File size: 14,138 Bytes
bfe2230 | 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 | ---
datasets:
- multimolecule/uniref
- multimolecule/bfd
- multimolecule/oas
library_name: multimolecule
license: agpl-3.0
pipeline_tag: text-generation
tags:
- Biology
- Protein
widget:
- example_title: prion protein (Kanno blood group)
expected_suffix: G
output:
text: MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPVILLISFLIFLIV
S T A Q K Q T L T A L N A A - K L T L L Q Q L L J H A L J S J L A - M Q Q S
H J L V S H V R I V
pipeline_tag: text-generation
sequence_type: Protein
task: text-generation
text: MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPVILLISFLIFLIV
- example_title: interleukin 10
expected_suffix: N
output:
text: MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIR
K A S A S S H V E S K J - L A T A E V N A S S G - L - A - T T L A L R N G A
- J A V Y L V V S T S
pipeline_tag: text-generation
sequence_type: Protein
task: text-generation
text: MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIR
- example_title: Zaire ebolavirus
expected_suffix: Y
output:
text: NVQTLCEALLADGLAKAFPSNMMVVTEREQKESLLHQASWHHTSDDFGEHATVRGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQC
S A I A E S A - Y A A J Q M A V T E H L D S J L Q H A E A E R K G L E A A Q
L M A D L V G T A A V
pipeline_tag: text-generation
sequence_type: Protein
task: text-generation
text: NVQTLCEALLADGLAKAFPSNMMVVTEREQKESLLHQASWHHTSDDFGEHATVRGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQC
- example_title: SARS coronavirus
expected_suffix: S
output:
text: MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFDNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFKCTFEYI
V A A A A G T T A K A A L K E A K J K E A T S S S - W A A A S J Q L A A J D
A A R E Q S T A S V
pipeline_tag: text-generation
sequence_type: Protein
task: text-generation
text: MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFDNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFKCTFEYI
---
# ProGen2
Pre-trained model on protein sequences using a causal language modeling (CLM) objective.
## Disclaimer
This is an UNOFFICIAL implementation of the [ProGen2: Exploring the Boundaries of Protein Language Models](https://doi.org/10.1016/j.cels.2023.10.002) by Erik Nijkamp, Jeffrey A. Ruffolo, et al.
The OFFICIAL repository of ProGen2 is at [enijkamp/progen](https://github.com/enijkamp/progen2).
> [!TIP]
> The MultiMolecule team has confirmed that the provided model and checkpoints are producing the same intermediate representations as the original implementation.
**The team releasing ProGen2 did not write this model card for this model so this model card has been written by the MultiMolecule team.**
## Model Details
ProGen2 is a [GPT-J](https://huggingface.co/EleutherAI/gpt-j-6b)-style model pre-trained on a large corpus of protein sequences in a self-supervised fashion. This means that the model was trained on the raw amino acids of protein sequences only, with an automatic process to generate inputs and labels from those sequences. Please refer to the [Training Details](#training-details) section for more information on the training process.
### Variants
- **[multimolecule/progen2-xlarge](https://huggingface.co/multimolecule/progen2-xlarge)**: The ProGen2 model pre-trained on Uniref90 and BFD30 with 6.4 billion parameters.
- **[multimolecule/progen2-large](https://huggingface.co/multimolecule/progen2-large)**: The ProGen2 model pre-trained on Uniref90 and BFD30 with 2.7 billion parameters.
- **[multimolecule/progen2-bfd90](https://huggingface.co/multimolecule/progen2-bfd90)**: The ProGen2 model pre-trained on Uniref90 and BFD90 with 2.7 billion parameters.
- **[multimolecule/progen2-large](https://huggingface.co/multimolecule/progen2-large)**: The ProGen2 model pre-trained on Uniref90 and BFD30 with 764 million parameters.
- **[multimolecule/progen2-oas](https://huggingface.co/multimolecule/progen2-oas)**: The ProGen2 model pre-trained on OAS with 764 million parameters.
- **[multimolecule/progen2-medium](https://huggingface.co/multimolecule/progen2-medium)**: The ProGen2 model pre-trained on Uniref90 and BFD30 with 764 million parameters.
- **[multimolecule/progen2-small](https://huggingface.co/multimolecule/progen2-small)**: The ProGen2 model pre-trained on Uniref90 and BFD30 with 151 million parameters.
### Model Specification
<table>
<thead>
<tr>
<th>Variants</th>
<th>Num Layers</th>
<th>Hidden Size</th>
<th>Num Heads</th>
<th>Intermediate Size</th>
<th>Num Parameters (M)</th>
<th>FLOPs (G)</th>
<th>MACs (G)</th>
<th>Context Length</th>
</tr>
</thead>
<tbody>
<tr>
<td>ProGen2-xlarge</td>
<td rowspan="3">32</td>
<td>4096</td>
<td>16</td>
<td>16384</td>
<td>6443.66</td>
<td>6735.76</td>
<td>3367.27</td>
<td rowspan="3">1024</td>
</tr>
<tr>
<td><b>ProGen2-large</b></td>
<td rowspan="2">2560</td>
<td rowspan="2">32</td>
<td rowspan="2">10240</td>
<td rowspan="2">2517.34</td>
<td rowspan="2">2664.21</td>
<td rowspan="2">1331.45</td>
</tr>
<tr>
<td>ProGen2-bfd90</td>
</tr>
<tr>
<td>ProGen2-base</td>
<td rowspan="3">27</td>
<td rowspan="3">1536</td>
<td rowspan="4">16</td>
<td rowspan="3">6144</td>
<td rowspan="3">764.81</td>
<td rowspan="3">826.85</td>
<td rowspan="3">413.12</td>
<td>2048</td>
</tr>
<tr>
<td>ProGen2-oas</td>
<td rowspan="3">1024</td>
</tr>
<tr>
<td>ProGen2-medium</td>
</tr>
<tr>
<td>ProGen2-small</td>
<td>12</td>
<td>1024</td>
<td>4096</td>
<td>151.15</td>
<td>167.74</td>
<td>83.75</td>
</tr>
</tbody>
</table>
### Links
- **Code**: [multimolecule.progen2](https://github.com/DLS5-Omics/multimolecule/tree/master/multimolecule/models/progen2)
- **Weights**: [multimolecule/progen2](https://huggingface.co/multimolecule/progen2-large)
- **Data**: [UniRef](https://www.uniprot.org/uniref), [BFD](https://bfd.mmseqs.com)
- **Paper**: [ProGen2: Exploring the Boundaries of Protein Language Models](https://doi.org/10.1016/j.cels.2023.10.002)
- **Developed by**: Erik Nijkamp, Jeffrey A. Ruffolo, Eli N. Weinstein, Nikhil Naik, Ali Madani
- **Model type**: [GPT-J](https://huggingface.co/EleutherAI/gpt-j-6b)
- **Original Repository**: [enijkamp/progen2](https://github.com/enijkamp/progen2)
## Usage
The model file depends on the [`multimolecule`](https://multimolecule.danling.org) library. You can install it using pip:
```bash
pip install multimolecule
```
### Direct Use
#### Text Generation
You can use this model directly with a pipeline for text generation:
```python
import multimolecule # you must import multimolecule to register models
from transformers import pipeline
generator = pipeline("text-generation", model="multimolecule/progen2-large")
output = generator("MGHGVSRPPVVTLR", max_new_tokens=50)
```
### Downstream Use
#### Extract Features
Here is how to use this model to get the features of a given sequence in PyTorch:
```python
from multimolecule import ProteinTokenizer, ProGen2Model
tokenizer = ProteinTokenizer.from_pretrained("multimolecule/progen2-large")
model = ProGen2Model.from_pretrained("multimolecule/progen2-large")
text = "MGHGVSRPPVVTLRPAVLDDCPVLWR"
input = tokenizer(text, return_tensors="pt")
output = model(**input)
```
#### Sequence Classification / Regression
> [!NOTE]
> This model is not fine-tuned for any specific task. You will need to fine-tune the model on a downstream task to use it for sequence classification or regression.
Here is how to use this model as backbone to fine-tune for a sequence-level task in PyTorch:
```python
import torch
from multimolecule import ProteinTokenizer, ProGen2ForSequencePrediction
tokenizer = ProteinTokenizer.from_pretrained("multimolecule/progen2-large")
model = ProGen2ForSequencePrediction.from_pretrained("multimolecule/progen2-large")
text = "MGHGVSRPPVVTLRPAVLDDCPVLWR"
input = tokenizer(text, return_tensors="pt")
label = torch.tensor([1])
output = model(**input, labels=label)
```
#### Token Classification / Regression
> [!NOTE]
> This model is not fine-tuned for any specific task. You will need to fine-tune the model on a downstream task to use it for token classification or regression.
Here is how to use this model as backbone to fine-tune for a residue-level task in PyTorch:
```python
import torch
from multimolecule import ProteinTokenizer, ProGen2ForTokenPrediction
tokenizer = ProteinTokenizer.from_pretrained("multimolecule/progen2-large")
model = ProGen2ForTokenPrediction.from_pretrained("multimolecule/progen2-large")
text = "MGHGVSRPPVVTLRPAVLDDCPVLWR"
input = tokenizer(text, return_tensors="pt")
label = torch.randint(2, (len(text), ))
output = model(**input, labels=label)
```
## Training Details
ProGen2 used Causal Language Modeling (CLM) as the pre-training objective: given a protein sequence, the model is trained to predict the next amino acid token autoregressively.
### Training Data
The ProGen2 models were pre-trained on protein sequence databases:
- **Uniref90**: A clustered version of the UniProt database at 90% sequence identity, containing approximately 135 million sequences.
- **BFD30**: The Big Fantastic Database clustered at 30% sequence identity, approximately one-third the size of Uniref90.
- **BFD90**: The Big Fantastic Database clustered at 90% sequence identity, approximately twice the size of Uniref90.
- **OAS**: The Observed Antibody Space database, clustered at 85% sequence identity.
Different model variants were trained on different combinations:
- **progen2-small, progen2-medium, progen2-base, progen2-large, progen2-xlarge**: Trained on Uniref90 and BFD30.
- **progen2-bfd90**: Trained on Uniref90 and BFD90.
- **progen2-oas**: Trained on the OAS database.
### Training Procedure
ProGen2 used causal language modeling (CLM) as the pre-training objective.
#### Pre-training
The model was trained on Google TPU-v3 pods using JAX.
- Batch size: 500,000 -- 1,000,000
- Steps: 350,000 -- 400,000
- Optimizer: Adam(β1=0.9, β2=0.999, ε=1e-8)
- Learning rate: 1e-5 -- 6e-4
- Learning rate scheduler: Cosine
- Learning rate warm-up: 3,000 -- 10,000 steps
- Weight decay: 0.1
- Maximum Gradient Norm: 0.8 -- 1.0
## Citation
**BibTeX**:
```bibtex
@ARTICLE{Nijkamp2023-jz,
title = "{ProGen2}: Exploring the boundaries of protein language models",
author = "Nijkamp, Erik and Ruffolo, Jeffrey A and Weinstein, Eli N and
Naik, Nikhil and Madani, Ali",
abstract = "Attention-based models trained on protein sequences have
demonstrated incredible success at classification and generation
tasks relevant for artificial-intelligence-driven protein
design. However, we lack a sufficient understanding of how very
large-scale models and data play a role in effective protein
model development. We introduce a suite of protein language
models, named ProGen2, that are scaled up to 6.4B parameters and
trained on different sequence datasets drawn from over a billion
proteins from genomic, metagenomic, and immune repertoire
databases. ProGen2 models show state-of-the-art performance in
capturing the distribution of observed evolutionary sequences,
generating novel viable sequences, and predicting protein
fitness without additional fine-tuning. As large model sizes and
raw numbers of protein sequences continue to become more widely
accessible, our results suggest that a growing emphasis needs to
be placed on the data distribution provided to a protein
sequence model. Our models and code are open sourced for
widespread adoption in protein engineering. A record of this
paper's Transparent Peer Review process is included in the
supplemental information.",
journal = "Cell Syst.",
publisher = "Elsevier BV",
volume = 14,
number = 11,
pages = "968--978.e3",
month = nov,
year = 2023,
keywords = "fitness prediction; language modeling; protein design",
copyright = "http://www.elsevier.com/open-access/userlicense/1.0/",
language = "en"
}
```
> [!NOTE]
> The artifacts distributed in this repository are part of the MultiMolecule project.
> If you use MultiMolecule in your research, you must cite the MultiMolecule project as follows:
```bibtex
@software{chen_2024_12638419,
author = {Chen, Zhiyuan and Zhu, Sophia Y.},
title = {MultiMolecule},
doi = {10.5281/zenodo.12638419},
publisher = {Zenodo},
url = {https://doi.org/10.5281/zenodo.12638419},
year = 2024,
month = may,
day = 4
}
```
## Contact
Please use GitHub issues of [MultiMolecule](https://github.com/DLS5-Omics/multimolecule/issues) for any questions or comments on the model card.
Please contact the authors of the [ProGen2 paper](https://doi.org/10.1016/j.cels.2023.10.002) for questions or comments on the paper/model.
## License
This model is licensed under the [GNU Affero General Public License](license.md).
For additional terms and clarifications, please refer to our [License FAQ](license-faq.md).
```spdx
SPDX-License-Identifier: AGPL-3.0-or-later
``` |