling the experiences of a little black puppet girl named Nia living through the COVID-19 pandemic with her personal web-based company, Kids at Heart Productions. Before assuming her new role as Artistic Director, Ms. Davis served as the Director of Inclusion and Education with Brooklyn Children’s Theatre restructuring their children’s musical theater programming through an anti-racism lens. BA in Theater Arts from the University of Southern California www.khaliadavis.com!
Rudy Ramirez (they/them) is a Brooklyn-based multidisciplinary artist, director, deviser, and arts educator. An Arizona State University alumnus, Rudy's first artistic home was at Childsplay in Tempe, AZ, where they served as an ensemble member and teaching artist for a number of seasons. Some of their favorite Childsplay projects include The Yellow Boat, Tomas & the Library Lady (national tour), and The Smartest Girl in the World. Rudy then moved on to the east coast, where they began working as a teaching artist with a focus on devised work with young people that explores personal identity, origins, and worldview. To that end, they facilitated residencies through Ping Chong + Company's Secret Histories Education program in New Jersey and New York schools. Additionally, Rudy created and developed the Devised Theatre program, centering the same social justice themes and explorations, for the New Jersey Performing Arts Center's YASI: Young Artist Summer Intensive. Most recently, Rudy served as the Director of Education for The Magik Theatre in San Antonio, TX. Rudy firmly believes in the transformative power of storytelling, art-making, and theatre for all.
MELISA FIRLIT
Melissa Firlit (she/her) was nominated for 3 Henry Awards by the Colorado Theatre Guild for her 2019 production of Jekyll & Hyde at the Pagosa Springs Center for the Arts. Her theatre company, Resolve Productions, received the 2020 Open Space Grant at the Episcopal Actors Guild for Marrow by Brian Quirk, which also had a run at the 2019 Edinburgh Fringe Festival. Recently she directed Analyze Zoom by Nandita Shenoy at Mile Square Theatre’s online fall series, where prior to “pandemic pause” she directed 5 Times in One Night by Chiara Atik. She directed the Ireland National Tour of Misterman by Enda Walsh. Melissa’s work has been seen nationally at 59East59th, Denver Center for the Performing Arts, New Light Theatre Project, The Princeton Festival, Creede Repertory Theatre, Pagosa Springs Center for the Arts and more. As part of her personal commitment to collaboration with playwrights, Melissa is the Artistic Director for the Thingamajig Playwrights Festival which provides a hands on development opportunity over the course of a ten day residency to two playwrights. Her favorite part of that festival is the Youth Playwrights Festival which brings to life the plays of young artists in the community with a professional team. To provide up and coming thespians with the same passion she thrives on, Melissa helmed a Musical Theatre Bootcamp Program at The College of St. Rose for 8 years. She is currently on faculty at Molloy College/Cap 21 Theatre Arts Program and National Theater Institute (NTI) at the Eugene O’Neill Theater Center. Training: MFA, Rutgers University, BA, The University of Hartford and National Theater Institute. Member SDC. www.melissafirlit.com.
THOMPSON-BOLDEN
Kristopher Thompson-Bolden (he/his) has spent the last 2 and a half years performing in the Australian and New Zealand premier of the hit musical The Book of Mormon!! His other credits include: Mamma Mia at The Hollywood Bowl, Dear World starring Tyne Daly, Anything Goes Revival directed and choreographed by Tony Winner Kathleen Marshall, Billy Elliot, The Color Purple starring American Idol Winner-Fantasia, and he also played CJ in the World Premier of the musical The Nutty Professor directed by the late legendary comedian Jerry Lewis. In addition to performing he has taught for Joffrey Musical Theatre Intensive in NYC and South Africa.
MATI RAFAEL CARDINALE
Mati Rafael Cardinale (she/her, they/them, he/him) is an emerging teaching artist who feels incredibly blessed to be a part of the SCT family. A queer immigrant from Venezuela, they use their life experience to work with immigrants and members of the LGBT community, striving to use theatre to bolster and comfort these groups in a society that marginalizes them.
SCT @ Home for the Holidays!
SCT @ Home is back this December with some favorite at-home drama activities - this time with a winter flare! Perfect for young ones who are out of school, these activities are designed to gather loved ones together, get everyone laughing, and bring imagination, innovation, and creativity alive in our homes. Check out the links below for drama activities, games, coloring pages all inspired by our past holiday performances!
Activity 1: Big & Small drawing activity from The Velveteen Rabbit
Toys are all around us this holiday season, but what if you were a tiny human amongst all the toys!? Use your imagination (and your art supplies) to create a story or drawing about or a small human trying to find a place in a big toy world.
We want to see your finished stories! Take a picture of your drawing and comment below or tag us with #sctathome to be a part of the conversation.
Activity 2: The White Witch's Statue Garden from The Lion, The Witch, and The Wardrobe
Nothing says winter in Narnia quite like the White Witch and her evil spell that makes it all winter, all the time. Ban together with your fellow "statues" and collaborate as a team to surround her and break the wicked spell, allowing winter to come to and end!
Activity 3: Making Tracks in the Snow with Peter from The Snowy Day
The best part about snow is.... playing in it of course! While there may not be real snow on the ground, you can use your pencil to imagine all the fun tracks you could make and draw the patterns. Bonus points if you take it one leap further and use your body to bring the foot patterns you drew to life! Even more bonus points if you share the fun with someone else!
We want to see your creations! Take a picture of your drawings or a video of you in action and comment below or tag us with #sctathome to be a part of the conversation.
Activity 4: Penguin March from Mr. Popper's Penguins
Penguins aren't the only animal that lives where it is very cold! Take a page out of Mr. Popper's expedition book and delve deep into what other animals make their habitat amongst the snow and take turns bringing those animals to life in your living room! Let the expedition begin!
Activity 5: Button Search and Find from Corduroy
HELP! Corduroy has lost his button in the toy shop and he needs your help to find it! See if you can find all 10 buttons hidden in this coloring page and then let your imagination go wild and turn this coloring page into a true masterpiece!
We want to see your finished drawings! Take a picture of your drawing and comment below or tag us with #sctathome to be a part of the conversation.
12/5/2020 Comments
THE GIFT OF THEATRE: DECEMBER @ SCT
As the weather grows cold and the year comes to a close, we’re embracing the season of giving. And what better way to bring us all together than through the gift of theatre.
Theatre inspires our creativity, encourages community, and connects us through shared experiences. Through the help of donors, drama school families, audience members, like you, SCT has kept the spark of theatre alive even with the house lights down.
This month, read on to learn what SCT is planning for December and how each of us can participate in spreading the gift of theatre this holiday season.
ON-SALE NOW: WINTER DRAMA SCHOOL CLASSES
Winter is here! Well… Winter Drama Classes are here. Register now for your favorite class titles - back virtually this winter by popular demand. A virtual drama class is a great way to stay creative, and connect with friends - invite a sibling, classmate or cousin across the country to take a virtual drama class with you! Better yet, gift them a class as a special holiday treat.
Classes are running January 15 - February 6 and February 12 - March 6, including Story Drama, Musical Theatre, Improv, Master Class Series, and MORE!
SAVE THE DATE: FUELING TRANSFORMATION 2021
Join SCT for our Annual Fundraiser and help us continue to give the gift of theatre for years to come. This happy hour timed event will be a one-hour virtual celebration of SCT’s legacy and bright future. We invite you to spend time with the actors, leaders, supporters, and friends of SCT for an evening filled with joy and enthusiasm for the power of live theatre.
5:30 p.m. Breakout Room Happy Hours Begin
GIVE YOUR TEACHER THE GIFT OF SCT
I think you’ll agree with us when we say, educators are superheroes. And right now, they’re tired! Teachers have been working tirelessly to keep their students engaged and enthusiastic about their education while also making sure they’re staying safe. This holiday season, why not give your child’s teacher a break and let SCT do some of the work?
SCT’s Community Engagement programs bring actors, teaching artists, and other theatre professionals into schools, homes, and communities where they use theatre exercises to explore a variety of common core lessons, and we’re prepared to do it all in a virtual space.
GIFT IDEAS FOR YOUNG THESPIANS
The holidays are here and what better way to spread cheer to the young people and families on your list than the gift of SCT. You might be surprised to learn of the many ways you can use an SCT gift certificate, so allow us to help you give a gift that will garner a standing ovation.
GIVE THE GIFT OF THEATRE
SCT INTERNSHIP APPLICATIONS CLOSE JANUARY 8!
Seattle Children’s Theatre is one of the largest professional children’s theatres in the US and each summer, SCT Education Programs offer over 15 internship positions to support Drama School programming including nearly 200 camps and classes for students ages 3½ -18, partnership camps across the city, and programming for the upcoming season and school year.
The Internship Program is an exciting opportunity to develop hands-on experience in theatre education through classroom observation, teaching artistry, and arts administration or content marketing, while building professional relationships in the field. In addition, interns receive professional development opportunities to increase proficiency in theatre and education.
A GIFT FROM OUR TYA PARTNER - BAY AREA CHILDREN'S THEATRE
Screen-free Audio-Musical Adventures with a Storytelling Kit | Delivered Right to Your Home
Play On! is a new musical series of theater kits crafted in response to COVID-19 to continue to inspire creative learning and arts education around the country. The brainchild of our friends at the award-winning artistic team at Bay Area Children’s Theatre, these first released kits center on three original musical stories entitled, “Twinkle’s Musical Adventure,” “The Ice Cream Factory Fiasco: An Agent 11 Adventure” and “The Gingerbread Family” for kids of all ages. These musicals-in-a-box come complete with all the essentials kids and families need to create, listen to and participate in (screen-free) their own musical imagination adventure in their own home.
The holidays are here and what better way to spread cheer to the young people and families on your list than the gift of SCT. You might be surprised to learn of the many ways you can use an SCT gift certificate right now, so allow us to help you give a gift that will garner a standing ovation.
CAMPS AND CLASSES GALORE
Gift certificates can be used for any of our current or upcoming classes. Winter Session is on sale now and feature some of SCT’s most popular classes from the last year. From ages 3.5-18, our classes, taught by theatre experts and artists, that will inspire your young thespian to think critically about their creativity no matter the focus or goal.
CREATE YOUR OWN DRAMA ADVENTURE
Let your gift recipient take advantage of our newest offering where they determine their dramatic fate! Whether the focus is science, math, social justice, theatre arts or sensory drama, they pick the focus and the duration. The options are wide open, but we might suggest some of these fun ideas:
Take a 90-minute immersive adventure to the center of the earth during science class.
Book a 60-minute virtual acting class to celebrate a birthday.
Connect with your cousins across the country in an adventure tailored just for the family.
(Psst--this makes an excellent gift for your student’s teacher to use in the classroom as our classes are common core approved!)
SAVE IT FOR LATER
The value of an SCT gift certificate never diminishes or expires and they make the perfect gift for family and friends who enjoy the flexibility of all SCT has to offer. Put it to use today or hold onto it and use it to see your favorite show during our next season of theatre.
GET TO GIFTING!
SCT RECOMMENDS: THINGS TO DO AND READ THIS NOVEMBER
Welcome to SCT Recommends, where we are sharing what members from the SCT community are enjoying, watching, reading, or listening to during this time! Johamy Morales, SCT's Director of Education is also enjoying some fun things which you can learn about below, along with her recommendations on how to keep creativity alive in your home.
The Nepantla Cultural Arts Gallery
A couple of weeks ago I stopped by an art gallery called The Nepantla Cultural Arts Gallery, a multi-use accessible cultural arts gallery located on the border of West Seattle and the White Center neighborhood. They host monthly art exhibitions focused on marginalized communities and communities of color, while offering an ever growing gift shop with unique collection of apparel, jewelry, handmade gifts, and amazing works of art by local and national artists. We are located at 9414 Delridge Way SW Seattle WA 98106.
Nepantla is a Nahuatl (Aztec language) term which describes being in the middle or the space in the middle. The term was popularized by Chicana writer/scholar Gloria Anzaldua. Most often the term references endangered communities, cultures or gender who due to colonialism/marginalization or historical trauma, that engage in resistance strategies of survival. Nepantla becomes the alternative space in which to live, heal, function, and create.
I invite you and your family to explore and support this local gallery as they prepare for a new exhibit this thanksgiving holiday season.
How We Show Up by Mia Songbird
This past month I read How We Show Up: Reclaiming Family, Friendship, and Community and I was left moved and inspired by Mia Songbird's words of wisdom. After almost every presentation activist and writer Mia Songbird gives to executive, think tanks, and policy makers, one of those leaders quietly confesses how much they long for the profound community she describes. They have family, friends, and colleagues, yet they still feel like they’re standing alone. They’re “winning” at the American Dream, but they’re lonely, disconnected, and unsatisfied. Through research, interviews, and stories of lived experiences, How We Show Up returns us to our inherent connectedness where we find strength, safety, and support in vulnerability and generosity, in asking for help, and in being accountable, while leading us to liberation.
Lately I have been reflecting on the amount of stress and challenges that our parents, caregivers, and educators are navigating in this time. Give some self-care to yourself! Carve a little time to read a book. Our children look to us, the adults, in these unprecedented times and it is important for self-care in order to care for those we love.
It takes a village to care for our youth!
WHAT VOICES ARE YOU BRINGING TO THE DINNER TABLE? | A LIST OF RESOURCES
Join SCT in utilizing this list of resources to continue the expansion of diverse voices and storytellers you and your family are reading, watching, and listening to as we go into this holiday season.
Know of other resources that should be included? Let us know in the comments below.
Food is where we meet, where we build, where we struggle, and where we survive. -Peoples Kitchen Collective
My family is not religious, but when we eat dinner together, we give thanks. We include the rain, the sun, the moon, the soil, and the wind. Our gratitude starts with "Thank you to all the hands that touched this food on its way to our table." It's meant to acknowledge not just my husband or me, who cooked the meal, but everyone from the farm to the grocery store to our home who grew, harvested, fed, slaughtered, transported, stocked, and bagged the food in our meal. It's meant to acknowledge that it takes a lot of labor from many, many people for us to eat. It's meant to make visible the people we are connected to through our meal. -Mia Birdsong from How We Show Up; Reclaiming Family, Friendship, and Community
Thanksgiving from the Native American Perspective:
A List of 32 Native American Children's Books - Coloursofus.com
7 Thanksgiving Books for Kids Written from the Native Perspective - coolmompicks.com
3 Children's Books About Thanksgiving from Native Perspectives - Medium
How to Talk to Your Kids About Thanksgiving - NPR
Thanksgiving Lesson Plan Booklet from a Native American Perspective
Indigenous Artists & Organizations:
Red Eagle Soaring: Native Youth Theatre
Ty Defoe
Larisa FastHourse
Indigenous Direction
New Native Theatre
A Kids Play About Racism: Check out the resources developed for your family to engage on the topic of racism
A Kids Play About Racism official site
Active Audience Guide - curated activities for Pre K - 5th grade students, and tools to help you continue the conversation around racism.
A Kids Play About Racism: Timeout W/ Brodrick Podcast - During this episode, SCT Education Coordinator Brodrick Ryans interviews Khalia Davis, Davied Morales, and Justin Ellington who are all a part of the creative team for A Kids Play About Racism.
A Kids Book About Racism - Read and purchase the book by Jelani Memory that inspired the creative team to have conversations about racism and to bring these essential discussions to families in a new way.
Podcasts for Parents and Guardians:
Talking Race With Young Children: a podcast from Sesame Workshop and NPR
WHAT WILL YOU HARVEST?: NOVEMBER @ SCT
November is a time to gather with loved ones, share joy, and reflect in gratitude. And let’s be honest… it’s also about delicious food we share in community. As we look to the next month, we’re thinking about the word harvest- the hands that worked to harvest the food at the dinner table, our ability to harvest ourselves physically, mentally and emotionally, and how we harvest the spirit of community as we give thanks to one another.
Read on to see all the fun ways we plan to engage and support our community this month by harvesting creativity, compassion, and action.
We would love to hear from you! What will you harvest in November to stay engaged, active and creative? Let us know on social media!
BUILD YOUR OWN CREATIVE ADVENTURE
Harvest creativity right from your living room with SCT’s Community Engagement Programming! While we may not be able to gather in person, did you know SCT can come to you?
Are you interested in a 90-minute immersive adventure that takes students to the center of the earth during science class? How about a 60-minute virtual acting class to celebrate a birthday? Maybe you’re looking for a way to connect your child to a cousin across the country, why not get creative via zoom with SCT?
Whenever, whatever occasion, and however long, SCT is here to help you build your own theatre adventure.
DRAMA SCHOOL CLASSES... COMING SOON!
Have any plans this January? Well, now you do. SCT Drama School Classes are coming back virtually. We’re excited to get creative and tell stories with you! Keep an eye out for an announcement later this month.
SPOTLIGHT ON: WASHMASKS: HEART OF WASHINGTON MASK DRIVE, WASHABLE MASKS FOR WASHINGTON FARMS
What it is: WashMasks is a cooperative mutual aid founded by artists, arts educators, and teachers with the focus on providing support and advocacy for Washington farm workers and their families.
Since April, the volunteers of WashMasks have gathered and distributed nearly 17,000 masks, over $2,000 in school supplies, 20 full shipments of food, bedding, infant care, and paper goods; and $1,000 in cash donations for farm working communities affected by Covid-19 and the wildfires.
How YOU Can Help: Adult and children’s masks are greatly needed! Learn how to make masks from home and donate to WashMasks here.
Looking to donate in other ways? Donate to Seattle Rep’s Food and Mask Drive
SEW THE SEEDS OF GIVING
Feeling grateful for 45 years of SCT? Celebrate by giving $45 today to ensure 45 more years of sparking joy, encouraging empathy and building community for our region's youth. And don’t forget! Now through the end of the year, any gifts of $100 or more will receive a free ticket to SCT’s next Season of Theatre.
WHAT VOICES ARE YOU BRINGING TO THE DINNER TABLE?
Learn how to expand the range of voices and storytellers you and your family are reading, watching, and listening to as we go into this holiday season.
Food is where we meet, where we build, where we struggle, and where we survive. - Peoples Kitchen Collective
My family is not religious, but when we eat dinner together, we give thanks. We include the rain, the sun, the moon, the soil, and the wind. Our gratitude starts with "Thank you to all the hands that touched this food on its way to our table." It's meant to acknowledge not just my husband or me, who cooked the meal, but everyone from the farm to the grocery store to our home who grew, harvested, fed, slaughtered, transported, stocked, and bagged the food in our meal. It's meant to acknowledge that it takes a lot of labor from many, many people for us to eat. It's meant to make visible the people we are connected to through our meal. - Mia Birdson from How We Show Up; Reclaiming family. Friendship, and Community
View and contribute to a list of resources, books, TYA plays and more here.
CREATE YOUR OWN NOT SO HAUNTED HOUSE
So do we! For the last 20 years, SCT Drama School students have imagined and created their own version of a (not so spooky) haunted experience for SCT staff, teaching artists and family members to enjoy.
Since we can’t be together in SCT’s classrooms to experience the spooks in person, now is your chance to bring this tradition to life in your living room. See below for the potion on how to craft your own Not So Haunted House and take a look back at years past.
Step 1: The most important step in creating the perfect Not So Haunted House is your creativity. Use your body, your voice, and your imagination to craft the perfect spooky setting! Ask yourself: Who are you? A witch? A pirate? A ghost? Where are you? A graveyard? A pumpkin patch? The forest?
Step 2: Grab whatever items you have around the house that will help you bring your spooky tale to life. Those couch cushions would make great gravestones! Is there a creature lurking in lake bathtub? Dad’s coat sure looks like a headless monster! Who knows what’s lurking around the corner in the kitchen...the possibilities are endless!
Step 3: Tap a friend or a sibling to help tell your story! They can be a new character or help to guide unsuspecting adults through your haunted path.
Step 4: It’s showtime! Gather all who dare to enter your domain. Dazzle and delight with your spooktacular tale!
Step 5: Remember, this is a Not So Haunted House. Make sure to find a creative way to reveal to your visitors that it’s all pretend! Halloween is the perfect time for tricks, but they’ll love this treat.
We can’t wait to see what you create! Send us photos at hello@sct.org or tag us @sct_seattle on Instagram and Facebook for a chance to be featured on SCT’s social channels.
Happy Haunting!
In need of further inspiration? Take a look into 2 SCT classrooms from haunted years past!
GET GHOULING
WATCH IF YOU DARE
DO YOU MISS SCT'S ANNUAL NOT SO HAUNTED HOUSE?
SCT RECOMMENDS: FUN STUFF FOR YOUR FAMILY
We're sharing what members from the SCT community are enjoying, watching, reading, or listening to during this time! First up is Brodrick Ryans, SCT's Education Coordinator and a 2020 Emerging Leader with Theatre for Young Audiences USA (TYA/USA). He's also a bunch of other cool things, which you can learn about below, along with his recommendations on how to keep creativity alive in your home.
Hi, tell us about yourself.
I am the Education Coordinator at SCT and a 2020 Emerging Leader with Theatre for Young Audiences USA (TYA/USA). I am also a freelance artist, educator, and podcaster. I am originally from Alabama, and yes I am a huge Alabama football fan… ROLL TIDE!
My career in theatre started because of my older brother. We are a very sports-oriented family and we both played basketball. Going into 9th grade I think he noticed that I was feeling out of place and encouraged me to take a theatre class with him and his friends. For me, that was the true start, which is why I’m a huge advocate of theatre education in schools.
What has inspired you lately that you'd like to recommend to SCT families?
Well, I would love to say check out my podcast TIMEOUT w/ Brodrick *wink, wink*… but I would seriously recommend the book and play A Kids Play About Racism and A Kids Book About Racism. Both are great resources for the entire family on how to explain what is going on during the current social climate in America, and SCT develop the curriculum Active Audience Guide.
For parents, I would recommend the podcast Nice White Parents, which provides great insight to the American school system and the disconnect between ideals and reality.
How have you been staying creative during this time?
I have been pretty busy during this time working on two major projects that have been really important for me personally and professionally - A Kids Play About Racism and Voices of Change: A Virtual Play Reading Event.
Voices of Change was a partnership with Kaiser Permanente and TYA/USA to provide virtual readings of three Idris Goodwin plays. There were over 300 participants and a panel discussion about the importance of each work. This was the first time that I worked as a producer while providing educational input. I created the post-show exercise for students and collaborated with Thriving Schools national partners—including a colleague from Portland, OR—to make Voices of Change a success. I could talk about this project all day!
What do you miss most about live theatre?
The audience interactions and audible responses! There’s something so rewarding about watching and hearing an audience enjoy and respond to a great piece of theatrical work. Maybe we should write a show called The Year Theatre Took A Break? It would be a comedic tragedy.
ALL TREATS, NO TRICKS: OCTOBER @ SCT
This October, SCT is all about the fun and none of the fright.
Well… we guess we wouldn’t mind a few goofy skeletons and fun-loving ghouls, but no jump scares, okay?
During a time when the spooks can start to feel a bit overwhelming, we’re focusing on our favorite part of the Halloween season: treats. The creativity and community that surround SCT serves as a constant delight. And while we love a scary October story as much as the next Halloween lover, we’re letting our community partnerships, faithful families, and fellow theatres serve as nightlight to keep things bright when the world starts to feel a little dark.
So read on, and join us in celebrating community and indulging in some SCT treats this spooky season.
DIVE BACK IN: THE GHOSTLIGHT STORIES
It wouldn’t be Halloween without a few scares...right? Earlier this year, SCT actors, staff members, and families worked together to recreate their favorite spooky stories for a 10-part series called The Ghostlight Stories. These weekly 15-minute episodes took a look at things that scare us, thrill us and ignite courage. We’ve chosen 10 spook-tacular Ghost Light Stories for you and the whole family to revisit this month so keep an eye on SCT’s social accounts throughout the month for their release!
What’s your favorite scary story? We want to know! Send us a video of you, your friends, or your family recreating your favorite spooky tale for a chance to be featured on SCT’s Facebook page.
RELIVE YOUR FAVORITES
INSPIRATION: TOP 10 SCT CHARACTERS TO BE THIS HALLOWEEN
Stuck on ideas for this year's Halloween costume? We're here to help! Take a look below for 10 inspiring, goofy, and bold characters to dress up as this year from past SCT productions. Build your own boat and travel to where the wild things are as Max, ditch the dress and become your own princess like Snow White, or channel your courage and throw on your boxing gloves as Cassius Clay.
The options are endless!
A TREAT FOR SCT DONORS!
SCT is deeply grateful for the support we receive from our donors. As a special thank you, all those who give a gift of $100 or more between now and December 31, 2020 will receive a complimentary ticket valid for SCT’s next mainstage season. It is because of donors like you that SCT is able to continue using the power of theatre and arts education to grow empathy, spark joy, and invite young people to engage in the stories that surround us.
The next chapter of this story begins with donors like you. Won’t you give today?
BIG NEWS: A KIDS PLAY ABOUT RACISM NOW FREE FOR EDUCATORS
SCT, in partnership with 41 TYA Theatres across the country, is pleased to announce that A Kids Play About Racism is now available free of charge to classroom and homeschool educators around the world! In addition to the virtual experience, all education materials thoughtfully crafted by SCT education staff are also available to students and educators.
DON'T MISS OUT: SATURDAY MORNING STORIES WITH KING-FM
Do you miss seeing your favorite stories come to life on stage? So do we! But don’t miss a chance to hear your favorite stories come to life right in your living room with Saturday Morning Stories. SCT has partnered with Classical KING-FM 98.1 to bring beloved children’s literature to life through a crescendo of whimsical melodies and narrated plots. Hand selected titles take families on a classical music adventure where they can simultaneously engage in activities uniquely curated by SCT for each production that the whole family can enjoy.
Listeners can tune in at 8:30 a.m. through November 7, 2020.
TOP 10 SCT CHARACTERS TO DRESS UP AS THIS HALLOWEEN
Stuck on ideas for this year's Halloween costume? We're here to help! Take a look below for 10 inspiring, goofy, and bold characters to dress up as this year from past SCT productions. Build your own boat and travel to where the wild things are as Max, ditch the dress and become your own princess like Snow White, or channel your courage and throw on your boxing gloves as Muhammad Ali.
The options are endless! What are you going to dress up as for Halloween this year? Let us know in the comments below!
1. A Young muhammad ali from 'and in this corner: cassius clay' (2018)
Andre G. Brown in SCT's 2018 production of 'And In This Corner: Cassius Clay'. Photo by Elise Bakketun.
2. ASLAN FROM 'THE LION, THE WITCH, AND THE WARDROBE' (2016)
The cast of SCT's 2016 production of 'The Lion, The Witch, and The Wardrobe'. Photo by Chris Bennion.
3. MAX FROM 'WHERE THE WILD THINGS ARE' (2016)
The cast of SCT's 2016 production of 'Where the Wild Things Are'. Photo by Chris Bennion.
4. SNOW WHITE FROM 'SNOW WHITE' (2020)
Claudine Mboligikpelani Nako and Conner Neddersen SCT's 2020 production of 'Snow White'. Photo by Angela Sterling.
5. JACKIE ROBINSON FROM 'JACKIE AND ME' (2011)
The cast of SCT's 2011 production of 'Jackie And Me'. Photo by Chris Bennion.
6. LYLE FROM 'LYLE THE CROCODILE' (2011)
The cast of SCT's 2011 production of 'Lyle the Crocodile'. Photo by Chris Bennion.
7. pippi from 'pippi longstocking' (2013)
The cast of SCT's 2011 production of 'Pippi Longstocking'. Photo by Chris Bennion.
8. cat in the hat from 'dr. seuss's cat in the hat' (2012)
The cast of SCT's 2012 production of 'Dr. Suess's The Cat In The Hat'. Photo by Chris Bennion.
9. BLUE & YELLOW DOG FROM 'GO, DOG, GO!' (2011)
The cast of SCT's 2011 production of 'Go, Dog, Go!'. Photo by Chris Bennion.
10. corduroy from 'corduroy' (2019)
Chip Sherman in SCT's 2019 production of 'Corduroy'. Photo by Angela Sterling.
GROWTH IN A TIME OF TRANSITION: SEPTEMBER @ SCT
September is a time of transition.
Like you, we have spent the last six months learning, adapting, and growing. And just as we have all grown accustomed to our safe-at-home virtual reality, we are pausing to plan for the school year and reflect on all of the recent change in our community and our world.
Transition can be daunting, but knowledge, courage, and growth makes the change worthwhile. So, whether you’re an artist learning new ways to express your creativity, a student preparing for a year of learning in new environments, or a parent or educator helping their child navigate the changing world, SCT is here to support.
Join us as we embrace transition and welcome growth, and read on to learn more about SCT’s plans for the coming months.
SPOTLIGHT ON: COMMUNITY ENGAGEMENT & ARTS BASED LEARNING
Hear from SCT’s Associate Director of Education, Tiffany Maltos and Arts Based Learning Program Manager, Elizabeth Coen on the impact of community programs and how SCT plans to evolve, as we focus our efforts on our regional communities to continue bringing resources to schools this Fall.
At SCT, we’re constantly asking ourselves how we can build on our mission of providing children of all ages access to professional theatre. Experiencing theatre at a young age has proven to be a strong tool for young people to build their social and emotional skills, unleash their creativity, and learn more about themselves and the world around them. We also know that not every young person has the ability to make a trip to the theatre, so the mission of SCT’s Community Engagement and Arts Based Learning Programs is simple: let’s bring theatre to them.
learning through music:
A CONVERSATION WITH CURRICULUM SPECIALIST MEREDITH BERLIN ON SCT’S EDUCATIONAL SERIES WITH KING FM
If we've learned anything in the last few months, it's that giving our eyes a break from our virtual world and screens is key, which is why we're so excited to announce our partnership with KING FM, designed to engage your ears and give your eyes some much needed time off.
SCT and KING FM have partnered to present a 10-week educational series, Saturday Morning Stories, which launched in mid-August and will continue through October 17, 2020. This series brings beloved children’s literature to life through a crescendo of whimsical melodies and narrated plots. Hand selected titles like Goodnight Moon and Peter and the Wolf take families on a classical music adventure where they can simultaneously engage in activities uniquely curated by SCT for each production that the whole family can enjoy.
Read on to hear from SCT Curriculum Specialist and long time Teaching Artist Meredith Berlin on her process for designing the activities for Saturday Morning Stories, what families can expect from this unique new experience, and why it’s the perfect addition to your back to school schedule.
thank you, king county!
Join us in thanking one of our valued partners, King County's 4Culture, for their generous support of SCT through the COVID-19 Grant Relief Fund. Created as economic support to science, arts and culture organizations, and independent music venues, this grant of $10,000 will help support SCT’s efforts to re-launch and welcome patrons again. We are thrilled to be the recipient of King County’s support which will help us continue serving our community through virtual programming. Thank you, King County and 4Culture!
Continue Your Journey: Resources for Black Lives Matter, A Kids Play About Racism, and more from SCT and our Community PartnerS
SPOTLIGHT ON: SCT COMMUNITY ENGAGEMENT & ARTS BASED LEARNING PROGRAMS
The Community Engagement programs at SCT take actors, teaching artists, and other theatre professionals off the stage and into schools and community organizations that benefit from their expertise the most. “The priority in establishing these programs is always the community’s needs,” says SCT’s Associate Director of Education Tiffany Maltos. “We work individually with educators and program managers to identify what type of experience would benefit students the most. This could be an in-depth discussion about racism through a theatre piece like And In This Corner: Cassius Clay, a collaborative workshop on team building, or even an experience based around a subject they’re currently working on, like science or history. What is always consistent is our team’s ability to bring tools to the community that encourages growth in our youth.”
In recent years, SCT’s Community Engagement programming has seen tremendous growth; with a department increase of 30% in less than three years and 1,100 hours of programming in 2019 alone. The demands for this engagement was at an all-time high going into the 2020 school year. In addition to schools, SCT also works with community organizations like King County Juvenile Detention Center, Childhaven, and the Abused Deaf Women’s Advocacy Service. “When the pandemic hit, we knew we were going to have to potentially shift our programming to accommodate distanced learning, and we’re confident in the structure we have in place to successfully hold these workshops in a virtual space.”
In addition to Community Engagement, SCT’s Arts Based Learning Program, which works to reach middle and high school students across Washington, has also had to adapt its fall schedule to accommodate the virtual world. In partnership with Kaiser Permanente, SCT has developed and performed productions aimed to spark proactive conversations around mental health, bullying, and other relevant issues today’s youth are facing. “Through these performances and post-show workshops, we have shown students examples of conflict resolution, coping strategies for stress, and how they can build resiliency within themselves,” says Arts Based Learning Program Manager Elizabeth Coen. “We knew it was very important to continue our programming, and immediately went to work on how we can reach these students in a virtual world.”
“We’re excited to bring our show Ghosted to high school students virtually this fall,” says Coen adding that the production has been adapted for this new learning format and will include opportunities for students to participate in conversations about mental health.
“We are still able to provide a space to talk through the strategies and tools presented in the show with students in a virtual classroom,” says Coen. “The highest priority is creating a space where they feel safe, supported, creative, and curious. As we learned during our virtual Summer Drama School camps and classes, SCT’s Teaching Artists are extremely successful in doing this work in a virtual space. We can’t wait to dive in this school year.”
Though the transition to virtual learning and the heavy impact of the recent changes in our community were daunting for program leaders, Maltos says she sees this time as an opportunity to grow SCT’s offerings. “This time has allowed us to think thoughtfully about how we can deepen our partnerships. How can we be as impactful as possible? How can this succeed in an online space and beyond?” Maltos says.
As for the impact she anticipates seeing in the coming months? “Our Teaching Artists understand the limitations and the possibilities of a zoom room,” says Maltos. “We are committed to bringing the highest caliber experience to these students during a time when they may need it most.”
to learn more about how to have sct at your school, contact us at educationoutreach@sct.org
GET TO KNOW 'TUBBY THE TUBA' BEFORE TUNING IN ON KING FM
Join our friend Tubby the Tuba on a musical adventure this Saturday morning on KING FM! While you listen, gather the family and enjoy activities created by the SCT Education Staff specifically to accompany this unique experience. Please enjoy Dance, Music, and Edible Art activities inspired by and connected to the program narrated by Julia Child with music by George Kleinsinger.
Tubby the Tuba is unhappy with his orchestra and is on the hunt for a melody of his own! Did you know Tubby the Tuba originally premiered as a radio show in 1946? Over the years, his tune has been sung by iconic storytellers like Dick Van Dyke, Danny Kaye, and in this Saturday's telling will be narrated by Julia Child. It's no secret that Tubby's journey is a story for the ages; it was even nominated for an Academy Award when a short film based on his adventures was released in 1947!
1945 poster for 'Tubby the Tuba' sung by Danny Kaye. Photo courtesy of discogs.com
VIEW THIS WEEK'S ACTIVITIES
full 'saturday morning stories' schedule
listen live on king fm
5 THINGS YOU DIDN'T KNOW ABOUT PADDINGTON BEAR
Take some time this Saturday morning away from your screens and join our friend Paddington Bear on a charming musical journey to his first concert.
While you listen, gather the family and enjoy activities created by the SCT Education Staff specifically to accompany this unique experience. iInspired by a the program narrated by Stephen Fry, with music by Herbert Chappell, activities include Storytelling, Visual Art, and Movement exercises for the whole family to enjoy.
5 fun facts you didn't know about paddington bear
1. You can find a statue of Paddington in Paddington Station in London. Really! Paddington stands in his namesake station to greet visitors and travelers as they pass through London.
2. Paddington's creator, author Michael Bond, had the idea for Paddington in 1956 as he was wandering through a London department store on Christmas Eve, searching for a present for his wife. He saw a lonely teddy bear on a shelf and thought he looked like he needed a friend, so he brought his home and the rest in history!
3. Paddington books have been translated into over 40 languages! His adventures are enjoyed in countries all over the world.
4. If you know Paddington, we're sure you did know that his favorite thing is marmalade. But... did you know that his favorite marmalade is spiced orange?
5. There are 14 different Paddington books by author Michael Bond. Not to mention movies, TV shows, and of course, concerts! After you're done listening to Paddington Bear's First Concert, join him on his many other adventures as he gets into trouble and warms the hearts of his family and friends.
view the full saturday morning stories schedule
CURRICULUM SPECIALIST MEREDITH BERLIN ON KING FM & 'SATURDAY MORNING STORIES'
SCT is excited to partner with KING FM to present a 10-week education series, Saturday Morning Stories, beginning this Saturday, August 15. This series will bring beloved children’s literature to life through a crescendo of whimsical melodies and narrated plots. Hand selected titles like Goodnight Moon and Peter and the Wolf take families on a classical music adventure where they can simultaneously engage in activities uniquely curated by SCT for each production that the whole family can enjoy. Listeners can tune in at 8:30 a.m. through October 17, 2020.
Read on to hear from SCT Curriculum Specialist and long time Teaching Artist Meredith Berlin on her process for designing the activities for 'Saturday Morning Stories' and what families can expect from this unique new experience.
VIEW THE ACTIVITIES FOR 'PADDINGTON BEAR'S FIRST CONCERT'
Meet Meredith Berlin, Curriculum Designer of 'Saturday Morning Stories' Partnership with
KING FM:
Curriculum Specialist and Teaching Artist, Meredith has taught SCT drama school students of every age and level for over twenty years. She has performed as an actor and dancer on stages in Seattle and Washington DC. She is also a director, choreographer, and is the author of The Ghost Light Kids Get Hooked, an adventure inspired by her experiences behind the scenes at SCT and other theaters. Meredith has received grants from both the Seattle and King County Arts Commissions.
what can young people and families expect the experience of 'saturday morning stories' to be like when following along with sct's activities?
Great question! The activities are designed to provide structures for artistic investigation and collaboration as well as family conversations on the themes embedded in the stories. Families can decide for themselves whether they would prefer to read the activity sheets before the program and engage in the activities as they listen, or if they prefer to use the activity sheets to extend learning after they have listened to the program. Each activity sheet includes simple instructions, a list of materials (which we are keeping minimal and simple so that everyone can participate without any need to buy supplies), and ideas for bonus activities and reflection. They are ALL designed to be fun and also help build confidence and connection to the music and each other.
what was the process of developing the educational curriculum for 'saturday morning stories' like?
First I got to have a wonderful time listening to all of the programs. How lucky I felt to spend part of my work day joining Paddington Bear for tea, reflecting with Tubby the Tuba about the unique contributions I have to offer, and marveling at the courage and strength of Maui who snares the sun (just to name a few). As I listened to the programs there were sections that drew me in, and I would listen to those again and again, allowing them to inspire connections to movement, dance, visual arts, acting or writing activities. Once I decided which art forms to focus on I invited colleagues with expertise in those areas to contribute activities to the project. My colleagues and I are currently engaged in the process of solidifying those big ideas and honing them down into activities that anyone can try at home with their family.
why do you think it's important for families to take this time together?
Whether or not they ever play a musical instrument, audition for a play, submit their art to an art gallery or their poetry for publication, these inter-generational activities help us see each other in a new light and are the types of experiences children remember for the rest of their lives.
do you have a personal favorite show that will be features in 'saturday morning stories'?
Oh, that is the hardest question of all! Carnival of the Animals is something I listened to as a child, on my little plastic record player. My friends and I would choreograph dances to the music, dress up and perform for our parents. I seem to remember that I was an elephant. Later in life when I took cello lessons I had the chance to play some music by Saint-Saens myself, so I have a connection to that music that grew as I grew. But truly I love all the stories and musical pieces for different reasons.
SCT AND KING FM PARTNER TO BRING A SATURDAY MORNING MUSIC AND STORY PROGRAM TO PUGET SOUND FAMILIES
Seattle, Wash.-- Seattle Children’s Theatre and KING FM present a 10-week education series titled Saturday Morning Stories to bring beloved children’s literature to life through a crescendo of whimsical melodies and narrated plots. Hand selected titles like Goodnight Moon and Peter and the Wolf take families on a classical music adventure where they can simultaneously engage in activities uniquely curated by SCT for each production that the whole family can enjoy. Listeners can tune in at 8:30 a.m. beginning August 15 through October 17, 2020.
“This collaboration with KING FM is a wonderful opportunity to combine our resources and offer the experience of the performing arts from the comfort of your home,” says SCT Director of Education, Johamy Morales. “Through our activity guides and new curriculum, we hope to provide caregivers and young people with the tools they need to spark their own curiosity, courage, and play.”
KING FM, which reaches up to 250,000 weekly listeners across Puget Sound, has made it their mission to make classical music accessible for everyone in the community and to advocate for the arts throughout the region. “Teachers and parents use Classical KING FM to introduce children to classical music, and the station has additional programs to supplement this important work,” says Blaine Shepherd, Director of Programming and Corporate Support at KING FM.
The weekly activities, designed by long time SCT teaching artist and Curriculum Specialist, Meredith Berlin, offer all families a chance to play regardless of age. “The activities are designed to provide structures for artistic investigation and collaboration as well as family conversations on the themes embedded in the stories. Each activity sheet includes simple instructions, a list of materials, and ideas for bonus activities and reflection. They are all designed to be fun while building confidence and connection to the music and each other,” says Berlin, adding that listeners can engage the activities before or after the program, tailoring the experience for their family.
Families can learn more about Saturday Morning Stories and join in on the weekly fun by visiting www.king.org. Weekly activities will be made available up to one week prior to each production and will be available for review and download at www.sct.org.
About Meredith Berlin (she/her), Curriculum Designer - Curriculum Specialist and Teaching Artist, Meredith has taught SCT drama school students of every age and level for over twenty years. She has performed as an actor and dancer on stages in Seattle and Washington DC. She is also a director, choreographer, and is the author of The Ghost Light Kids Get Hooked, an adventure inspired by her experiences behind the scenes at SCT and other theaters. Meredith has received grants from both the Seattle and King County Arts Commissions.
Seattle Children’s Theatre is internationally recognized as a leading producer of professional theatre, educational programs and new works for young audiences, which have entertained, inspired and educated over 4 million children and their families. Since its inception, SCT has produced more than 260 plays, 115 of which are world premieres. Each season nearly 60,000 students and teachers experience the magic of live theatre through our Student Access Series. For this program, SCT subsidizes $1.3 million in significantly reduced and free tickets to make attending the theatre more accessible for schools in the region. The 2018-2019 season is sponsored by Microsoft, Shubert Foundation, Bill & Melinda Gates Foundation and ArtsFund. Stay up to date with SCT by visiting our blog.
About KING FM - Classical KING FM 98.1 is the primary institution developing new audiences for classical music and the arts in Seattle, Bellevue, and the Puget Sound Region. Listener-supported KING FM is located at Seattle Center with a mission to make classical music accessible for everyone in the community and to advocate for the arts in our region. In addition to creating programming that offers everyone in the region an opportunity to make classical music and the arts a part of daily life, Classical KING FM partners with arts and culture organizations of all size and scope in the region, offering broadcast performances of local concerts as well as an opportunity for local musicians to perform on our signature Friday evening program Northwest Focus LIVE. The Northwest Focus Concert Calendar offers listeners the opportunity to learn more about concerts and events to encourage them to deepen their involvement with classical music and the arts by attending and supporting the excellent performing organizations the region boasts.
More than 15,000 members are supporters of Classical KING FM, helping to pave the way for a bright future for the station, and bringing the richness of classical music to diverse audiences in the rapidly growing Puget Sound Region.
AN INTERVIEW WITH SENSORY DRAMA SPECIALIST MADDIE NAPEL
MEET TEACHING ARTIST AND SENSORY DRAMA SPECIALIST, MADDIE NAPEL
Maddie (she/her) has a background in sensory drama from working with Seesaw Theatre at Northwestern University and is the founding Artistic Director of Parachute Players. She also has extensive experience as a teaching artist in special education classrooms in Seattle and personal experience with the disability community as a sibling of an adult brother with cerebral palsy. Through her work and training, she has sought out (and continues to seek out) partnerships with teachers and artists with disabilities.
First, tell us a bit about Sensory Drama. Who is it for and why is it unique?
Sensory Drama is what happens when you reimagine traditional creative drama (facilitated group storytelling) to make it more inclusive of all kinds of learners and players! Sensory Drama classes have built-in moments for sensory engagement (seeing and hearing but also feeling, smelling, and moving our bodies through space). This helps class work for both students who are sensory seeking and those with sensory processing challenges, while simultaneously strengthening instruction for all learners, as it gives everyone more options for how to get and stay engaged! Other accommodations are provided as well. When we intentionally include young people with disabilities in our programming, we all win.
These Sensory Drama summer classes are specifically for students with disabilities. We feel that holding space for these students is always important, but particularly important right now, as they have been disproportionately impacted by the COVID-19 initiated shift to online learning. We want to show these students and these families how much they are valued by offering these experiences, tailor-made for them.
What kinds of accommodations are made for different students?
So many fun accommodations! The biggest feature of Sensory Drama is, of course, its focus on multimodal sensory engagement, but we provide other accommodations as well. Once families register, all families will have access to a social story, detailing exactly what they should expect during class. This can help to alleviate anxiety and demystify the unfamiliar social situation created by distance learning. During class, we will follow a visual schedule to help ease transitions between activities. Also— and this is a big suggestion that came from consultant Talleri MacRae—we will be upfront about our expectation that not all families will stay connected for the entire class each day. Things happen, and we’ll provide families with enough structure that they can “finish” each class on their own time. Finally, we may provide accommodations for specific students’ needs, like modifying instruction for a physical activity for a student in a wheelchair or encouraging students who use Alternative/ Augmentative Communication (AAC) to use these devices.
What is the goal of a guardian and me experience? What does that participation look like for both guardian and student?
This is a guardian and me experience because Sensory Drama is about connection, and it’s sometimes hard to feel that connection through a screen! We connect when we share in sensory experiences (when we touch the same soft fabric or smell the same smell of lavender). Guardians (and other members of your household) can expect to be fully included in the experience. We will play together!
How has your experience been while teaching these classes in a virtual environment?
I’ve been teaching virtual classes for young people with disabilities since March, and I’ve been completely inspired by the transition to online instruction. Just as I am inspired by the challenge of accommodating for individual students’ needs, I am inspired by the challenge of this online platform— it has its own constraints and affordances and has made me more creative as an educator! When a change prompts us to question our assumptions about how things must be done, new possibilities emerge.
VIEW THE CURRICULUM FOR
SENSORY DRAMA - OCEAN ADVENTURES
meeT sensory drama consultant,
talleri macrae
Talleri (she/her) is a disabled theatre artist based in Louisville, KY. Talleri is a teaching artist for Playwright Discovery Program, an arts-based residency that serves young writers with disabilities. She also works alongside theatres, service providers, and autistic self-advocates to offer sensory-friendly and relaxed performances. Some organizations Talleri has served are: Actors Theatre of Louisville, the Kentucky Center for the Performing Arts, Indiana Repertory Theatre and La Jolla Playhouse. Talleri is the Director of Professional Development and Training for National Disability Theatre (established 2018). She holds a B.S. from Northwestern University, and an M.F.A. from The University of Texas at Austin.
CONNECTION NEAR & FAR: AUGUST @ SCT
Whether it’s two friends, a great distance, or just the dots, connecting to the people and things in the world around us is imperative. Right now, it can also be quite challenging. This month at SCT, we are taking the time to focus on how we connect with our audience, community and friends – near and far! The best way we know how to connect is through art, and even though the doors to our theatre may be closed for now, it isn’t stopping us from creating, sharing, and teaching. For generations, SCT has been a friend and resource to young people and their families, and that is a connection that will never waiver.
So read on to discover all the ways SCT continues to connect to our valued audience – nationally, regionally and locally.
There is a lot going on in our nation and the world right now, and we believe that the best way to process and learn about big changes is through art. SCT is excited to be a leading producer for the world-premiere of A Kids Play About Racism, which debuts on Broadway on Demand for free on August 1 & 2. The effort, supported by 41 theatres for young audiences, is developed from Jelani Memory’s A Kids Book About Racism and directed by bicoastal multidisciplinary artist Khalia Davis who was recently named TYA/USA’s 2019 Emerging Theatre Artist. As part of the production, educational materials developed by SCT in collaboration with the Northwest African American Museum will help students learn through art, history and education, inspiring and equipping them to change the world.
EXPLORE THE PLAY
VIEW ACTIVE AUDIENCE GUIDE
EXCLUSIVE FOR SCT FAMILIES
Join Aiko Bethea as she facilitates a powerful (and virtual) discussion with Khalia Davis, Kennedy Dawson, LaNesha DeBardelaben, and Johamy Morales on how history, education, personal experience, and art intersect, equip, and inspire young people to change the world. As part of SCT and Northwest African American Museum’s audience, you have priority access to this exclusive prerecorded event on Saturday, August 1 at 10 a.m. or Sunday, August 2 at 5 p.m. Mark your calendars today and plan to join us on SCT's YouTube Channel for this exclusive post-show event!
We are excited to announce that on August 15, SCT will partner with KING-FM 98.1 for a 10-week educational series featuring the musical accompaniments from a number of our past productions including Goodnight Moon, Peter and the Wolf, and more! In addition to the experience of listening to these iconic scores and books, SCT’s education staff and teaching artists will be creating curriculum and activities to accompany each book narrative from home, designed to engage your student’s body, voice, and imagination.
KING-FM reaches across the Greater Puget Sound with up to 300,000 listeners a week, and with a simple click of a button you can join us on Saturday morning starting August 15 for an experience your whole family will love. Visit us online for more information from us and our friends at KING-FM on when and where you can tune in! Who knows, the music from your favorite SCT show may just be featured.
THANK YOU, ARTSFUND!
Join us in thanking one of SCT's great partners who really show us how to make connections. ArtsFund has been supporting the mission of SCT for decades and this year is no different. We were thrilled to be a recipient of one of their Arts Emergency Relief grants in May. We aren't alone! This spring ArtsFund provided $5.3M in grants to 111 organizations. Celebrating a major milestone this year, they have been connecting our community to the arts for 50 years. ArtsFund strengthens the community by supporting the arts through leadership, advocacy, and grant-making and SCT is thrilled to be connected to this great organization.
We are thrilled that we have been able to find new ways to connect with our students with virtual Summer Drama Classes. August marks the final month of summer classes, and over the course of the last 2 months, we have been able to welcome over 600 students from 14 states across the country to gather within SCT’s virtual walls.
Encouraging connection through a virtual setting can be challenging, but our teaching artists and students have found success through SCT’s intimate class sizes and new roster of summer classes including unique affinity options and upcoming classes like Intro to Puppetry, Sensory Drama, and Stand Up classes for BIPOC students. It has been 2 months of supreme creativity and fun, and we can’t wait to see what August will bring!
VIEW REMAINING CLASSES
JOIN THE CREATIVES & EDUCATORS BEHIND 'A KIDS PLAY ABOUT RACISM' FOR A POST SHOW DISCUSSION
A groundbreaking collaboration among 37 Theatres for Young Audiences across the United States, led by the lead producing team of Bay Area Children’s Theatre, Seattle Children’s Theatre, and Alliance Theatre in Atlanta, will present the virtual premiere of A Kids Play About Racism, a theatrical adaptation of Jelani Memory’s A Kids Book About Racism. Premiering August 1 and 2 on the streaming platform Broadway On Demand, the new work is adapted and directed by award-winning director and TYA artist Khalia Davis and will be brought to life by an entirely Black and BIPOC cast and creative team from across the United States. A Kids Play About Racism will utilize theatre to offer young children and families a way to engage in meaningful conversation about race.
Adaptor and Director of A Kid’s Play About Racism, bicoastal multidisciplinary artist, and recipient of TYA/USA’s 2019 Emerging Leader Fellowship.
Aiko Bethea
Recognized by Forbes and CultureAmp as a preferred anti-racism and DEI educator and consultant, Atlanta-based attorney, and former SCT Board of Trustees.
LaNesha DeBardelaben
Executive Director at Northwest African American Museum, 20+ year career building success for Black museums, national president of the Association of African American Museums Board of Directors.
Johamy Morales
SCT’s Director of Education, Trustee for Theatre Communication Group, featured panelist for Colorado Creative Industries and TCG’s Rising Leaders of Color.
Kennedy Dawson
A senior at Holy Names Academy, is honored to be a part of today's discussion. Kennedy is an active participant in her high school theatre department and has performed in multiple SCT productions. Kennedy considers herself a social activist and hopes to use her art as a platform to inspire younger kids of color to be unafraid to use their voices.
Learn More About A Kids Play About Racism
SCT to Coproduce 'A Kids Play About Racism' in Partnership with 37 TYA Theatres Across the Nation
CONNECTION IN THE MIDST OF COVID-19: HOW SCT MADE ME FEEL WELCOME FROM 2,500 MILES AWAY
by chloe tower - summer 2020 intern
I had known that I had wanted to apply for the Teaching Artist Internship since I had heard about SCT in a TYA History course at my university. This theatre that values inclusivity, acceptance, and connection was an absolute dream for me. Growing up in Orlando, FL, I had never been to Seattle, or hardly any of the West Coast so, naturally, I was so excited to get to see what theatre was like on the other side of the country. Then, the COVID-19 pandemic swept through our world. I was terrified that the internship that I had dreamt of would no longer be a possibility. But, thanks to the amazing staff of SCT, Drama School Virtual Classes and a virtual Teaching Artist Internship were still possible. Though this internship has been different than expected, I have still found as much care and intentionality from the staff via a virtual platform, as I would have experienced in person.
Initially, I was nervous about how I could feel connected, since I would be doing the internship from the complete opposite part of the country. However, SCT made me feel so connected, included, and accepted. During the very first week, working alongside Brodrick Ryans (Education Coordinator), we shared experiences of growing up in the Southeast, a desire to share stories on stage of those who have not had a voice, and a love for seeing the growth in students. It was moments like these with teaching artists over the summer that made me feel connected and valued.
One of the most wonderful parts of this internship has been getting to know the eight other interns in the 2020 class. From virtual movie nights to hangouts over Zoom, these other interns have been intentional to keep the community that comes with an internship alive and thriving even in a virtual setting. These individuals have supported, inspired, and accepted me and made the family of SCT feel so real and tangible.
The term “SCT family” had been used before and during my internship experience, and I can honestly say that I have felt that sense of community and family from the moment I accepted this internship. SCT has gone above and beyond to ensure that I have felt accepted and supported, not only as an intern, but as a person. From check-ins with Johamy Morales (Director of Education) and Tiffany Maltos (Associate Education Director), to chats with Liz Cohn (Arts-Based Learning Manager) about our shared Floridian experiences, the staff has made me feel like a part of the family, even though I am 2,500 miles away. This internship experience over the summer has renewed my hope for the future of theatre and arts education in a post COVID world. We may be living in uncertain times, but one thing is for sure: being a part of the internship class of 2020 has changed my life for the better.
Learn more about SCT's Internship Program
Introducing SCT's Summer 2020 Class of Interns
8 HELPFUL TIPS FOR TALKING TO YOUR CHILDREN ABOUT THE BLACK LIVES MATTER MOVEMENT
WRITTEN BY NIKKI TOMBS
EDUCATION DIRECTOR AT TRUE COLORS THEATRE
On December 31, 2019, with seconds to go, voices around the world made proclamations that the year 2020 would be one of perfect vision. As the countdown ensued and the last notes of Auld Lang Syne ushered in yet another January, none of the predictions made from futurists, academics or the government could forecast the global reckoning and revelations to come. 20/20, a term typically used to reflect one's visual acuity, would now metaphorically reflect the world’s account of a deadly pandemic—one that has claimed the lives of so many. The reality is that this pandemic has separated families, promoted fear, evoked anger, revealed truths, challenged policy, and shut down the world. The PANDEMIC I speak of is called racism and it did not begin to reveal its ugly truth in 2020. For over 400 years, we have witnessed the normalization of legalized oppression of people of color, while many have continued to turn a blind eye. We must not only open our eyes but also open our mouths and start to have these difficult conversations about race, specifically with our children.
I must warn you that this is not radical discourse of finger pointing and judgement (at least that is not the intent). It is neither a placated account made more palatable to those who have grappled with this very difficult conversation. It is; however, a sincere offering of my experiences in discussing race, prejudice and the Black Lives Matter movement with my children, and supporting those in my sphere who have sought ways to engage these topics with their children. I am no expert or teacher of all things race. But I am a student of the world who navigates as a woman of color, charged with leading four young minds (my children) to make wise decisions that will impact our world. More importantly, I am a part of a communal movement of those who have not always followed the precepts of what is appropriate to say or appropriate to do, but we continue to seek opportunities to learn more in order to do better.
Therefore, the question becomes when it is appropriate to have conversations with your kids about racism. My husband and I started these conversations as early as kindergarten after noticing the shift in our children’s interactions when meeting new friends. We would start with questions that could range from something as simple as, “How was your day?” to “Who did what and why and how did that make you feel?” We soon discovered that at some point, the questions would begin to come from them. I recently recall when my seven year old son entered my bedroom as my husband and I were watching, what was then, a peaceful demonstration on television. As he peered at the screen, he asked me why the people were marching. I began to explain to him that a man named George Floyd died. He turned and then asked, “Was he sick?” My reply was “…no, the police killed him and that’s why all of those people are marching.” He then said, “Are those people his family?” I smiled at him, envious of his innocence as pure as the lamb in a John Donne metaphysical poem and replied, “They are now!” And just when I thought the line of questioning was over, he asked “why are they yelling black lives matter!” I said, “Because sadly, for some reason, there are those who believe that they don’t.” He gave an inquisitive stare, which shifted to resolve and exited the room.
These conversations have an entirely different tone when speaking to my twenty year old son whose simple drive to the grocery store requires two checklists: one with a list of items needed, and the other a mental checklist of do’s and don’ts to make it home safely. Then there is my teenage daughter whose most upsetting account of racism or prejudice is witnessing her school administrators and teachers target black students for their dress code, hairstyles and argot. Nevertheless, the last conversation is one of an entirely different tone. It is bittersweet as I whisper in the ear of my differently abled (special needs) son who is completely unaware of the perils of the world. Each tear is a shared emotion of gratitude and grief. But what also grieves my spirit is that due to the unfair treatment of people of color, social justice movements, such as Black Lives Matter, must exist to both advocate and remind. The Black Lives Matter movement has been fighting to be heard since 2013’s urgent need to bring attention to police brutality. The impetus for this movement was the death of 17-year-old Trayvon Martin in 2012. Despite their valiant efforts, more and more lives are lost to police brutality and the saga continues. There are those who feel the need to remind us that all lives matter-and they do. But this dismissive response and inability to acknowledge black lives further complicates the notion that “they” truly believe that black lives are a part of the ALL lives they tout. There is reciprocal value in these types of conversations, and we imbue our allies and all to do something differently. My hope is the suggestions listed below will serve as a starting point in an effort to retain that innocence that celebrates the beauty of the world and not the perils of humanity.
1. My first recommendation to start these tough conversations with young impressionable minds is to do just that, START somewhere. As the quote states, “there are two mistakes one can make along the road to truth…not going all the way, and not starting” –Buddha
2. Acknowledge your own blind spots or micro aggressions before having these conversations. Be open to evaluating your lens of perspective before influencing theirs.
3. Choose your words carefully. Words have the power to embolden or dishearten. Which will you be responsible for? Our children are watching, listening and responding.
4. Identify teachable moments. Nurturing these moments help to impart tolerance and understanding. Our children look to us to find meaning in this world, so take advantage of those opportunities.
5. Discover parallels through avenues of interest like gaming, sports, and arts.
6. Utilize technology. Depending on the age, utilize social media as a catalyst for discussion. Though radical thinking and misinformation can be found on some platforms, there are organizations and reputable institutions, like that post responsible content that can jumpstart the conversation.
7. Find mirrors and windows through literacy. Conversations about race are not just about how others see you, but how you see yourself in the world. Find the mirrors and windows of opportunity to teach them about themselves and those around them. Cicely Lewis, founder of the literacy initiative READ WOKE, provides a comprehensive list of books that are authored by or have main characters who are people of color.
8. The Arts. The arts promote confidence, ensemble ethic, unity, and empathy. Young learners can create their own art (visual or performance) or attend an artistic experience and use it as the impetus for discussion.
THEATRE FOR YOUNG AUDIENCES/USA (TYA/USA)
THE VIRTUAL PREMIERE OF
A KIDS PLAY ABOUT RACISM
AWARD-WINNING TYA ARTIST KHALIA DAVIS LEADS AN ALL BLACK CAST AND CREATIVE TEAM FROM ACROSS THE COUNTRY IN ADAPTING JELANI MEMORY’S A KIDS BOOK ABOUT RACISM
37 TYA THEATRES ACROSS THE NATION ARE CO-PRODUCING THE VIRTUAL PERFORMANCE, LED BY BAY AREA CHILDREN’S THEATRE, SEATTLE CHILDREN’S THEATRE, AND ALLIANCE THEATRE
New York, NY, July 13, 2020 – A groundbreaking collaboration among 37 Theatres for Young Audiences across the United States, led by the lead producing team of Bay Area Children’s Theatre, Seattle Children’s Theatre, and Alliance Theatre in Atlanta, will present the virtual premiere of A Kids Play About Racism, a theatrical adaptation of Jelani Memory’s A Kids Book About Racism. Premiering August 1 and 2 on the streaming platform Broadway On Demand, the new work is adapted and directed by award-winning director and TYA artist Khalia Davis and will be brought to life by an entirely Black and BIPOC cast and creative team from across the United States. A Kids Play About Racism will utilize theatre to offer young children and families a way to engage in meaningful conversation about race.
The new work is adapted and directed by award-winning director and TYA artist Khalia Davis and will be brought to life by an entirely Black and BIPOC cast and creative team from across the United States, including Seattle-based educators and artists Johamy Morales (Seattle Children’s Theatre Director of Education), Brodrick Santeze Ryans (Seattle Children’ Theatre Education Coordinator), Jason Turner (Museum Educator and Tour Guide for the Northwest African American Museum), Nikki Toombs (Education Director at True Colors Theatre), Marquicia (Qui Qui) Dominguez (Seattle Based Teaching Artist) and Amberlee Joers (Seattle Theatre Group’s Broadway Education Administrator).
As part of the production, educational materials developed by SCT in collaboration with the Northwest African American Museum will extend the experience and enhance age-appropriate engagement. “SCT is proud to be co-producing A Kid’s Play About Racism in collaboration with the talented artists and institutions from across the nation" says SCT Managing Director Kevin Malgesini, "Khalia Davis and Jelani Memory’s work is a profound way to elevate Black voices and share them with young people. This production also serves as a reminder that while our doors are closed, we are still making powerful art that connects our local, regional and national communities during this unprecedented time." All 37 partnering theatres are members of Theatre for Young Audiences USA (TYA/USA), the national organization representing the field of theatre for children and family audiences.
“I jumped at the opportunity to adapt Jelani Memory's book A Kids Book About Racism into a theatrical piece for young audiences simply because it meant we were recognizing the importance of including children in these difficult conversations,” shared lead artist Khalia Davis. “This show embraces the full spectrum of emotional response children may have as they navigate comprehending racism and how it may affect them."
“When I wrote A Kids Book About Racism, I wrote it from my own kids. I never could have imagined it would have spread so far and wide to thousands of kids all over the world, or turned into a nationwide theatrical event. I am thrilled to see what Khalia and these other amazing artists create,” offered Jelani Memory, whose book provides the inspiration for the production. A Kids Book about Racism is part of Memory’s children’s book publishing company A Kids Book About, which offers titles on a range of big topics to explore including feminism, belonging, gratitude, cancer, and many more.
The scale and breadth of this co-production has been made possible in part through the network cultivated by TYA/USA, which connects organizations and artists across the country focused on theatre for young people and families. Through the last few months, TYA/USA has offered a range of programming to provide deep connections and resource sharing in response to COVID-19. Through this network, TYA theatres across the country have been able to come together to find ways to support each other and their audiences through new and innovative collaboration models.
A Kids Play About Racism will be streaming on Broadway On Demand on August 1 and 2 along with accompanying interviews and educational videos.
A Kids Play About Racism is adapted and directed by Khalia Davis, with music composed by Justin Ellington and Costume Design by Ron McCann (California). It will be performed by Davied Morales (California), Angel Adedokun (California), Moses Goods (Hawaii), Rapheal Hamilton (Arizona), Isaiah Harris (Texas), Jessenia Ingram (Georgia), and Regan Sims (New York).
The work is produced by Seattle Children’s Theatre, Bay Area Children’s Theatre, and Alliance Theatre, in partnership with Adventure Theatre MTC, Arts on the Horizon, Children's Theatre of Charlotte, Chicago Children's Theatre, Children's Theater of Madison, Children’s Theatre Company, Childsplay, Children's Theatre of Cincinnati, Coterie Theatre, Dallas Children's Theater, Dare to Dream Theatre, Des Moines Performing Arts, Filament Theatre, First Stage, Honolulu Theatre for Youth, Imagination Stage, The Kennedy Center, Magik Theatre, Metro Theater Company, Nashville Children's Theatre, New York City Children's Theater, Oregon Children's Theatre, Orlando Repertory Theatre, Pink Umbrella Theater Company, ReNew Productions, Rose Theater, Seattle Children's Theatre The Growing Stage - The Children's Theatre of New Jersey, The Gottabees, The Open Eye Theater, TheatreWorksUSA, Trike Theatre, Trusty Sidekick Theater Company, Wheelock Family Theatre at Boston University, and Orpheum Theatre Group.
About Khalia Davis: Khalia Davis (she/her) is a bicoastal multidisciplinary artist splitting her time between the San Francisco/Bay Area and New York. Directed and devised new works with prominent theaters such as Bay Area Children’s Theater, Atlantic Theater Company’s Atlantic for Kids, New York City Children’s Theater, Spellbound Theatre and more. Ms. Davis recently served as the Director of Inclusion and Education with Brooklyn Children’s Theatre restructuring their children’s musical theater programming through an anti-racism lens and currently teaches with New York City Children's Theater, the Atlantic Acting School, and for Disney Theatrical Group leading music and movement workshops and facilitating audience and community engagement. She is also an Artistic Associate for the nationally-known arts education organization The Story Pirates. As a performer, she has worked regionally and toured nationally on both coasts. Recently awarded the 2019 Emerging Leader Fellowship with TYA/USA and the NYCCT Leader Fellowship for 2019/2020. BA in Theater Arts from the University of Southern California. To learn more about Ms. Davis, check her out at www.khaliadavis.com.
About TYA/USA:Theatre for Young Audiences/USA (TYA/USA) is the leading national organization representing over 1,000 member theatres, organizations, and individual arts professionals across the United States committed to the professional field of theatre for children, young adults, and families. Recently, 1200 professionals from 46 states and 21 countries participated in the 2020 TYA/USA Virtual Festival & Conference. Dedicated to ensuring that all young people have access to high-quality theatre experiences, TYA/USA offers a variety of programming that connects professionals working in the sector through in-person gatherings and virtual sessions; provides opportunities for field-wide learning and leadership development; disseminates field news and research through a variety of print and online channels; and advances the field both internally and externally through a range of advocacy efforts. Founded in 1965, TYA/USA is the only theatre organization in the United States which has the development of professional theatre for young audiences and international exchange as its primary mandates. TYA/USA is the United States Center for the International Association of Theatre for Children and Young People (ASSITEJ). More information can be found at www.tyausa.org.
About Broadway On Demand: Broadway On Demand is the premiere streaming service offering an extensive and wide-ranging library of video on demand content, exclusive livestream events, interactive platforms, and educational resources. It is designed as a virtual performing arts complex offering not only Broadway shows and movie musicals but also, individual artists, concert series, performance venues, and theatres around the world. Additionally, using a unique licensing interface, approved middle school, high school, and college productions will have the opportunity to be streamed to a global audience. Broadway On Demand fulfills Broadway’s long-held promise of being the ‘longest street in the world’.
|
cc/2021-04/en_middle_0021.json.gz/line2170
|
__label__wiki
| 0.677886
| 0.677886
|
Securonix Wins 2018 SC Magazine Trust Award for Best SIEM Solution
ADDISON, Texas, April 25, 2018 (GLOBE NEWSWIRE) — Securonix, the market leader in big data security analytics and user and entity behavior analytics, announced today that Securonix’s Next Gen SIEM solutionhas been recognized as the top security information and event management (SIEM) solution in the 2018 SC Magazine Trust Award for the “Best SIEM Solution.” The announcement was made on Tuesday, April 17, 2018, during the 22nd Annual SC Awards Gala in San Francisco, CA.
Securonix is reinventing the security information and event management (SIEM) market by transforming big data into actionable security intelligence. Securonix solutions leverage a highly scalable big data platform to collect security event data, detect advanced threats using patented machine learning techniques, and respond cybersecurity incidents using built-in automated playbooks. Securonix is the only vendor to deliver its solution as both enterprise software and as a hosted cloud software-as-a-service (SaaS) solution.
“Cybersecurity innovation and real-world customer success are the fundamental principles that guide everything we do at Securonix,” said Sachin Nayyar, CEO of Securonix. “The cybersecurity management space has turned the corner, and legacy SIEM products are no longer viable for today’s cyberthreat landscape. SC Media’s recognition of Securonix’s product excellence is a resounding validation of our mission.”
Winners of the Trust Award were chosen by a distinguished group of leading IT security professionals from SC Media’s readership and were selected by SC Media’s editorial team. Entrants were narrowed down to a select group of finalists before undergoing a rigorous and conclusive judging process to determine the winner of each category.
“The Trust Award category is one of the most highly anticipated designations at the SC Awards ceremony, because it represents the voice of the people who are really using the products and services,” said Illena Armstrong, VP, Editorial, SC Media. “Securonix’s Next Gen SIEM solution was chosen as the ‘Best SIEM Solution’ winner for its ability to meet the needs – and exceed expectations – of its customers.”
The SC Awards are recognized throughout the security industry as the gold standard of excellence in cybersecurity. SC Media uses the awards to recognize the achievements of security professionals in the field, the innovations happening in the vendor and service provider communities, and the vigilant work of government, commercial, and nonprofit entities. To see the specific accolades awarded to Securonix SIEM, please download this award summary.
SC Media is cybersecurity. For over 25 years, they have armed information security professionals with in-depth and unbiased information through timely news, comprehensive analysis, cutting-edge features, contributions from thought leaders, and independent product reviews in partnership with and for top-level information security executives and their technical teams.
In addition to their comprehensive website, SC Media offers magazines, eBooks, and newsletters. They also host digital and live events such as the SC Awards and RiskSec NY to provide cybersecurity professionals all the information needed to safeguard their organizations and contribute to their longevity and success.
About Securonix
Securonix transforms enterprise security with actionable intelligence. Using a purpose-built security analytics platform, Securonix quickly and accurately detects high-risk threats to your organization.
For more information about Securonix visit https://securonix.com
Chris Fucanan AquaLab PR for Securonix [email protected] (650) 776-7811
Securonix Unveils Strategic Alliance to Combat Cyberattacks in the Cloud
Securonix Wins Govies Award for Big Data Analytics
|
cc/2021-04/en_middle_0021.json.gz/line2172
|
__label__wiki
| 0.812612
| 0.812612
|
Pedro Sousa
Novak Djokovic Up To 6th In ATP Race Rankings And In Position For Run At No. 1
by Tom Gainey | August 20th, 2018, 1:42 pm
Heading into Rome, Novak Djokovic was reeling with just six wins in 12 matches, but the Serb has since turned things around in big way, taking 27 of his last 31 matches including titles and Wimbledon and yesterday at Cincinnati, which gave him the full set of Masters trophies.
The results have risen his ranking. He was down to No. 22 in June, but is up to No. 6 as today in the 52-week rankings, with no points to defend until January.
And in the 2018 Race, he is now at No. 3, just behind 175 points behind No. 2 Roger Federer and 2,315 behind No. 1 Rafael Nadal.
If Djokovic were to win the US Open, he will pass Federer and narrow the gap between he and Nadal at least by 600-1000 pts, if not more, heading into the fall season when the Spaniard often struggles.
Federer is also in the same situation as Djokovic, though the Swiss is likely not to play as much as Djokovic the last few months, although he could change things up if he close to the No. 1.
But If Nadal wins the US Open, he’ll be tough to pass down the stretch.
Alexander Zverev and former champions Juan Martin del Potro and Marin Cilic could also get into the No. 1 hunt but they’ll need to be playing on the final Sunday in New York.
“I think it will be a very exciting end to the season, because everybody’s going to probably be healthy or healthier again,” Federer said. “It’s nice to see Novak come back, and Milos has been playing great tennis again. Stan seems solid again. Same with Nishikori. These are all guys that we were missing for the last nine months or so.”
It’s also amazing that’s in August 2018, the Big 3 occupy the Top 3 spots in the Race.
Djokovic last ranked No. 1 on November 6, 2016.
ATP RACE STANDINGS (as of August 20, 2018)
1 Rafael Nadal 6760
2 Roger Federer 4620
3 Novak Djokovic 4445
4 Alexander Zverev 4275
5 Juan Martin del Potro 3710
6 Marin Cilic 3455
7 Kevin Anderson 3270
8 Dominic Thiem 3005
9 John Isner 2570
10 Fabio Fognini 1895
Rafael Nadal Overtakes Novak Djokovic For No. 1 In 2012 ATP Rankings Race
37-Year-Old Roger Federer Leads The ATP Race Heading Into The Clay Season
Rafael Nadal Closes Gap With Roger Federer For Rankings Race Lead
For The First Time In ATP Rankings History, The Entire Top 5 Is 30+
Novak Djokovic Increases No. 1 Lead Over Roger Federer In 2012 ATP Points Race
Read more stories about: No. 1 ranking
Tags: Alexander Zverev, Juan Martin Del Potro, Novak Djokovic, Rafael Nadal, Roger Federer
4 Comments for Novak Djokovic Up To 6th In ATP Race Rankings And In Position For Run At No. 1
This indeed is a huge shift, by the end of Asian swing Djoko could be #1. But to do so he has to wins USO and one of Beijing (a title he dominated for year) or Shangai. He doesn’t need to win 3, and will depending on how Nadal perform in these next 3 events.
Nadal defends a lot of points next 3 tourneys: 2000 for USO + 500 for Beijing + 600 from Shangai finals = 3.100 pts, while Djoko has 0
If we took this points out, they currently have:
– Nadal: 10.040 – 3.100 = 6.940 pts
– Djoko: 4.445 pts
A 2.495 pts gap
Djoko would have to win 2.500 more pts than Nadal in these 3 tourneys. Hard, but doable. If Nadal loses in USO before semis, the ranking gap will decrease between all players as Nadal will get below 9.000 pts.
The best scenario for Djoko right now would be to land in Nadal QF draw in USO, this way he has a direct chance to control the result of that mach and future possible ranking, whereas if he is on the other side he will have to depend on Nadal’s results.
The #1 ranking will already be on the line at USO. If Fed wins it and Nadal loses before semis Fed will be #1.
August 20th, 2018 at 7:20 pm
Giles Says:
Funnily enough joker is not entered for the China Open.
August 21st, 2018 at 8:01 am
Nitesh Says:
Nothing gets out from speculations. Getting a No. 1 ranking is a complex thing.You need to play good and still depend on others.
August 22nd, 2018 at 7:00 am
I hope no. 1 ranking will be decided in Atp finals.
|
cc/2021-04/en_middle_0021.json.gz/line2175
|
__label__wiki
| 0.762929
| 0.762929
|
Novak Djokovic announces launch of breakaway player association
Novak Djokovic has announced the launch of a breakaway men’s player association, despite strong opposition from Roger Federer, Rafael Nadal and Andy Murray.
World number one Djokovic and Canadian player Vasek Pospisil are behind the formation of the Professional Tennis Players Association (PTPA), which they hope can co-exist alongside the ATP Player Council.
The first players to sign up for the PTPA met on Saturday at the Billie Jean King National Tennis Centre in New York, where the US Open begins on Monday.
Around 60 players posed for a photo posted on social media, with Djokovic writing: “After yesterday’s successful meeting, we are excited to announce the beginning of the Professional Tennis Players Association (PTPA). The first player only association in tennis since 1972. #PTPA.”
After yesterday’s successful meeting, we are excited to announce the beginning of the Professional Tennis Players Association (PTPA). The first player only association in tennis since 1972. #PTPA pic.twitter.com/q8H0aOdqDl
— Novak Djokovic (@DjokerNole) August 30, 2020
Djokovic previously said he would be asking the top 500 men’s singles players in the world and the top 200 doubles players for their support, but Federer, Nadal and Murray have all spoken out against the idea, while the ATP, WTA, ITF and all four grand slams have also called for unity.
“Legally we are 100 per cent safe and we are allowed to form the player association. This is not a union. This is a player association,” Djokovic said on Saturday. “So we are not calling for boycotts. We are not forming parallel tours.
“Our goal is to try to secure support from the players and try to get an indication of support. We don’t have a minimum number of players that will sign or maximum number of players that will sign.
“We are hoping we can get the majority of those players. We are aware that it most likely will not be the case today, but we are giving it time.
Novak Djokovic (left) would like the support of Roger Federer (right) for the new Professional Tennis Players Association (Tess Derry/PA)
“Of course I would love to have Roger and Rafa on board. Of course I would love to have all the players on board. But I understand. I truly understand that, you know, some of them have different opinions and they don’t think the time is right. Again, I think the time is right.”
Murray said he would not be signing a letter of support, adding: “I’m not totally against a player union, player association, but right now there’s a couple of things.
“One is I feel like the current management that are in place should be given some time to implement their vision. Whether that works out or not would potentially influence me in the future as to which way I would go.
“Also the fact that the women aren’t part of it, I feel like that would send a significantly – well, just a much more powerful message personally if the WTA were on board with it as well. That’s not currently the case.”
The world is living a difficult and complicated situation. I personally believe these are times to be calm and work all of us together in the same direction. It is time for unity, not for separation.
— Rafa Nadal (@RafaelNadal) August 29, 2020
Nadal, who has opted not to defend his US Open title due to the coronavirus pandemic, wrote on Twitter: “The world is living a difficult and complicated situation. I personally believe these are times to be calm and work all of us together in the same direction. It is time for unity, not for separation.
“These are moments where big things can be achieved as long as the world of tennis is united. We all, players, tournaments and governing bodies have to work together. We have a bigger problem and separation and disunion is definitely not the solution.”
‘Real fortunate to get through,’ says Cameron Norrie after beating Frances Tiafoe at Delray Beach Open
Cameron Norrie continues great run at Delray Beach.
Strict Australian Open quarantine regulations announced and those who flout rules face heavy fines
Officials will come down hard on those who flout rules.
Tennis Today: Player in face mask U-turn, Rafael Nadal’s cousins following in his footsteps
Tennis Today features Osaka and Nadal.
‘I decided to stay home,’ says John Isner after pulling out of the 2021 Australian Open
‘It wasn’t an easy decision at all,’ says John Isner.
Maria Sakkari scores another big win as she dumps out Sofia Kenin in Abu Dhabi while Elina Svitolina also falls
Top two fall in Abu Dhabi.
Kyle Edmund forced to withdraw from Australian Open due to long-standing knee problem
Kyle Edmund won’t feature at the 2021 Australian Open.
Rafael Nadal finding it ‘tough’ to ‘solve’ the Novak Djokovic puzzle on Australian Open hard courts
Nadal yet to find game plan to beat Djokovic in Melbourne.
Novak Djokovic and Rafael Nadal backed to continue their dominance of men’s tennis in 2021
No changes at the top expected.
Simona Halep prepared for ‘mental’ challenges that daunting Australian Open quarantine period poses
Halep all set for quarantine period.
French star hits out at extra privileges given to Novak Djokovic, Rafael Nadal, Serena Williams
Jeremy Chardy unimpressed.
|
cc/2021-04/en_middle_0021.json.gz/line2176
|
__label__wiki
| 0.844869
| 0.844869
|
Serena Williams opens up about postpartum emotions: I felt like I was not a good mom
Former world No 1 Serena Williams has opened up about her “postpartum emotions” after a difficult week.
The 23-time Grand Slam winner suffered the worst defeat of her career in the first round of the Silicon Valley Classic as she went down 6-1, 6-0 to Great Britain’s Johanna Konta.
She was due to play in the Rogers Cup on Monday, but withdrew on Saturday, citing “personal reasons”.
The 36-year-old has only played in five tournaments since she returned to the WTA Tour following the birth of her daughter Olympia in September last year.
In an emotional Instagram post, she admitted life is not easy.
“Last week was not easy for me. Not only was I accepting some tough personal stuff, but I just was in a funk. Mostly, I felt like I was not a good mom.
“I read several articles that said postpartum emotions can last up to 3 years if not dealt with. I like communication best. Talking things through with my mom, my sisters, my friends let me know that my feelings are totally normal.
“It’s totally normal to feel like I’m not doing enough for my baby.
“We have all been there. I work a lot, I train, and I’m trying to be the best athlete I can be.
“However, that means although I have been with her every day of her life, I’m not around as much as I would like to be. Most of you moms deal with the same thing. Whether stay-at-home or working, finding that balance with kids is a true art. You are the true heroes.
“I’m here to say: if you are having a rough day or week–it’s ok–I am, too!!! There’s always tomm!”
Quarantine plan revealed for the game’s top players ahead of Australian Open
The world’s leading players will quarantine in Adelaide rather than Melbourne ahead of the Australian Open.
Rising star provisionally suspended from all tennis activity following a positive doping test
Ukrainian rising star Dayana Yastremska has been…
Is this the real reason why Roger Federer is skipping next month’s Australian Open?
Roger Federer suggested he pulled out of the Australian Open for fitness reasons, yet other reasons were in play.
Sofia Kenin wins as the tennis season gets underway despite doubts over what happens next
No.1 seed Sofia Kenin of the United…
Formula 1 ace Jenson Button has admitted he is ‘in awe’ of the tennis giants of the modern era.
British Davis Cup captain Leon Smith believes Dan Evans could be a player to watch in 2021.
Tennis star Camila Giorgi draws mixed response after posting sexy lingerie images on social media
Tennis star Camila Giorgi has been targeted by online trolls after sharing a series of racy lingerie snaps on her social media channels.
Legendary coach of Boris Becker and Goran Ivanisevic loses his fight with cancer
Bob Brett, one of tennis’ most respected coaches and a former director of player development has died of cancer.
Australian Open organisers scrambling to finalise preparations for players
The hard work appeared to have been done when Tennis Australia announced last month that the tournament would start on February 8.
Novak Djokovic and Rafael Nadal to lead the field at the ATP Cup next month
Novak Djokovic and Rafael Nadal will lead a star-studded field at the ATP Cup next month.
ATP tennis betting special: Roger Federer to win Wimbledon next year? Andy Murray to win a title?
|
cc/2021-04/en_middle_0021.json.gz/line2177
|
__label__cc
| 0.645657
| 0.354343
|
Daniil Medvedev cops $9,000 fine after explosive US Open match
Daniil Medvedev will have to fork out $9,000 after he was hit with two fines on the back of his hostile US Open match against Feliciano Lopez.
The fifth-seeded Medvedev saw off the Spaniard 7-6 (7-1), 4-6, 7-6 (9-7), 6-4, but he was booed by the crowd throughout the match.
He didn’t help himself as he snatched a towel from a ball boy, threw his racket and flipped the middle finger to the spectators.
And now, a very special message from Daniil Medvedev. pic.twitter.com/hlfhhjULCA
— Wilfy (@whitelinefervor) August 31, 2019
At the end of the match he thanked the crowd for their “support”.
“I want all of you to know, when you go to sleep at night, I won because of you,” he said. “The energy you’re giving me right now, guys, I think it will be enough for my five next matches. The more you do this, the more I will win, for you guys.”
‘The energy you are giving me (by booing) will be enough for my next 5 matches’
– Daniil Medvedevpic.twitter.com/MEgJyV8mBC 😂
— The Tennis Podcast (@TennisPodcast) August 31, 2019
The Russian has been hit with a total fine of $9,000 (about £7,400) by US Open officials: $5,000 for unsportsmanlike conduct and $4,000 for a visible obscenity.
Follow us on Twitter @T365Official and like our Facebook page.
|
cc/2021-04/en_middle_0021.json.gz/line2178
|
__label__wiki
| 0.812596
| 0.812596
|
Spotlights–Shoobies, Neil Zaza, Jorge Drexler, Tower of Power, Nanga Jazz World Trio
Catch These Hometown Heroes Live
by Debra Kate Schafer
This South Jersey band’s modern rendition of the emo-pop genre is truly something to behold. Shoobies are a successful five-piece collective that began as a duo just wanting to escape small town boredom. In three short years, they became the hardest working DIY band in the area, growing themselves, their sound, and their fanbase from those at their first show–A Battle of the Bands competition at The Stone Pony–to approximately 60,000 monthly Spotify listeners from across the globe. Their distinctive approach to synth pop in 2020 mixed in with their adoration for bands like The Cure and The Smiths has curated a darker, eclectic, slick, goth-pop sound that revels in their black and white visuals and heartbreak based lyrics. Celebrate all that is music from Shoobies at their debut album release show at House of Independents March 13.
The Experience That Is Neil Zaza
Neil Zaza is a world renowned, melodic, instrumental guitarist. No exaggeration: this man is a beloved global phenomenon and is looked at as a “worldwide ambassador” for the instrument and what it can do. He creates intricately crafted rock ‘n’ roll that is technically sound, uniquely written, and ridiculously memorable. Nobody can do what he can with his instrument and his talent. It has made for multiple fan-favorite albums, international touring, room for new inspiration, and creative growth. Ohio-born and raised, Zaza has a strong connection to the East Coast, meaning that his show at the Brighton Bar in Long Branch on March 14 is sure to be filled to the brim with instrumental rock fans coming in from near and far. For tickets, head over to songkick.com.
Jorge Drexler Is More Than A Singer
When you say that a singer is multi-talented, you assume they can play an instrument or two, possibly even write a couple of hit songs. What about being a surgeon? Specifically a head and neck surgeon? Well, Uruguayan-born Jorge Drexler checks all of those boxes and more. The Latin pop singer-songwriter is talented in many ways and has been since the start of his career in the mid-nineties, which is exactly why it was so well-deserved that he was the first Uruguayan performer to win an Academy Award for composing the lead song from The Motorcycle Diaries. Drexler is beloved all across the globe and his music is upbeat and resonating, whether or not you speak his language. Experience it for yourself at the Town Hall on Mar. 15. Visit songkick.com for tickets.
Tower Of Power At The Tower
by Mike Greenblatt
It’s fitting that one of America’s great horn sections, Tower Of Power, will play the Tower Theatre in the Philadelphia suburb of Upper Darby, Pennsylvania on March 21. This Oakland, California soul machine has been around since the sixties. There was a time when almost every major act yearned to have these horns pumping away behind them. The list of major artists they’ve collaborated with is staggering Otis Redding, Aaron Neville, Aerosmith, Bonnie Raitt, Elton John, Huey Lewis, Little Feat, Heart, and Santana are but a few. They’ve put out great music on their own, too. They’re loud, brassy, in-your-face, and it is scientifically impossible to sit still when they’re on a stage.
Nanga In The Gap
The Nanga Jazz World Trio—bassist Christopher Dean Sullivan, pianist Patrick Poladian, and drummer Vernon J. Mobley—will perform March 27 at The Deer Head Inn in Delaware Water Gap, Pennsylvania. Bassist Sullivan has shared stages with Freddie Hubbard, Christian McBride, Stanley Jordan, Joe Lovano, and Sonny Fortune. Influenced by Slam Stewart and Ray Brown, whether he’s on a bow or plucking away, he’s like a geyser erupting molten lava from the Earth’s core. The venue itself, adjacent to the Appalachian Trail within a picturesque national park, is a wonder to behold.
brighton bardebra kate schafergoings-onhouse of independentsjorge drexlermike greenblattnana jazz worldneil zazashoobiesspotlightsthe deer head inntower of powertown hallupper darby
Mike Greenblatt’s Rant ‘n’ Roll
Spotlights–MARO, Beasto Blanco
Tim Louie
Happy St. Patrick’s Day From The Chieftains!
Katherine Yeske Taylor
Spotlights–Terrapin Family Band, The Jayhawks, Bill Popp, PowerSnap, Steve Hackett, Deletto
|
cc/2021-04/en_middle_0021.json.gz/line2183
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.