Upload Fold_type_fold_type/dev/data.json with huggingface_hub
Browse files
Fold_type_fold_type/dev/data.json
ADDED
|
@@ -0,0 +1,22 @@
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
| 1 |
+
[
|
| 2 |
+
{
|
| 3 |
+
"input": "According to the SCOPe data set, the structure of all sequences can be simply divided into 1195 categories from 0 to 1194. Please divide the following protein sequences into one of the categories. <protein>PIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQEFFPKFKGLTTADELKKSADVRWHAERIINAVDDAVASMDDTEKMSMKLRNLSGKHAKSFQVDPEYFKVLAAVIADTVAAGDAGFEKLMSMICILLRSAY</protein>",
|
| 4 |
+
"output": "0"
|
| 5 |
+
},
|
| 6 |
+
{
|
| 7 |
+
"input": "According to the SCOPe data set, the structure of all sequences can be simply divided into 1195 categories from 0 to 1194. Please divide the following protein sequences into one of the categories. <protein>LSAAQKDNVKSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGLFSGAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLAGFMKSYGGDEGAWTAVAGALMGMIRPDM</protein>",
|
| 8 |
+
"output": "0"
|
| 9 |
+
},
|
| 10 |
+
{
|
| 11 |
+
"input": "According to the SCOPe data set, the structure of all sequences can be simply divided into 1195 categories from 0 to 1194. Please divide the following protein sequences into one of the categories. <protein>GATQSFQSVGDLTPAEKDLIRSTWDQLMTHRTGFVADVFIRIFHNDPTAQRKFPQMAGLSPAELRTSRQMHAHAIRVSALMTTYIDEMDTEVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAELGVGFTKQVHDAWAKTFAIVQGVLITKHAS</protein>",
|
| 12 |
+
"output": "0"
|
| 13 |
+
},
|
| 14 |
+
{
|
| 15 |
+
"input": "Please predict the folding category of the given protein sequence. The output should be a number between 0 and 1194, reflecting the classification system used in the SCOPe dataset. <protein>VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTTRLFSKLQGLFSANDIGVQQHADKVQRALGEAIDDLKKVEINFQNLSGKHQEIGVDTQNFKLLGQTFMVELALHYKKTFRPKEHAAAYKFFRLVAEALSSNYH</protein>",
|
| 16 |
+
"output": "0"
|
| 17 |
+
},
|
| 18 |
+
{
|
| 19 |
+
"input": "Please predict the folding category of the given protein sequence. The output should be a number between 0 and 1194, reflecting the classification system used in the SCOPe dataset. <protein>GLSAAQRQVVASTWKDIAGADNGAGVGKECLSKFISAHPEMAAVFGFSGASDPGVAELGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGNKHIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYGDISGALISGLQS</protein>",
|
| 20 |
+
"output": "0"
|
| 21 |
+
}
|
| 22 |
+
]
|