File size: 1,498 Bytes
38adcf4 |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 |
## NeuroPred-PLM: an interpretable and robust model for prediction of neuropeptides by protein language model
[](https://pypi.org/project/NeuroPredPLM/) [](https://pypi.org/project/NeuroPredPLM/) [](./LICENSE) 
### Requirements
To install requirements:
```
# latest version
pip install git+https://github.com/ISYSLAB-HUST/NeuroPred-PLM.git
# stable version
pip install NeuroPredPLM
```
### Usage [<img src="https://colab.research.google.com/assets/colab-badge.svg">](https://colab.research.google.com/github/ISYSLAB-HUST/NeuroPred-PLM/blob/master/notebook/NeuroPred_PLM_test.ipynb)
```
import torch
from NeuroPredPLM.predict import predict
data = [
("peptide_1", "IGLRLPNMLKF"),
("peptide_2", "QAAQFKVWSASELVD"),
("peptide_3","LRSPKMMHKSGCFGRRLDRIGSLSGLGCNVLRKY")
]
device = "cuda" if torch.cuda.is_available() else "cpu"
neuropeptide_pred = predict(data,device)
# {peptide_id:[Type:int(1->neuropeptide,0->non-neuropeptide), attention score:nd.array]}
```
### License
Released under the [MIT license](LICENSE).
### Contact
If you have any questions, comments, or would like to report a bug, please file a Github issue or contact me at wanglei94@hust.edu.cn. |