Update README.md

README.md

@@ -37,4 +37,69 @@ size_categories:
 - 1K<n<10K
 ---
 
+# Dataset Card for Contact Prediction Dataset
+
+### Dataset Summary
+
+Contact map prediction aims to determine whether two residues, $i$ and $j$, are in contact or not, based on their distance with a certain threshold ($<$8 Angstrom). This task is an important part of the early Alphafold version for structural prediction. 
+
+## Dataset Structure
+
+### Data Instances
+
+For each instance, there is a string of the protein sequences, a sequence for the contact labels. The each of the sub-labels "[2, 3]" indicates the 3rd residue are in contact with the 4th residue (start from index 0). See the [Contact map prediction dataset viewer](https://huggingface.co/datasets/Bo1015/contact_prediction_binary/viewer/default/test) to explore more examples.
+
+```
+{'seq':'QNLLKNLAASLGRKPFVADKQGVYRLTIDKHLVMLAPHGSELVLRTPIDAPMLREGNNVNVTLLRSLMQQALAWAKRYPQTLVLDDCGQLVLEARLRLQELDTHGLQEVINKQLALLEHLIPQLTP'
+'label': [ [ 0, 0 ], [ 0, 1 ], [ 1, 1 ], [ 1, 2 ], [ 1, 3 ], [ 1, 101 ], [ 2, 2 ], [ 2, 3 ], [ 2, 4 ], [ 3, 3 ], [ 3, 4 ], [ 3, 5 ], [ 3, 99 ], [ 3, 100 ], [ 3, 101 ], [ 4, 4 ], [ 4, 5 ], [ 4, 53 ], ...]}
+```
+
+The average  for the `seq` and the `label` are provided below:
+
+| Feature    | Mean Count |
+| ---------- | ---------------- |
+| seq    | 249        |
+| label | 1,500             |
+
+### Data Fields
+
+- `seq`: a string containing the protein seqeunce
+- `label`: a string containing the contact label of each residue pair.
+
+### Data Splits
+
+The CNN/DailyMail dataset has 3 splits: _train_, _validation_, and _test_. Below are the statistics for Version 3.0.0 of the dataset.
+
+| Dataset Split | Number of Instances in Split                |
+| ------------- | ------------------------------------------- |
+| Train         | 12,041                              |
+| Validation    | 1,505                                      |
+| Test          | 1,505                                      |
+
+### Source Data
+
+#### Initial Data Collection and Normalization
+
+The [trRosetta dataset]() is employed and the same split. 
+
+
+### Licensing Information
+
+The dataset is released under the [Apache-2.0 License](http://www.apache.org/licenses/LICENSE-2.0). 
+
+### Citation
+If you find our work useful, please consider citing the following paper:
+
+```
+@misc{chen2024xtrimopglm,
+  title={xTrimoPGLM: unified 100B-scale pre-trained transformer for deciphering the language of protein},
+  author={Chen, Bo and Cheng, Xingyi and Li, Pan and Geng, Yangli-ao and Gong, Jing and Li, Shen and Bei, Zhilei and Tan, Xu and Wang, Boyan and Zeng, Xin and others},
+  year={2024},
+  eprint={2401.06199},
+  archivePrefix={arXiv},
+  primaryClass={cs.CL},
+  note={arXiv preprint arXiv:2401.06199}
+}
+```
+