diff --git a/.gitattributes b/.gitattributes index a6344aac8c09253b3b630fb776ae94478aa0275b..38fc76a0d641ffc2ef113fdd6506b7951d9ac085 100644 --- a/.gitattributes +++ b/.gitattributes @@ -1,35 +1,62 @@ -*.7z filter=lfs diff=lfs merge=lfs -text -*.arrow filter=lfs diff=lfs merge=lfs -text -*.bin filter=lfs diff=lfs merge=lfs -text -*.bz2 filter=lfs diff=lfs merge=lfs -text -*.ckpt filter=lfs diff=lfs merge=lfs -text -*.ftz filter=lfs diff=lfs merge=lfs -text -*.gz filter=lfs diff=lfs merge=lfs -text -*.h5 filter=lfs diff=lfs merge=lfs -text -*.joblib filter=lfs diff=lfs merge=lfs -text -*.lfs.* filter=lfs diff=lfs merge=lfs -text -*.mlmodel filter=lfs diff=lfs merge=lfs -text -*.model filter=lfs diff=lfs merge=lfs -text -*.msgpack filter=lfs diff=lfs merge=lfs -text -*.npy filter=lfs diff=lfs merge=lfs -text -*.npz filter=lfs diff=lfs merge=lfs -text -*.onnx filter=lfs diff=lfs merge=lfs -text -*.ot filter=lfs diff=lfs merge=lfs -text -*.parquet filter=lfs diff=lfs merge=lfs -text -*.pb filter=lfs diff=lfs merge=lfs -text -*.pickle filter=lfs diff=lfs merge=lfs -text -*.pkl filter=lfs diff=lfs merge=lfs -text -*.pt filter=lfs diff=lfs merge=lfs -text -*.pth filter=lfs diff=lfs merge=lfs -text -*.rar filter=lfs diff=lfs merge=lfs -text -*.safetensors filter=lfs diff=lfs merge=lfs -text -saved_model/**/* filter=lfs diff=lfs merge=lfs -text -*.tar.* filter=lfs diff=lfs merge=lfs -text -*.tar filter=lfs diff=lfs merge=lfs -text -*.tflite filter=lfs diff=lfs merge=lfs -text -*.tgz filter=lfs diff=lfs merge=lfs -text -*.wasm filter=lfs diff=lfs merge=lfs -text -*.xz filter=lfs diff=lfs merge=lfs -text -*.zip filter=lfs diff=lfs merge=lfs -text -*.zst filter=lfs diff=lfs merge=lfs -text -*tfevents* filter=lfs diff=lfs merge=lfs -text +*.7z filter=lfs diff=lfs merge=lfs -text +*.arrow filter=lfs diff=lfs merge=lfs -text +*.bin filter=lfs diff=lfs merge=lfs -text +*.bz2 filter=lfs diff=lfs merge=lfs -text +*.ckpt filter=lfs diff=lfs merge=lfs -text +*.ftz filter=lfs diff=lfs merge=lfs -text +*.gz filter=lfs diff=lfs merge=lfs -text +*.h5 filter=lfs diff=lfs merge=lfs -text +*.joblib filter=lfs diff=lfs merge=lfs -text +*.lfs.* filter=lfs diff=lfs merge=lfs -text +*.mlmodel filter=lfs diff=lfs merge=lfs -text +*.model filter=lfs diff=lfs merge=lfs -text +*.msgpack filter=lfs diff=lfs merge=lfs -text +*.npy filter=lfs diff=lfs merge=lfs -text +*.npz filter=lfs diff=lfs merge=lfs -text +*.onnx filter=lfs diff=lfs merge=lfs -text +*.ot filter=lfs diff=lfs merge=lfs -text +*.parquet filter=lfs diff=lfs merge=lfs -text +*.pb filter=lfs diff=lfs merge=lfs -text +*.pickle filter=lfs diff=lfs merge=lfs -text +*.pkl filter=lfs diff=lfs merge=lfs -text +*.pt filter=lfs diff=lfs merge=lfs -text +*.pth filter=lfs diff=lfs merge=lfs -text +*.rar filter=lfs diff=lfs merge=lfs -text +*.safetensors filter=lfs diff=lfs merge=lfs -text +saved_model/**/* filter=lfs diff=lfs merge=lfs -text +*.tar.* filter=lfs diff=lfs merge=lfs -text +*.tar filter=lfs diff=lfs merge=lfs -text +*.tflite filter=lfs diff=lfs merge=lfs -text +*.tgz filter=lfs diff=lfs merge=lfs -text +*.wasm filter=lfs diff=lfs merge=lfs -text +*.xz filter=lfs diff=lfs merge=lfs -text +*.zip filter=lfs diff=lfs merge=lfs -text +*.zst filter=lfs diff=lfs merge=lfs -text +*tfevents* filter=lfs diff=lfs merge=lfs -text +tools/cytoscape/v3.10.3/Cytoscape_3_10_3_macos_aarch64.dmg filter=lfs diff=lfs merge=lfs -text +tools/cytoscape/v3.10.3/Cytoscape_3_10_3_macos_x64.dmg filter=lfs diff=lfs merge=lfs -text +tools/cytoscape/v3.10.3/Cytoscape_3_10_3_unix.sh filter=lfs diff=lfs merge=lfs -text +tools/cytoscape/v3.10.3/Cytoscape_3_10_3_windows_64bit.exe filter=lfs diff=lfs merge=lfs -text +tools/cytoscape/v3.11.0-nightly/Cytoscape_3_11_0-SNAPSHOT_macos_aarch64.dmg filter=lfs diff=lfs merge=lfs -text +tools/cytoscape/v3.11.0-nightly/Cytoscape_3_11_0-SNAPSHOT_macos_x64.dmg filter=lfs diff=lfs merge=lfs -text +tools/cytoscape/v3.11.0-nightly/Cytoscape_3_11_0-SNAPSHOT_unix.sh filter=lfs diff=lfs merge=lfs -text +tools/cytoscape/v3.11.0-nightly/Cytoscape_3_11_0-SNAPSHOT_windows_64bit.exe filter=lfs diff=lfs merge=lfs -text +tools/gcmodeller/gcmodeller-workbench-main.png filter=lfs diff=lfs merge=lfs -text +tools/gcmodeller/gcmodeller-workbench-screen1.png filter=lfs diff=lfs merge=lfs -text +tools/gcmodeller/v0.0.1-alpha/GCModeller.z01 filter=lfs diff=lfs merge=lfs -text +tools/gcmodeller/v0.0.1-alpha/GCModeller.z02 filter=lfs diff=lfs merge=lfs -text +tools/gcmodeller/v0.0.1-alpha/GCModeller.z03 filter=lfs diff=lfs merge=lfs -text +tools/gcmodeller/v0.0.1-alpha/GCModeller.z04 filter=lfs diff=lfs merge=lfs -text +tools/tbtools/Microsoft_Runtimes_Collection_2019.07.20_X64.exe filter=lfs diff=lfs merge=lfs -text +tools/tbtools/v2.135/TBtools-II_macos_2_135.dmg filter=lfs diff=lfs merge=lfs -text +tools/tbtools/v2.135/TBtools-II_windows-x32_2_135.exe filter=lfs diff=lfs merge=lfs -text +tools/tbtools/v2.135/TBtools-II_windows-x64_2_135_latestJDK.exe filter=lfs diff=lfs merge=lfs -text +tools/tbtools/v2.135/TBtools-II_windows-x64_2_135.exe filter=lfs diff=lfs merge=lfs -text +tools/tbtools/v2.136/TBtools-II_macos_2_136.dmg filter=lfs diff=lfs merge=lfs -text +tools/tbtools/v2.136/TBtools-II_windows-x32_2_136.exe filter=lfs diff=lfs merge=lfs -text +tools/tbtools/v2.136/TBtools-II_windows-x64_2_136_latestJDK.exe filter=lfs diff=lfs merge=lfs -text +tools/tbtools/v2.136/TBtools-II_windows-x64_2_136.exe filter=lfs diff=lfs merge=lfs -text +tools/tbtools/v2.138/TBtools-II_macos_2_138.dmg filter=lfs diff=lfs merge=lfs -text +tools/tbtools/v2.138/TBtools-II_windows-x32_2_138.exe filter=lfs diff=lfs merge=lfs -text +tools/tbtools/v2.138/TBtools-II_windows-x64_2_138_latestJDK.exe filter=lfs diff=lfs merge=lfs -text +tools/tbtools/v2.138/TBtools-II_windows-x64_2_138.exe filter=lfs diff=lfs merge=lfs -text diff --git a/tools/cytoscape/cytoscape.zip b/tools/cytoscape/cytoscape.zip new file mode 100644 index 0000000000000000000000000000000000000000..186b05650fbf6e7d6710e5ec3bc0ec89f15ce707 --- /dev/null +++ b/tools/cytoscape/cytoscape.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:69b4ea888316d2b6e497419bd83cf4cfb8ed4144d6499715e0a854a80922d3be +size 772512 diff --git a/tools/cytoscape/v3.10.3/Cytoscape_3_10_3_macos_aarch64.dmg b/tools/cytoscape/v3.10.3/Cytoscape_3_10_3_macos_aarch64.dmg new file mode 100644 index 0000000000000000000000000000000000000000..d8a631688e2ec97073b3a0a22365880ed9c826f8 --- /dev/null +++ b/tools/cytoscape/v3.10.3/Cytoscape_3_10_3_macos_aarch64.dmg @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:246d0a9137b33f1381976a8b12caa3810d8593e3b86e7801a48836e2dafa64fd +size 231744856 diff --git a/tools/cytoscape/v3.10.3/Cytoscape_3_10_3_macos_x64.dmg b/tools/cytoscape/v3.10.3/Cytoscape_3_10_3_macos_x64.dmg new file mode 100644 index 0000000000000000000000000000000000000000..9009fae67269e775fca585cdb4a49792e8a6c426 --- /dev/null +++ b/tools/cytoscape/v3.10.3/Cytoscape_3_10_3_macos_x64.dmg @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:717c91fb1228571f8ed9b4d905aa63044bb866813a56d0cff3101455cd89cfde +size 234263892 diff --git a/tools/cytoscape/v3.10.3/Cytoscape_3_10_3_unix.sh b/tools/cytoscape/v3.10.3/Cytoscape_3_10_3_unix.sh new file mode 100644 index 0000000000000000000000000000000000000000..b2f445826e249879b05abeba8ec25ff5ea575e21 --- /dev/null +++ b/tools/cytoscape/v3.10.3/Cytoscape_3_10_3_unix.sh @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:99a2d2f9559222ff0ef2136365517da8202fa4a7a89ec0860f8caf1db0ed40f7 +size 239305068 diff --git a/tools/cytoscape/v3.10.3/Cytoscape_3_10_3_windows_64bit.exe b/tools/cytoscape/v3.10.3/Cytoscape_3_10_3_windows_64bit.exe new file mode 100644 index 0000000000000000000000000000000000000000..fafc672b93c614b78d45624240c0b03500284cc7 --- /dev/null +++ b/tools/cytoscape/v3.10.3/Cytoscape_3_10_3_windows_64bit.exe @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:ef53eb6ed290736663d0312c6d149a91155957f15b6a13eb66f4fff2f3d5bd9b +size 233120768 diff --git a/tools/cytoscape/v3.10.3/cytoscape-unix-3.10.3.tar.gz b/tools/cytoscape/v3.10.3/cytoscape-unix-3.10.3.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..6357b94d8c48363a027f7f87617ee9f62970c5d0 --- /dev/null +++ b/tools/cytoscape/v3.10.3/cytoscape-unix-3.10.3.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:eb68b717ab863680bccf9e625086100c08a659c42872c679d9449da6bb9944b4 +size 359982151 diff --git a/tools/cytoscape/v3.10.3/cytoscape-windows-3.10.3.zip b/tools/cytoscape/v3.10.3/cytoscape-windows-3.10.3.zip new file mode 100644 index 0000000000000000000000000000000000000000..6eeaa97f584553c1a2374c4df42ca98f6eee47a8 --- /dev/null +++ b/tools/cytoscape/v3.10.3/cytoscape-windows-3.10.3.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:4e8e30542312a58f9ebfd737c3fe1d904d5dd38fdebffd0d599ab59f9458f40e +size 361051377 diff --git a/tools/cytoscape/v3.11.0-nightly/Cytoscape_3_11_0-SNAPSHOT_macos_aarch64.dmg b/tools/cytoscape/v3.11.0-nightly/Cytoscape_3_11_0-SNAPSHOT_macos_aarch64.dmg new file mode 100644 index 0000000000000000000000000000000000000000..f9a2aa53a5315f33b47d112d14ec42e41a45c529 --- /dev/null +++ b/tools/cytoscape/v3.11.0-nightly/Cytoscape_3_11_0-SNAPSHOT_macos_aarch64.dmg @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:6e840432cacae41bf44a2935d805c30b9969b79fc08fce75b76c038078df1094 +size 258418017 diff --git a/tools/cytoscape/v3.11.0-nightly/Cytoscape_3_11_0-SNAPSHOT_macos_x64.dmg b/tools/cytoscape/v3.11.0-nightly/Cytoscape_3_11_0-SNAPSHOT_macos_x64.dmg new file mode 100644 index 0000000000000000000000000000000000000000..9995369246d776a2fc2db39a64877c8ee3c65bd6 --- /dev/null +++ b/tools/cytoscape/v3.11.0-nightly/Cytoscape_3_11_0-SNAPSHOT_macos_x64.dmg @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:5c0f6d1cb4d6245c18ccfe9caddef03c0645b06890578900224d45427546376d +size 261018973 diff --git a/tools/cytoscape/v3.11.0-nightly/Cytoscape_3_11_0-SNAPSHOT_unix.sh b/tools/cytoscape/v3.11.0-nightly/Cytoscape_3_11_0-SNAPSHOT_unix.sh new file mode 100644 index 0000000000000000000000000000000000000000..4f628c54a069500fb808bc86443c827a588b8344 --- /dev/null +++ b/tools/cytoscape/v3.11.0-nightly/Cytoscape_3_11_0-SNAPSHOT_unix.sh @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:b6361febe8d2d2dca6c4845731155b74fbb643844bfa84eed6b9c27b440657d7 +size 266312822 diff --git a/tools/cytoscape/v3.11.0-nightly/Cytoscape_3_11_0-SNAPSHOT_windows_64bit.exe b/tools/cytoscape/v3.11.0-nightly/Cytoscape_3_11_0-SNAPSHOT_windows_64bit.exe new file mode 100644 index 0000000000000000000000000000000000000000..d4586c1b4a64d3f5eec30cb840cb8fe209b6d940 --- /dev/null +++ b/tools/cytoscape/v3.11.0-nightly/Cytoscape_3_11_0-SNAPSHOT_windows_64bit.exe @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:f61127abb576b3c35671df5813394c84a40f2a062161283d4ab4a40ba48cf855 +size 259128832 diff --git a/tools/cytoscape/v3.11.0-nightly/cytoscape-unix-3.11.0-SNAPSHOT.tar.gz b/tools/cytoscape/v3.11.0-nightly/cytoscape-unix-3.11.0-SNAPSHOT.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..b70e2d00f0028ffd582ceabec07bfededc039841 --- /dev/null +++ b/tools/cytoscape/v3.11.0-nightly/cytoscape-unix-3.11.0-SNAPSHOT.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:34c2cd0db5df873af9321022eab6fc2696aaf14f96faf4d13679d6dcd1f4bd4d +size 390420033 diff --git a/tools/cytoscape/v3.11.0-nightly/cytoscape-windows-3.11.0-SNAPSHOT.zip b/tools/cytoscape/v3.11.0-nightly/cytoscape-windows-3.11.0-SNAPSHOT.zip new file mode 100644 index 0000000000000000000000000000000000000000..d0af27ce6c331d847b6942fa0b64f4d2f08185f6 --- /dev/null +++ b/tools/cytoscape/v3.11.0-nightly/cytoscape-windows-3.11.0-SNAPSHOT.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:edb93145808edeeacb2184b69a6fabb82a51b1fa733eda62648689482ec59218 +size 391528541 diff --git a/tools/cytoscape/v3.11.0-nightly/output.txt b/tools/cytoscape/v3.11.0-nightly/output.txt new file mode 100644 index 0000000000000000000000000000000000000000..b7358491c6562c9cd1d26f43b90ede701658d68e --- /dev/null +++ b/tools/cytoscape/v3.11.0-nightly/output.txt @@ -0,0 +1,6 @@ +# List of generated media files. The columns are tab-separated: +# id | media file type | display name | media file path +12 unix unix /home/cybuilder/builds/cytoscape/cytoscape/gui-distribution/packaging/target/media/Cytoscape_3_11_0-SNAPSHOT_unix.sh +11 windows windows /home/cybuilder/builds/cytoscape/cytoscape/gui-distribution/packaging/target/media/Cytoscape_3_11_0-SNAPSHOT_windows_64bit.exe +9 macos macos x64 /home/cybuilder/builds/cytoscape/cytoscape/gui-distribution/packaging/target/media/Cytoscape_3_11_0-SNAPSHOT_macos_x64.dmg +637 macos macos aarch64 /home/cybuilder/builds/cytoscape/cytoscape/gui-distribution/packaging/target/media/Cytoscape_3_11_0-SNAPSHOT_macos_aarch64.dmg diff --git a/tools/cytoscape/v3.11.0-nightly/updates.xml b/tools/cytoscape/v3.11.0-nightly/updates.xml new file mode 100644 index 0000000000000000000000000000000000000000..2a9ae7991855e0b6f66f0e51b436e2df466bbee3 --- /dev/null +++ b/tools/cytoscape/v3.11.0-nightly/updates.xml @@ -0,0 +1,15 @@ + + + + + + + + + + + + + + + diff --git a/tools/deeptfactor.zip b/tools/deeptfactor.zip new file mode 100644 index 0000000000000000000000000000000000000000..7da84ae8f01b03651546ad97369e7bdc59ab0156 --- /dev/null +++ b/tools/deeptfactor.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:4029ea39f89b102c4c5c138343668b820a12e3323ac7d0f90fcb6bbc6cba5187 +size 34732328 diff --git a/tools/gcmodeller/Description.txt b/tools/gcmodeller/Description.txt new file mode 100644 index 0000000000000000000000000000000000000000..09e47c93fcea52bc521aa1cea76518ad1774be0e --- /dev/null +++ b/tools/gcmodeller/Description.txt @@ -0,0 +1,3 @@ +GCModeller: genomics CAD (Computer Assistant Design) Modeller system in .NET language. + +https://gcmodeller.org \ No newline at end of file diff --git a/tools/gcmodeller/R#/COVID-19.zip b/tools/gcmodeller/R#/COVID-19.zip new file mode 100644 index 0000000000000000000000000000000000000000..7f69e1d0782c431d93d56cab399715272ae12def --- /dev/null +++ b/tools/gcmodeller/R#/COVID-19.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:374f55c9f24f8679ba118af10bae3c6903c1ecdf65dfb6ccde6acefa951e5860 +size 22185531 diff --git a/tools/gcmodeller/R#/Description.txt b/tools/gcmodeller/R#/Description.txt new file mode 100644 index 0000000000000000000000000000000000000000..59364ac2bf315c430f7ba5695cc0e85211169671 --- /dev/null +++ b/tools/gcmodeller/R#/Description.txt @@ -0,0 +1,3 @@ +R# language is a kind of R liked vectorized language implements on .NET environment for the bioinformatics data analysis. + +https://rsharp.net \ No newline at end of file diff --git a/tools/gcmodeller/R#/IronR.zip b/tools/gcmodeller/R#/IronR.zip new file mode 100644 index 0000000000000000000000000000000000000000..916a61dc33bddb4483aba45bd20acbefc5b9fa7e --- /dev/null +++ b/tools/gcmodeller/R#/IronR.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:f969b563a378123d9e7bdb45814e8b4ede07bb6e8f6c39683e99c1027b3ee8e1 +size 127662 diff --git a/tools/gcmodeller/R#/Julia.zip b/tools/gcmodeller/R#/Julia.zip new file mode 100644 index 0000000000000000000000000000000000000000..4d68f43b26209f7b9d2cb814215aece90384a3f8 --- /dev/null +++ b/tools/gcmodeller/R#/Julia.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:fd922aa7645776498397b9c6f3a1d35b9b0292ca6b1edfbacdb08388fcf6aa8f +size 289145 diff --git a/tools/gcmodeller/R#/R-sharp.zip b/tools/gcmodeller/R#/R-sharp.zip new file mode 100644 index 0000000000000000000000000000000000000000..c100c0d2b173572ddd45d3c2a80a857f0af0b109 --- /dev/null +++ b/tools/gcmodeller/R#/R-sharp.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:383655cfbdd484b1fa8ae6359616106873d999135854ee400b00e3378edf920a +size 498087758 diff --git a/tools/gcmodeller/R#/Rdocumentation.zip b/tools/gcmodeller/R#/Rdocumentation.zip new file mode 100644 index 0000000000000000000000000000000000000000..02d5dede4fcdc10d9c60e8b9829d6aa57ff24b36 --- /dev/null +++ b/tools/gcmodeller/R#/Rdocumentation.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:717258b05cb15986bef73e1b06b0f3869a22ab89e8e7725351b2dde6283cfac2 +size 617065891 diff --git a/tools/gcmodeller/R#/Rserver.zip b/tools/gcmodeller/R#/Rserver.zip new file mode 100644 index 0000000000000000000000000000000000000000..4bc9953da33e2375a05b0f37e5d753134d03af45 --- /dev/null +++ b/tools/gcmodeller/R#/Rserver.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:bc50d22a47d0315a9568e3685a6078598906b4250277331e233fc9d7bd4eed26 +size 501248 diff --git a/tools/gcmodeller/R#/SMV.zip b/tools/gcmodeller/R#/SMV.zip new file mode 100644 index 0000000000000000000000000000000000000000..62cb4eccbf4b8131ef13527045a6599c8dd1034b --- /dev/null +++ b/tools/gcmodeller/R#/SMV.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:56098454bfca9410b9bf6fb7e3f19df311eadbf323c82d5a949f51312db7be65 +size 24444932 diff --git a/tools/gcmodeller/R#/WorkflowRender.zip b/tools/gcmodeller/R#/WorkflowRender.zip new file mode 100644 index 0000000000000000000000000000000000000000..57d7d466c2a189c94764e4133b1d336e290d5a0c --- /dev/null +++ b/tools/gcmodeller/R#/WorkflowRender.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:4c2eb71e247490c3c248af1af2e8d4657afb988e7d59f35543b13236f17e4d3b +size 406815 diff --git a/tools/gcmodeller/R#/bing-academic.zip b/tools/gcmodeller/R#/bing-academic.zip new file mode 100644 index 0000000000000000000000000000000000000000..846cc91ce6f52788a87c33d8e7fd1de89b913f78 --- /dev/null +++ b/tools/gcmodeller/R#/bing-academic.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:58eb3e434068d11fc4ca5f69c1c005092c9b8abee2bf9a433c80741e67002aeb +size 76999249 diff --git a/tools/gcmodeller/R#/cell-render.zip b/tools/gcmodeller/R#/cell-render.zip new file mode 100644 index 0000000000000000000000000000000000000000..ef0c1ed37d4346caf1634be8ce90e3723ffb2b31 --- /dev/null +++ b/tools/gcmodeller/R#/cell-render.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:c23334251a369bebf3676a9061ef204fc5e3f39078d1eac622d6a0b8807b1052 +size 154380380 diff --git a/tools/gcmodeller/R#/enigma.zip b/tools/gcmodeller/R#/enigma.zip new file mode 100644 index 0000000000000000000000000000000000000000..11a56d6aa3b72f860006abf44e8ff0e272bfe4e7 --- /dev/null +++ b/tools/gcmodeller/R#/enigma.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:bca19ccffae82a839da23db9a4a3dab5e2ed84af11602cc20d49fa48f5504436 +size 57834111 diff --git a/tools/gcmodeller/R#/ggplot.zip b/tools/gcmodeller/R#/ggplot.zip new file mode 100644 index 0000000000000000000000000000000000000000..91a3361d9106a6b347d888d90f77a0bca9698fc7 --- /dev/null +++ b/tools/gcmodeller/R#/ggplot.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:d9ab251a5faa807714fe293e5fcffaf667bbd186d8fdf1c42465d33159d2bf63 +size 63564360 diff --git a/tools/gcmodeller/R#/languageserver.zip b/tools/gcmodeller/R#/languageserver.zip new file mode 100644 index 0000000000000000000000000000000000000000..9e688e563414df8bfc11c75ca18cb2cc14cf61e8 --- /dev/null +++ b/tools/gcmodeller/R#/languageserver.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:6c59c68aab8fc2bbcd23c9851f4ea131b263daaf316b45de5ff20c1998ff1fd1 +size 1166834 diff --git a/tools/gcmodeller/R#/mini-R.zip b/tools/gcmodeller/R#/mini-R.zip new file mode 100644 index 0000000000000000000000000000000000000000..92e9713c9d7b2fa8b14ec688e535912ce7c8f569 --- /dev/null +++ b/tools/gcmodeller/R#/mini-R.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:1c979ebabd6d188d0dddfbfc7c99ab42e8f4fe4abb26e7905991ce54d670685d +size 39011767 diff --git a/tools/gcmodeller/R#/node-rdata.zip b/tools/gcmodeller/R#/node-rdata.zip new file mode 100644 index 0000000000000000000000000000000000000000..b60933b457bba911c7b96fd6531f6c727d9732d8 --- /dev/null +++ b/tools/gcmodeller/R#/node-rdata.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:404199e0d2902de756d416a812aefcdeabcbf5a807f573d6ef645d1c1c92baad +size 69246 diff --git a/tools/gcmodeller/R#/r-registry.zip b/tools/gcmodeller/R#/r-registry.zip new file mode 100644 index 0000000000000000000000000000000000000000..9276f0a321b99a18c74dc91aca9bba7785419ffb --- /dev/null +++ b/tools/gcmodeller/R#/r-registry.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:2ddc09742162f74ed0a1d8b8245c1a9ed601cb20db16afbec5fcb71146a2d92c +size 118973 diff --git a/tools/gcmodeller/R#/rdata-ts.zip b/tools/gcmodeller/R#/rdata-ts.zip new file mode 100644 index 0000000000000000000000000000000000000000..3bc1e3dfb8acc8433c2a5fb97b09b769d2fe6f60 --- /dev/null +++ b/tools/gcmodeller/R#/rdata-ts.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:8216965cd5c2cd88b20e20234b9f226c2615e114662737bd63051c310eac6893 +size 110325 diff --git a/tools/gcmodeller/R#/rsharp.net-home-page.zip b/tools/gcmodeller/R#/rsharp.net-home-page.zip new file mode 100644 index 0000000000000000000000000000000000000000..f499f96a97abfa2d349a46b9d40998ff88c517ca --- /dev/null +++ b/tools/gcmodeller/R#/rsharp.net-home-page.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:f23321ab4e3dc9a545a1086632c05d4cccedb7cc80c2557a33869fc176c2b272 +size 12869310 diff --git a/tools/gcmodeller/R#/vector.js.zip b/tools/gcmodeller/R#/vector.js.zip new file mode 100644 index 0000000000000000000000000000000000000000..f212251bc65bf9ab2a901d8b894181cf366ca9e9 --- /dev/null +++ b/tools/gcmodeller/R#/vector.js.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:b76fdca0c12ebcc7edd207f64b2e15d8a72d32412eee059b03c9c002eacb49d1 +size 167465 diff --git a/tools/gcmodeller/Sources/DICOM.R.zip b/tools/gcmodeller/Sources/DICOM.R.zip new file mode 100644 index 0000000000000000000000000000000000000000..8fa1d550d6123931b5e9956e63d21c860784bb87 --- /dev/null +++ b/tools/gcmodeller/Sources/DICOM.R.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:cd48bed018464513087b1810fa1256b01256fb23d98e06e8710c063568a6e2b3 +size 51835263 diff --git a/tools/gcmodeller/Sources/GCModeller-Cloud.zip b/tools/gcmodeller/Sources/GCModeller-Cloud.zip new file mode 100644 index 0000000000000000000000000000000000000000..2f9f6e7a3250ef6f91dac4a4f0b1d5ee9bfb3697 --- /dev/null +++ b/tools/gcmodeller/Sources/GCModeller-Cloud.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:7f55a942ba3e6d0883f6e2c6698b810ac52a8ddcb92c49ff9db10fa6be60f8a6 +size 705213537 diff --git a/tools/gcmodeller/Sources/GCModeller-stable-6.0.zip b/tools/gcmodeller/Sources/GCModeller-stable-6.0.zip new file mode 100644 index 0000000000000000000000000000000000000000..ffda01b8d074c4591dcc99d743e16cce047934cf --- /dev/null +++ b/tools/gcmodeller/Sources/GCModeller-stable-6.0.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:2d2666ee6a0bd27fba66717b0c058dfdcc6073279bce2a9d311c4e57d031a5c5 +size 458399080 diff --git a/tools/gcmodeller/Sources/GCModeller-workbench.zip b/tools/gcmodeller/Sources/GCModeller-workbench.zip new file mode 100644 index 0000000000000000000000000000000000000000..0b5c6877d0d19f97099effd74e900c09a75a7629 --- /dev/null +++ b/tools/gcmodeller/Sources/GCModeller-workbench.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:c39ae10b49e30c4859b76107c636b77e7df1c88c160dfa8c85409a755576213a +size 193992499 diff --git a/tools/gcmodeller/Sources/GCModeller.Circos.zip b/tools/gcmodeller/Sources/GCModeller.Circos.zip new file mode 100644 index 0000000000000000000000000000000000000000..24f74a7a96794fd3974ac7544995a07055dc2aa8 --- /dev/null +++ b/tools/gcmodeller/Sources/GCModeller.Circos.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:bfc3054ef30bfb88581b34e133c55665cf36a6fcce3754c765edbcab3394b4ee +size 4237173 diff --git a/tools/gcmodeller/Sources/GCModeller.Core [xieguigang] +12.zip b/tools/gcmodeller/Sources/GCModeller.Core [xieguigang] +12.zip new file mode 100644 index 0000000000000000000000000000000000000000..2d8b4bdde6da3a0cbcad1b596acb3a19c4b2a271 --- /dev/null +++ b/tools/gcmodeller/Sources/GCModeller.Core [xieguigang] +12.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:fca26b5a31da09dd49b92ee0c18c8a3f059ebe5fbced02e4e0e13955d3017134 +size 46244793 diff --git a/tools/gcmodeller/Sources/GCModeller.Core.zip b/tools/gcmodeller/Sources/GCModeller.Core.zip new file mode 100644 index 0000000000000000000000000000000000000000..cb24dc637cabe77a36554df16a88757b8ab5fb3a --- /dev/null +++ b/tools/gcmodeller/Sources/GCModeller.Core.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:9108aaa3199fe5269879df756ced2b71d8ab2570b021d792535d4549e48c71ce +size 46194478 diff --git a/tools/gcmodeller/Sources/GCModeller.Cytoscape.zip b/tools/gcmodeller/Sources/GCModeller.Cytoscape.zip new file mode 100644 index 0000000000000000000000000000000000000000..2f7976d14f4e10b13b6d596fdbc279ad69a2210f --- /dev/null +++ b/tools/gcmodeller/Sources/GCModeller.Cytoscape.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:30d27bc09c433685810cfa4aa5aaeb448a5739d4cddf1ef399550914ceab1286 +size 2786558 diff --git a/tools/gcmodeller/Sources/GCModeller.zip b/tools/gcmodeller/Sources/GCModeller.zip new file mode 100644 index 0000000000000000000000000000000000000000..af429da7841adc3ccdbbdff82c58830cce853c67 --- /dev/null +++ b/tools/gcmodeller/Sources/GCModeller.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:58d8835944577b9d7cf63632ccb8d3df9e2df225e1db88be8a61bb6983aac9ea +size 2292485363 diff --git a/tools/gcmodeller/Sources/GO_gene-ontology.zip b/tools/gcmodeller/Sources/GO_gene-ontology.zip new file mode 100644 index 0000000000000000000000000000000000000000..c9d0869c70fa40079082f9421578f5cda43e3f05 --- /dev/null +++ b/tools/gcmodeller/Sources/GO_gene-ontology.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:324da74e2c492ab9cbddccfe430cec05c19a5c9fa60e1ccb276dcbbe9daf1626 +size 2970153 diff --git a/tools/gcmodeller/Sources/SBML.zip b/tools/gcmodeller/Sources/SBML.zip new file mode 100644 index 0000000000000000000000000000000000000000..e2b9d0577e7abfe5e9fed37d2145d059fd1627b5 --- /dev/null +++ b/tools/gcmodeller/Sources/SBML.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:ad481c339946e4e0329e349148cb3b61d15b31a8fa91a6e93eb2056068d744d6 +size 817605 diff --git a/tools/gcmodeller/Sources/Xanthomonas_campestris_8004_uid15.zip b/tools/gcmodeller/Sources/Xanthomonas_campestris_8004_uid15.zip new file mode 100644 index 0000000000000000000000000000000000000000..179709a810de87d622dd8f901828c30562274925 --- /dev/null +++ b/tools/gcmodeller/Sources/Xanthomonas_campestris_8004_uid15.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:3741973aaefa5f12d223e954b7e31880e0156535ca2ffed810e02ab88a4af035 +size 226654006 diff --git a/tools/gcmodeller/Sources/bioCAD.zip b/tools/gcmodeller/Sources/bioCAD.zip new file mode 100644 index 0000000000000000000000000000000000000000..4780d855d4c99755c745db1e21ac1fbe033ec161 --- /dev/null +++ b/tools/gcmodeller/Sources/bioCAD.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:629498d27dedd8d436487e989a277853f771d596e6c45262c41deeff4f428dd8 +size 28536840 diff --git a/tools/gcmodeller/Sources/biocad_registry.zip b/tools/gcmodeller/Sources/biocad_registry.zip new file mode 100644 index 0000000000000000000000000000000000000000..dabd41c019f4cf2dacd015fc97582670f5245963 --- /dev/null +++ b/tools/gcmodeller/Sources/biocad_registry.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:61605dd58abd721960768a3890a4139649af7a55d6588f60c1fb07fb275f06cc +size 56720782 diff --git a/tools/gcmodeller/Sources/docs.gcmodeller.org.zip b/tools/gcmodeller/Sources/docs.gcmodeller.org.zip new file mode 100644 index 0000000000000000000000000000000000000000..2e440c6f648234360a6954f3ff32625ffc65868f --- /dev/null +++ b/tools/gcmodeller/Sources/docs.gcmodeller.org.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:b988a6a3d556bd161f0ac678f38952b2658f25251c5775ba5c45c40821b2723e +size 13032410 diff --git a/tools/gcmodeller/Sources/gcmodeller-developer.zip b/tools/gcmodeller/Sources/gcmodeller-developer.zip new file mode 100644 index 0000000000000000000000000000000000000000..298b7b2520f87801aa529ac0d9db9e243bf6f6ae --- /dev/null +++ b/tools/gcmodeller/Sources/gcmodeller-developer.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:772c08d3c459efb791405a2710389f739d136bdf3cf11c84902ab5af690fa8b0 +size 89245012 diff --git a/tools/gcmodeller/Sources/genome-synteny.zip b/tools/gcmodeller/Sources/genome-synteny.zip new file mode 100644 index 0000000000000000000000000000000000000000..54bb9eef3a46bb4bc5575693fd27fa0df192d823 --- /dev/null +++ b/tools/gcmodeller/Sources/genome-synteny.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:da11500e96bc7004bea19945861aa258e781f7399d00a49ee40a6f871cd3e337 +size 2863916 diff --git a/tools/gcmodeller/Sources/ncbi-localblast.zip b/tools/gcmodeller/Sources/ncbi-localblast.zip new file mode 100644 index 0000000000000000000000000000000000000000..8bd03ee750e3bdb9a146a1c586898fdc60f4d100 --- /dev/null +++ b/tools/gcmodeller/Sources/ncbi-localblast.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:68d326b6431aff7205143796f959b5fd35d6572cfd9c781b1dd9a53e13349350 +size 4727550 diff --git a/tools/gcmodeller/Sources/novogene.metagenome.zip b/tools/gcmodeller/Sources/novogene.metagenome.zip new file mode 100644 index 0000000000000000000000000000000000000000..039b782d90d203296c33476c3e20da2e966ae8e4 --- /dev/null +++ b/tools/gcmodeller/Sources/novogene.metagenome.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:fb27430fa52cf7f11a9e1562c8b6431cb736f2bb657f25860d09b56078f9d0e5 +size 71969 diff --git a/tools/gcmodeller/Sources/vcellkit.zip b/tools/gcmodeller/Sources/vcellkit.zip new file mode 100644 index 0000000000000000000000000000000000000000..6f169814b64689433b5a16b2d78e51f7dc21421d --- /dev/null +++ b/tools/gcmodeller/Sources/vcellkit.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:d10d50287ba04cac93eae5ef3b4aec1b0d496a64b08bc4a1b58bf4efd8695f48 +size 14935565 diff --git a/tools/gcmodeller/gcmodeller-workbench-main.png b/tools/gcmodeller/gcmodeller-workbench-main.png new file mode 100644 index 0000000000000000000000000000000000000000..ee96c0a6d6d71ce587643e24e74d88537cfa9088 --- /dev/null +++ b/tools/gcmodeller/gcmodeller-workbench-main.png @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:3f76aa58b94357f4bd1640698f28e7eb4f85995a013549d94bc6cb54fb3c2775 +size 158673 diff --git a/tools/gcmodeller/gcmodeller-workbench-screen1.png b/tools/gcmodeller/gcmodeller-workbench-screen1.png new file mode 100644 index 0000000000000000000000000000000000000000..1cf3ada2a683c3afd8710c513a3455aecea7af44 --- /dev/null +++ b/tools/gcmodeller/gcmodeller-workbench-screen1.png @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:9c197b47d59480959981012cc5ef0e8fbd0011c6f519c15a634d775e414f9742 +size 160436 diff --git a/tools/gcmodeller/v0.0.1-alpha/GCModeller-0.0.1-alpha.zip b/tools/gcmodeller/v0.0.1-alpha/GCModeller-0.0.1-alpha.zip new file mode 100644 index 0000000000000000000000000000000000000000..c047f223cef14ea0f6a8c9756138285a1d96b64b --- /dev/null +++ b/tools/gcmodeller/v0.0.1-alpha/GCModeller-0.0.1-alpha.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:bab8a9d06507b61a90593b6701159f1e60eba65cac8a1b1173077c29afa99c8e +size 182603707 diff --git a/tools/gcmodeller/v0.0.1-alpha/GCModeller.z01 b/tools/gcmodeller/v0.0.1-alpha/GCModeller.z01 new file mode 100644 index 0000000000000000000000000000000000000000..6f3551757604900b310d4205be4aac644eceaed8 --- /dev/null +++ b/tools/gcmodeller/v0.0.1-alpha/GCModeller.z01 @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:4611e61bf4e1b08a909cbf06c224096054f0b01fc08444178c347dcddad4391b +size 10485760 diff --git a/tools/gcmodeller/v0.0.1-alpha/GCModeller.z02 b/tools/gcmodeller/v0.0.1-alpha/GCModeller.z02 new file mode 100644 index 0000000000000000000000000000000000000000..e895108a8a65b939b311eec1da0987db2f05970b --- /dev/null +++ b/tools/gcmodeller/v0.0.1-alpha/GCModeller.z02 @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:72ad5d7b359cf166c1bf13ef7825b9a3330f5aba5176e403d7c9bbd73b98501d +size 10485760 diff --git a/tools/gcmodeller/v0.0.1-alpha/GCModeller.z03 b/tools/gcmodeller/v0.0.1-alpha/GCModeller.z03 new file mode 100644 index 0000000000000000000000000000000000000000..20f29c31e2f76fbbd5460d7f337aaabfbad08309 --- /dev/null +++ b/tools/gcmodeller/v0.0.1-alpha/GCModeller.z03 @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:abcd63320f8acf63579b0f2eef151f4c25c6cb4a4a7518958e864f020bc2b5f5 +size 10485760 diff --git a/tools/gcmodeller/v0.0.1-alpha/GCModeller.z04 b/tools/gcmodeller/v0.0.1-alpha/GCModeller.z04 new file mode 100644 index 0000000000000000000000000000000000000000..6fa1e636cd661053be39926996d5ce5081eefaf6 --- /dev/null +++ b/tools/gcmodeller/v0.0.1-alpha/GCModeller.z04 @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:4bb41f55eaa3ff914f5f8330f9cad5db775b2c5ec369568bfe18d1db4ac6e01d +size 10485760 diff --git a/tools/gcmodeller/v0.0.1-alpha/GCModeller.zip b/tools/gcmodeller/v0.0.1-alpha/GCModeller.zip new file mode 100644 index 0000000000000000000000000000000000000000..ee25123aedc80826246b4c621a57053695be7688 --- /dev/null +++ b/tools/gcmodeller/v0.0.1-alpha/GCModeller.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:a3d126ff451c90970ed0f8d4ecced704d5a06284071294030b6fa1c14a97d21f +size 2297031 diff --git a/tools/gcmodeller/v0.0.5-alpha-2/GCModeller-0.0.5-alpha-2.zip b/tools/gcmodeller/v0.0.5-alpha-2/GCModeller-0.0.5-alpha-2.zip new file mode 100644 index 0000000000000000000000000000000000000000..3b83e1f743060b1dc25f4c5984e0cbafc6cebde8 --- /dev/null +++ b/tools/gcmodeller/v0.0.5-alpha-2/GCModeller-0.0.5-alpha-2.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:5da1a197fbdbb35842424b510b9effb548b3c36dee099d9df4eedd6237d6ff4f +size 219706596 diff --git a/tools/gcmodeller/v0.0.5-alpha-2/GCModeller.zip b/tools/gcmodeller/v0.0.5-alpha-2/GCModeller.zip new file mode 100644 index 0000000000000000000000000000000000000000..aa7104065ba58a9ddede09c9ed520b4714b2b3d6 --- /dev/null +++ b/tools/gcmodeller/v0.0.5-alpha-2/GCModeller.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:f82962ded3c721217e4ff656e777869c801cf3a8c0cf692ad9179a6621ae0722 +size 39062307 diff --git a/tools/keggmapper/kozo2_keggmapper/Description.txt b/tools/keggmapper/kozo2_keggmapper/Description.txt new file mode 100644 index 0000000000000000000000000000000000000000..45552d6376388f9c9726971c72635a7d72d11bc1 --- /dev/null +++ b/tools/keggmapper/kozo2_keggmapper/Description.txt @@ -0,0 +1 @@ +A R package to do the same thing as KEGG Mapper. \ No newline at end of file diff --git a/tools/keggmapper/kozo2_keggmapper/Installation & Examples.docx b/tools/keggmapper/kozo2_keggmapper/Installation & Examples.docx new file mode 100644 index 0000000000000000000000000000000000000000..a456b611bb248ff25aac27108f192bde34d92917 Binary files /dev/null and b/tools/keggmapper/kozo2_keggmapper/Installation & Examples.docx differ diff --git a/tools/keggmapper/kozo2_keggmapper/biocLite.R b/tools/keggmapper/kozo2_keggmapper/biocLite.R new file mode 100644 index 0000000000000000000000000000000000000000..495bc75ee9ecc25ddfb5cfbc7eb810f15008de4b --- /dev/null +++ b/tools/keggmapper/kozo2_keggmapper/biocLite.R @@ -0,0 +1,174 @@ +## Mirrors: uncomment the following and change to your favorite CRAN mirror +## if you don't want to use the default (cran.rstudio.com). +## options("repos" = c(CRAN="https://cran.rstudio.com")) + +## Mirrors: uncomment the following and change to your favorite Bioconductor +## mirror, if you don't want to use the default (bioconductor.org) +## options("BioC_mirror" = "https://bioconductor.org") + +local({ + + vers <- getRversion() + if (vers >= "3.6"){ + stop( + "With R version 3.5 or greater, install Bioconductor ", + "packages using BiocManager; see https://bioconductor.org/install", + call. = FALSE + ) + } + biocVers <- tryCatch({ + BiocInstaller::biocVersion() # recent BiocInstaller + }, error=function(...) { # no / older BiocInstaller + BioC_version_associated_with_R_version <- + get(".BioC_version_associated_with_R_version", + envir=asNamespace("tools"), inherits=FALSE) + if (is.function(BioC_version_associated_with_R_version)) + BioC_version_associated_with_R_version() + else # numeric_version + BioC_version_associated_with_R_version + }) + + if (vers < "3.0") { + ## legacy; no need to change "3.0" ever + ## coordinate this message with .onAttach + txt <- strwrap("A new version of Bioconductor is available + after installing the most recent version of R; see + http://bioconductor.org/install", exdent=2) + message(paste(txt, collapse="\n")) + } else if ("package:BiocInstaller" %in% search()) { + ## messages even if already attached + tryCatch(BiocInstaller:::.onAttach(), error=function(...) NULL) + } + + if (vers > "2.13" && biocVers > "2.8") { + + if (exists("biocLite", .GlobalEnv, inherits=FALSE)) { + txt <- strwrap("There is an outdated biocLite() function in the + global environment; run 'rm(biocLite)' and try again.") + stop("\n", paste(txt, collapse="\n")) + } + + if (!suppressWarnings(require("BiocInstaller", quietly=TRUE))) { + a <- NULL + p <- file.path(Sys.getenv("HOME"), ".R", "repositories") + if (file.exists(p)) { + a <- tools:::.read_repositories(p) + if (!"BioCsoft" %in% rownames(a)) + a <- NULL + } + if (is.null(a)) { + p <- file.path(R.home("etc"), "repositories") + a <- tools:::.read_repositories(p) + } + if (!"package:utils" %in% search()) { + path <- "//bioconductor.org/biocLite.R" + txt <- sprintf("use 'source(\"https:%s\")' or + 'source(\"http:%s\")' to update 'BiocInstaller' after + library(\"utils\")", path, path) + message(paste(strwrap(txt), collapse="\n ")) + } else { + if (vers >= "3.2.2" && vers < "3.3.0") { + ## transitioning to https support; check availability + con <- file(fl <- tempfile(), "w") + sink(con, type="message") + tryCatch({ + xx <- close(file("https://bioconductor.org")) + }, error=function(e) { + message(conditionMessage(e)) + }) + sink(type="message") + close(con) + if (!length(readLines(fl))) + a["BioCsoft", "URL"] <- + sub("^http:", "https:", a["BioCsoft", "URL"]) + } + ## add a conditional for Bioc releases occuring WITHIN + ## a single R minor version. This is so that a user with a + ## version of R (whose etc/repositories file references the + ## no-longer-latest URL) and without BiocInstaller + ## will be pointed to the most recent repository suitable + ## for their version of R + if (vers >= "3.5.0") { + a["BioCsoft", "URL"] <- sub(as.character(biocVers), "3.7", + a["BioCsoft", "URL"]) + } else if (vers >= "3.4.0") { + a["BioCsoft", "URL"] <- sub(as.character(biocVers), "3.6", + a["BioCsoft", "URL"]) + } else if (vers >= "3.3.0") { + a["BioCsoft", "URL"] <- sub(as.character(biocVers), "3.4", + a["BioCsoft", "URL"]) + } else if (vers >= "3.2") { + a["BioCsoft", "URL"] <- sub(as.character(biocVers), "3.2", + a["BioCsoft", "URL"]) + } else if (vers == "3.1.1") { + ## R-3.1.1's etc/repositories file at the time of the release + ## of Bioc 3.0 pointed to the 2.14 repository, but we want + ## new installations to access the 3.0 repository + a["BioCsoft", "URL"] <- sub(as.character(biocVers), "3.0", + a["BioCsoft", "URL"]) + } else if (vers == "3.1.0") { + ## R-devel points to 2.14 repository + a["BioCsoft", "URL"] <- sub(as.character(biocVers), "2.14", + a["BioCsoft", "URL"]) + } else if (vers >= "2.15" && vers < "2.16") { + a["BioCsoft", "URL"] <- sub(as.character(biocVers), "2.11", + a["BioCsoft", "URL"]) + biocVers <- numeric_version("2.11") + } + install.packages("BiocInstaller", repos=a["BioCsoft", "URL"]) + if (!suppressWarnings(require("BiocInstaller", + quietly=TRUE))) { + path0 <- "//bioconductor.org/packages" + path <- sprintf("%s/%s/bioc", path0, as.character(biocVers)) + txt0 <- "'biocLite.R' failed to install 'BiocInstaller', + use 'install.packages(\"BiocInstaller\", + repos=\"https:%s\")' or + 'install.packages(\"BiocInstaller\", repos=\"http:%s\")'" + txt <- sprintf(txt0, path, path) + message(paste(strwrap(txt), collapse="\n ")) + } + } + } else { + ## BiocInstaller version 1.16.0-1.18.1 do not + ## automatically update when type=="source"; notify users + ## when they have updated R over their old libraries + installerVersion <- utils::packageVersion("BiocInstaller") + test0 <- (vers > "3.1.2") && + !identical(getOption("pkgType"), "source") && + (installerVersion >= "1.16.0") && + (installerVersion <= "1.16.4") + if (test0) { + if (installerVersion < "1.16.4") { + txt <- "Update BiocInstaller with + oldPkgType=options(pkgType=\"source\"); + biocLite(\"BiocInstaller\"); options(oldPkgType)" + message(paste(strwrap(txt, exdent=2), collapse="\n")) + } + if (vers >= "3.2") { + path <- "//bioconductor.org/biocLite.R" + txt <- sprintf("BiocInstaller version %s is too old for + R version %s; remove.packages(\"BiocInstaller\"), + re-start R, then source(\"https:%s\") or + source(\"http:%s\")", biocVers, vers, path, path) + warning(paste(strwrap(txt, exdent=2), collapse="\n")) + } + } + } + } else { + tryCatch({ + source("https://bioconductor.org/getBioC.R") + }, error=function(e) { + warning("https: failed (", conditionMessage(e), "), trying http", + immediate.=TRUE) + source("http://bioconductor.org/getBioC.R") + }) + biocLite <<- + function(pkgs, groupName="lite", ...) + { + if (missing(pkgs)) + biocinstall(groupName=groupName, ...) + else + biocinstall(pkgs=pkgs, groupName=groupName, ...) + } + } +}) \ No newline at end of file diff --git a/tools/meme-suite/gendb.4.3.0.patch b/tools/meme-suite/gendb.4.3.0.patch new file mode 100644 index 0000000000000000000000000000000000000000..7971522cedfcee530240ed8b10dddcb85fe26b52 --- /dev/null +++ b/tools/meme-suite/gendb.4.3.0.patch @@ -0,0 +1,50 @@ +--- gendb.c.old 2009-11-14 16:03:21.000000000 -0800 ++++ gendb.c 2009-11-14 16:01:43.000000000 -0800 +@@ -7,10 +7,13 @@ + * DESCRIPTION: Generate sequences using a Markov model. + **************************************************************************/ + ++#ifndef MAIN + #define DEFINE_GLOBALS ++#endif + #include "macros.h" + #include "fcodon.h" + #include "background.h" ++#include "gendb.h" + #include "hash_alph.h" + #include "seq.h" + +@@ -19,6 +22,7 @@ + #define SEQS 10 /* number of sequences */ + #define MAX_ORDER 10 // largest Markov model order + ++#ifndef MAIN + /**************************************************************************/ + /* + get_letters +@@ -301,7 +305,7 @@ + Generate a file of synthetic sequences. + */ + /**************************************************************************/ +-extern SEQ_T *gendb( ++SEQ_T *gendb( + FILE *out, // Output stream; return output if null. + int type, // Type of alphabet. + // 0: protein w/ambigs +@@ -336,6 +340,7 @@ + // Print the random sequences. + return (print_random_seqs(out, seed, nseqs, min, max, letters, r, c, order, cum)); + } // gendb ++#endif + + + #ifdef MAIN +@@ -416,7 +421,7 @@ + } + } + if (option_index + 1 != argc) { +- fprintf(stderr, usage); ++ fprintf(stderr, "%s", usage); + exit(EXIT_FAILURE); + } + int nseqs = atoi(argv[option_index]); diff --git a/tools/meme-suite/gomo_databases.3.2.tgz b/tools/meme-suite/gomo_databases.3.2.tgz new file mode 100644 index 0000000000000000000000000000000000000000..9d97fcd317c1d02d76acca5e03c7f0c22c665773 --- /dev/null +++ b/tools/meme-suite/gomo_databases.3.2.tgz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:41fff46f710a1a8853df8b5ee5f9ceefb62a32b1f63b5fce5c1be2c956352255 +size 110141569 diff --git a/tools/meme-suite/mast-client.txt.3.5.0 b/tools/meme-suite/mast-client.txt.3.5.0 new file mode 100644 index 0000000000000000000000000000000000000000..17d8679b5094bd869f9e6697c377d714c983c0b5 --- /dev/null +++ b/tools/meme-suite/mast-client.txt.3.5.0 @@ -0,0 +1,164 @@ +#!/bin/csh +# +# $Id: mast-client.txt,v 1.5 2006/01/03 06:37:00 tbailey Exp $ +# $Log: mast-client.txt,v $ +# Revision 1.5 2006/01/03 06:37:00 tbailey +# Fix "MEME_BINbin" bug in mast-client.txt. +# Fix indentation in meme-server.c and meme-client.c. +# +# Revision 1.4 2005/10/05 06:18:35 nadya +# use full path for "rm". Asssume everybody has /bin/rm. +# +# Revision 1.3 2005/10/02 05:41:17 nadya +# add sourcing file to set all the environment +# use variables when calling real binaries. +# +# Revision 1.2 2005/10/02 05:01:49 nadya +# remove ".csh" from the name. Use extension ".bin" to call a real executable +# +# Revision 1.1.1.1 2005/07/30 02:21:41 nadya +# Importing from meme-3.0.14, and adding configure/make +# +# + +# This script was created by the MEME install command +set pgm = $0 +set pgm = $pgm:t + +# +# set the directories we need and get the machine/OS type +# + +# set the environment +setenv CONF @MEMEDIR@/etc/meme_config.csh +if ( -f $CONF) then + source $CONF +else + echo "$CONF does not exist. Meme installation is incomplete" + exit 1 +endif + + +# +# check for no arguments +# +if ($#argv < 1) then + usage: + cat << USAGE + USAGE: + mast-client [ ] + file to send to server + [ ] ping this host on this port + + Pings server on first CPU if is "__PING__" and exits with + status 0 if it is running. If arguments follow the first argument + "__PING__", pings a single host. + +USAGE +exit +endif + +# +# execute the binary version of the program with the arguments given +# during install and the arguments on the command line +# +@ i = 1 +set args = "" +# protect each argument with single quotes so they won't get lumped +while ($i <= $#argv) + set a = \'"$argv[$i]"\' + set args = "$args $a" + @ i++ +end + +# +# initialize names of available cpus and port numbers +# +set cpus = (@HOST_NAME@); set sockets = (@MASTPORT@); +set ncpus = $#cpus + +# +# initialize semaphore stuff +# +set patience = 10 # wait up to 10 seconds for +set down = $pgm.cpunum.down # down semaphore file name +set up = $pgm.cpunum.up # up semaphore file name + # semaphore +# +# test-and-set a semaphore file containing the next cpu number +# quit after $patience tries to prevent lockout and to create the +# semaphore the first time +# +@ i = 1 # patience counter +loop1: +mv -f $down $up >& /dev/null # test-and-set +if ($status && $i <= $patience) then # wait 1 second then loop + sleep 1 + @ i++ # bump patience counter + goto loop1 +endif + +# +# get the number of the cpu to use +# +if ($i > $patience) then # test-and-set failed + set cpunum = 1 # use first cpu +else # test and set succeeded + @ cpunum = `cat $up` # get cpu number from semaphore +endif + +# +# see if cpu is running server; if not, loop until a living cpu is found or all +# have been tried +# +if ($cpunum > $ncpus) set cpunum = 1 # in case fewer cpus than before +set first = $cpunum +set ping = $pgm.$$.ping.tmp +echo "ping" > $ping +set exe_status = 0 +onintr cleanup +while (1) + set cpu = $cpus[$cpunum] # name of cpu + if ($#argv == 3 && $1 == __PING__) then + set cpus = ($2) + set sockets = ($3) + set ncpus = 1 + endif + # ping the server + $MEME_BIN/$MEME_CLIENT_EXEC $sockets[$cpunum] $cpus[$cpunum] $ping 1 + set exe_status = $status # save the status + if ($1 == __PING__) goto cleanup # exit if this was a ping + if ($exe_status == 0) break; # server is alive + + # server is dead; get next cpu number mod n and loop + @ cpunum++ + if ($cpunum > $ncpus) @ cpunum = 1 + # check to see if out of cpus to try + if ($cpunum == $first) then # tried them all + mv -f $up $down >& /dev/null # clear the semaphore + echo "Sorry. No server is currently running." + goto cleanup # quit + endif +end + +# +# clear the semaphore setting next cpu number to use +# +@ next = $cpunum + 1 # next number +if ($next > $ncpus) @ next = 1 # modulo n +echo $next >! $up # store next cpu number +chmod 777 $up # so I can read it +mv -f $up $down # clear semaphore + +# +# execute the client +# +eval $MEME_BIN/$MEME_CLIENT_EXEC $sockets[$cpunum] $cpus[$cpunum] $args +set exe_status = $status # save the status + +# +# cleanup temporary files +# +cleanup: +if (-e $ping) /bin/rm -f $ping # delete the ping file +exit $exe_status diff --git a/tools/meme-suite/mast-client.txt.3.5.0.patch b/tools/meme-suite/mast-client.txt.3.5.0.patch new file mode 100644 index 0000000000000000000000000000000000000000..83a7a904da122b2496c33f70224d86f87743d941 --- /dev/null +++ b/tools/meme-suite/mast-client.txt.3.5.0.patch @@ -0,0 +1,33 @@ +--- mast-client.txt 2006-01-19 13:30:10.000000000 -0800 ++++ mast-client.txt 2006-01-18 15:57:30.000000000 -0800 +@@ -1,7 +1,11 @@ + #!/bin/csh + # +-# $Id: mast-client.txt,v 1.4 2005/10/05 06:18:35 nadya Exp $ ++# $Id: mast-client.txt,v 1.5 2006/01/03 06:37:00 tbailey Exp $ + # $Log: mast-client.txt,v $ ++# Revision 1.5 2006/01/03 06:37:00 tbailey ++# Fix "MEME_BINbin" bug in mast-client.txt. ++# Fix indentation in meme-server.c and meme-client.c. ++# + # Revision 1.4 2005/10/05 06:18:35 nadya + # use full path for "rm". Asssume everybody has /bin/rm. + # +@@ -121,7 +125,7 @@ + set ncpus = 1 + endif + # ping the server +- $MEME_BINbin/$MEME_CLIENT_EXEC $sockets[$cpunum] $cpus[$cpunum] $ping 1 ++ $MEME_BIN/$MEME_CLIENT_EXEC $sockets[$cpunum] $cpus[$cpunum] $ping 1 + set exe_status = $status # save the status + if ($1 == __PING__) goto cleanup # exit if this was a ping + if ($exe_status == 0) break; # server is alive +@@ -149,7 +153,7 @@ + # + # execute the client + # +-eval $MEME_BINbin/$MEME_CLIENT_EXEC $sockets[$cpunum] $cpus[$cpunum] $args ++eval $MEME_BIN/$MEME_CLIENT_EXEC $sockets[$cpunum] $cpus[$cpunum] $args + set exe_status = $status # save the status + + # diff --git a/tools/meme-suite/motif_databases.12.25.tgz b/tools/meme-suite/motif_databases.12.25.tgz new file mode 100644 index 0000000000000000000000000000000000000000..59b2f1610649ae8aad142d4880e6b88aa9532f2a --- /dev/null +++ b/tools/meme-suite/motif_databases.12.25.tgz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:2fc3e710cd4f6cf272851ca12fa73d56752170faada704f71895252073ffdc4e +size 42345776 diff --git a/tools/meme-suite/other/MEME.zip b/tools/meme-suite/other/MEME.zip new file mode 100644 index 0000000000000000000000000000000000000000..9170eb76f01f727c3814fa55a8a59e7866f7dd3f --- /dev/null +++ b/tools/meme-suite/other/MEME.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:214ce8aeafa958207a4b45b233950a24ccab46713518f445ecaf9bf72d2791ed +size 40953035 diff --git a/tools/meme-suite/other/memes/Description.txt b/tools/meme-suite/other/memes/Description.txt new file mode 100644 index 0000000000000000000000000000000000000000..f297e080b60f1825e923f98d3e5f57fb113863fb --- /dev/null +++ b/tools/meme-suite/other/memes/Description.txt @@ -0,0 +1 @@ +An R interface to the MEME Suite (https://snystrom.github.io/memes). \ No newline at end of file diff --git a/tools/meme-suite/other/memes/memes [ggraham] +370 -536.zip b/tools/meme-suite/other/memes/memes [ggraham] +370 -536.zip new file mode 100644 index 0000000000000000000000000000000000000000..d2ee6574c598bb88b47751aec89ea0520f679d6c --- /dev/null +++ b/tools/meme-suite/other/memes/memes [ggraham] +370 -536.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:b99bb1e0b2f69ab044760d8b204285a93b0cb9a8c95692d83fa67fa008f8c9a4 +size 18111367 diff --git a/tools/meme-suite/other/memes/memes [mniederhuber] +1 -3.zip b/tools/meme-suite/other/memes/memes [mniederhuber] +1 -3.zip new file mode 100644 index 0000000000000000000000000000000000000000..62b7f8b60abd9d04943ea4f056afc200f83014a3 --- /dev/null +++ b/tools/meme-suite/other/memes/memes [mniederhuber] +1 -3.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:ee9c17199751ead92fb6f9d76a59bcf9e812a9d83b4c8ae208b0519122979aa6 +size 3110588 diff --git a/tools/meme-suite/other/memes/memes [seb-mueller] +1 (warn-runmeme-control-objfun).zip b/tools/meme-suite/other/memes/memes [seb-mueller] +1 (warn-runmeme-control-objfun).zip new file mode 100644 index 0000000000000000000000000000000000000000..584dbe6237ccfc5afd88cebe9b2058202be1f6ac --- /dev/null +++ b/tools/meme-suite/other/memes/memes [seb-mueller] +1 (warn-runmeme-control-objfun).zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:3c557719fdd1cc200296b638117b8db6f9f2f1aa3d8b7707025b8036301cb765 +size 3143165 diff --git a/tools/meme-suite/other/memes/memes [ttriche] +1 -44.zip b/tools/meme-suite/other/memes/memes [ttriche] +1 -44.zip new file mode 100644 index 0000000000000000000000000000000000000000..4b7438eec42077af4f6afcbbe1a8eda0620c0ce9 --- /dev/null +++ b/tools/meme-suite/other/memes/memes [ttriche] +1 -44.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:ace5eb44e2dfd25647cd1fd18d26da5a6cc348180073b8080e200fdfa66928fb +size 3050701 diff --git a/tools/meme-suite/other/memes/memes.zip b/tools/meme-suite/other/memes/memes.zip new file mode 100644 index 0000000000000000000000000000000000000000..836eba1067f7f66bfa510fb55e4f805cd852156a --- /dev/null +++ b/tools/meme-suite/other/memes/memes.zip @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:66f697c937096085344827d82b869b51cd0d4487efbd68ae4b690706985acdf0 +size 3155821 diff --git a/tools/meme-suite/sequence_databases/fasta_arabidopsis.tgz b/tools/meme-suite/sequence_databases/fasta_arabidopsis.tgz new file mode 100644 index 0000000000000000000000000000000000000000..9ee6e02b42fbaf58e84b931ffe50fce018835cff --- /dev/null +++ b/tools/meme-suite/sequence_databases/fasta_arabidopsis.tgz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:cdf852bd90aaea685f4735ef8dec3b3022c1f8a72e95ec38380946df865f88ef +size 60962194 diff --git a/tools/meme-suite/sequence_databases/fasta_fly.tgz b/tools/meme-suite/sequence_databases/fasta_fly.tgz new file mode 100644 index 0000000000000000000000000000000000000000..5955cfa46ef772f3634f72aea01b4bea97b06100 --- /dev/null +++ b/tools/meme-suite/sequence_databases/fasta_fly.tgz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:7f6f74620215a54bdfbe0892402833de2f7b70b44fd9a5ab0151a2407d397c97 +size 193126901 diff --git a/tools/meme-suite/sequence_databases/fasta_frog.tgz b/tools/meme-suite/sequence_databases/fasta_frog.tgz new file mode 100644 index 0000000000000000000000000000000000000000..4d575d2fcf6556665be206ead9493d9effb51230 --- /dev/null +++ b/tools/meme-suite/sequence_databases/fasta_frog.tgz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:b03501e279cd51a8eb684e87a5d40088f9e6f08c78354cce64b465ea6b0055d0 +size 2651021074 diff --git a/tools/meme-suite/sequence_databases/fasta_human.tgz b/tools/meme-suite/sequence_databases/fasta_human.tgz new file mode 100644 index 0000000000000000000000000000000000000000..47ef0fc60cc9021ddab35213227e9cda92abf9b4 --- /dev/null +++ b/tools/meme-suite/sequence_databases/fasta_human.tgz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:8d9e18af2b9467fc17d7db509df8daf380d32acf7254a81018ca8c9064e921d7 +size 4765844992 diff --git a/tools/meme-suite/sequence_databases/fasta_model_organisms.tgz b/tools/meme-suite/sequence_databases/fasta_model_organisms.tgz new file mode 100644 index 0000000000000000000000000000000000000000..3486c8af2f11fab6e5e311897a0c2c0a03a8a079 --- /dev/null +++ b/tools/meme-suite/sequence_databases/fasta_model_organisms.tgz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:87244e7d53abd27ffb3340ddcb5b7a8c1e170ed9f19f0d0b5ebd1c6bf21ef5fb +size 11284710334 diff --git a/tools/meme-suite/sequence_databases/fasta_mouse.tgz b/tools/meme-suite/sequence_databases/fasta_mouse.tgz new file mode 100644 index 0000000000000000000000000000000000000000..6c64f918f62f8e500a3c57bd585b94cb5c682db8 --- /dev/null +++ b/tools/meme-suite/sequence_databases/fasta_mouse.tgz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:8b0959e644984f9e0c26f385b0942859c292286ac47b511b8980e914e9c7e6fe +size 4306206721 diff --git a/tools/meme-suite/sequence_databases/fasta_rat.tgz b/tools/meme-suite/sequence_databases/fasta_rat.tgz new file mode 100644 index 0000000000000000000000000000000000000000..accbcb74a675b2912344ace6465058b2b0b411d6 --- /dev/null +++ b/tools/meme-suite/sequence_databases/fasta_rat.tgz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:4c3494129424af3076c2f5d36af25e1c516d491b7d2788afc6e2436c4508609d +size 4310555848 diff --git a/tools/meme-suite/sequence_databases/fasta_rice.tgz b/tools/meme-suite/sequence_databases/fasta_rice.tgz new file mode 100644 index 0000000000000000000000000000000000000000..2af4af7861733083d3d25eee8a64b97a3f312ce3 --- /dev/null +++ b/tools/meme-suite/sequence_databases/fasta_rice.tgz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:3bc83f20a3648538fd63fbaecc1edf3a34a7858e6ab5ef1ee1f38fec299c4c09 +size 139082877 diff --git a/tools/meme-suite/sequence_databases/fasta_worm.tgz b/tools/meme-suite/sequence_databases/fasta_worm.tgz new file mode 100644 index 0000000000000000000000000000000000000000..5b7be48688267f225de6f0b5098851c140d54267 --- /dev/null +++ b/tools/meme-suite/sequence_databases/fasta_worm.tgz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:8990a9a9a38702339648d11c45867ca820ac5da79c2d0f05ac48d9eb7b426587 +size 173723612 diff --git a/tools/meme-suite/sequence_databases/fasta_yeast.tgz b/tools/meme-suite/sequence_databases/fasta_yeast.tgz new file mode 100644 index 0000000000000000000000000000000000000000..ab363b154f5dd6978713bc79df4c1e4984c35ba5 --- /dev/null +++ b/tools/meme-suite/sequence_databases/fasta_yeast.tgz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:9d1eb3ad8c1bd8b41fe8613499738f0031efae77990244e9fc312a53f569b596 +size 31839248 diff --git a/tools/meme-suite/sequence_databases/fasta_zebrafish.tgz b/tools/meme-suite/sequence_databases/fasta_zebrafish.tgz new file mode 100644 index 0000000000000000000000000000000000000000..da317f3c8f07856519421354c0cde089cd7389c5 --- /dev/null +++ b/tools/meme-suite/sequence_databases/fasta_zebrafish.tgz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:f3d28e8b264dfd62ef82f6bef180de412690a98af4d5b1afd0f11c33335ad579 +size 3446017850 diff --git a/tools/meme-suite/services/AME_5.5.4.xml b/tools/meme-suite/services/AME_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..c1b42137089168b7d242b875e8f9fa54d0e9eb0f --- /dev/null +++ b/tools/meme-suite/services/AME_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/AME_5.5.5.xml b/tools/meme-suite/services/AME_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..84a1d7666d82338b28bc45c6769af949654d3daf --- /dev/null +++ b/tools/meme-suite/services/AME_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/AME_5.5.6.xml b/tools/meme-suite/services/AME_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..4a8303a8384d8d98411a66dbe7fb89a206cfb484 --- /dev/null +++ b/tools/meme-suite/services/AME_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/AME_5.5.7.xml b/tools/meme-suite/services/AME_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..25dc4c522c12b24d18516740a0f2a234d6221999 --- /dev/null +++ b/tools/meme-suite/services/AME_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/AdminService.xml b/tools/meme-suite/services/AdminService.xml new file mode 100644 index 0000000000000000000000000000000000000000..0615e0998f0d9edff6ad44b99cc9315be2161519 --- /dev/null +++ b/tools/meme-suite/services/AdminService.xml @@ -0,0 +1,70 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/BED2FASTA_5.5.4.xml b/tools/meme-suite/services/BED2FASTA_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..63b37f49d4aedce225b8b99c1b47a61d948c0733 --- /dev/null +++ b/tools/meme-suite/services/BED2FASTA_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/BED2FASTA_5.5.5.xml b/tools/meme-suite/services/BED2FASTA_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..4f62481a05fb12d5c293cd18bcd62eab787083a7 --- /dev/null +++ b/tools/meme-suite/services/BED2FASTA_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/BED2FASTA_5.5.6.xml b/tools/meme-suite/services/BED2FASTA_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..700f39fadef516f885d0db67ce3811b77f789652 --- /dev/null +++ b/tools/meme-suite/services/BED2FASTA_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/BED2FASTA_5.5.7.xml b/tools/meme-suite/services/BED2FASTA_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..fe2a28fb728dcd2f5b37d419107ad2d116d988d4 --- /dev/null +++ b/tools/meme-suite/services/BED2FASTA_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/CENTRIMO_5.5.4.xml b/tools/meme-suite/services/CENTRIMO_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..17e2c636824cc8e8a7d796d62f955001178ef775 --- /dev/null +++ b/tools/meme-suite/services/CENTRIMO_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/CENTRIMO_5.5.5.xml b/tools/meme-suite/services/CENTRIMO_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..b7c57607b4760625ae0081aec7b1503047ed0bcf --- /dev/null +++ b/tools/meme-suite/services/CENTRIMO_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/CENTRIMO_5.5.6.xml b/tools/meme-suite/services/CENTRIMO_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..b48068891c720d9702cffc776c92abf4804f9cd1 --- /dev/null +++ b/tools/meme-suite/services/CENTRIMO_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/CENTRIMO_5.5.7.xml b/tools/meme-suite/services/CENTRIMO_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..39887522d8fbd161067745dcb4cf4b1f63edbd7b --- /dev/null +++ b/tools/meme-suite/services/CENTRIMO_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/DREME_5.5.4.xml b/tools/meme-suite/services/DREME_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..c70cf6f264825b6958e1ba5ac2cb3ae5bcf55968 --- /dev/null +++ b/tools/meme-suite/services/DREME_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/DREME_5.5.5.xml b/tools/meme-suite/services/DREME_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..8e68b5a37b1d82b2b4aa63501f3fef20249d5d6e --- /dev/null +++ b/tools/meme-suite/services/DREME_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/DREME_5.5.6.xml b/tools/meme-suite/services/DREME_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..ed29d1113461b2fc9a56f1e5fd8181c45fdc3dab --- /dev/null +++ b/tools/meme-suite/services/DREME_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/DREME_5.5.7.xml b/tools/meme-suite/services/DREME_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..29078ec1ad40e18740ae4be16f45a77295854674 --- /dev/null +++ b/tools/meme-suite/services/DREME_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/FIMO_5.5.4.xml b/tools/meme-suite/services/FIMO_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..e5fb1d104e8b4b025143fc5a3b120d8c616d343f --- /dev/null +++ b/tools/meme-suite/services/FIMO_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/FIMO_5.5.5.xml b/tools/meme-suite/services/FIMO_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..1a7ff326e53cc3eca3dcf8f35eefa9f0e84d5b7c --- /dev/null +++ b/tools/meme-suite/services/FIMO_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/FIMO_5.5.6.xml b/tools/meme-suite/services/FIMO_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..7be69acb1e5844bce00b2938900cb9fe9cdb79d8 --- /dev/null +++ b/tools/meme-suite/services/FIMO_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/FIMO_5.5.7.xml b/tools/meme-suite/services/FIMO_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..fb1f80dde055320abb86343ea2345c0e386f7742 --- /dev/null +++ b/tools/meme-suite/services/FIMO_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/GLAM2SCAN_5.5.4.xml b/tools/meme-suite/services/GLAM2SCAN_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..534fff7cffdcbcd2b334e0479cfff420c213b558 --- /dev/null +++ b/tools/meme-suite/services/GLAM2SCAN_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/GLAM2SCAN_5.5.5.xml b/tools/meme-suite/services/GLAM2SCAN_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..232fde635936c73f5c1721eaa6d09acb770b7dca --- /dev/null +++ b/tools/meme-suite/services/GLAM2SCAN_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/GLAM2SCAN_5.5.6.xml b/tools/meme-suite/services/GLAM2SCAN_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..a34b4865f17881396c4ea51d5f81720d96c4cbd2 --- /dev/null +++ b/tools/meme-suite/services/GLAM2SCAN_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/GLAM2SCAN_5.5.7.xml b/tools/meme-suite/services/GLAM2SCAN_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..63a5d05b9b913c1bc2ba350c97fe2cf76f1cd582 --- /dev/null +++ b/tools/meme-suite/services/GLAM2SCAN_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/GLAM2_5.5.4.xml b/tools/meme-suite/services/GLAM2_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..6a823b8a81f7151e8e181d8e31d836a0077cfe15 --- /dev/null +++ b/tools/meme-suite/services/GLAM2_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/GLAM2_5.5.5.xml b/tools/meme-suite/services/GLAM2_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..d891bdacaea11b45f70b61be6451aa0874bca803 --- /dev/null +++ b/tools/meme-suite/services/GLAM2_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/GLAM2_5.5.6.xml b/tools/meme-suite/services/GLAM2_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..32da71f831e45bbd31af34471f57eb247d4bd8be --- /dev/null +++ b/tools/meme-suite/services/GLAM2_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/GLAM2_5.5.7.xml b/tools/meme-suite/services/GLAM2_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..7b4644fe32bc2068763ac7a7ba120d5f3d30be83 --- /dev/null +++ b/tools/meme-suite/services/GLAM2_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/GOMO_5.5.4.xml b/tools/meme-suite/services/GOMO_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..33a62b01310c6e653599fc32e65c23320345b6ca --- /dev/null +++ b/tools/meme-suite/services/GOMO_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/GOMO_5.5.5.xml b/tools/meme-suite/services/GOMO_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..433dad5738dd32ae0a1637b6375f2168adfd3e15 --- /dev/null +++ b/tools/meme-suite/services/GOMO_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/GOMO_5.5.6.xml b/tools/meme-suite/services/GOMO_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..0b96ffe736d9a656efba905800a83f6b1f26739e --- /dev/null +++ b/tools/meme-suite/services/GOMO_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/GOMO_5.5.7.xml b/tools/meme-suite/services/GOMO_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..4c197b56632d1f89c5f5a2cf9c1ba2a411f15bdc --- /dev/null +++ b/tools/meme-suite/services/GOMO_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MAST_5.5.4.xml b/tools/meme-suite/services/MAST_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..e22c74437fe4b1a9154cfc1d5e9105b4baa12874 --- /dev/null +++ b/tools/meme-suite/services/MAST_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MAST_5.5.5.xml b/tools/meme-suite/services/MAST_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..b04fe40b6f371e066bfc37b218e07f9ddbe5f596 --- /dev/null +++ b/tools/meme-suite/services/MAST_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MAST_5.5.6.xml b/tools/meme-suite/services/MAST_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..0263a6ce09c78733e22c3f8a6cfda67c2c3ce40a --- /dev/null +++ b/tools/meme-suite/services/MAST_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MAST_5.5.7.xml b/tools/meme-suite/services/MAST_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..3d3eea831de2f45ebbdd03bb09fa0a1d3b6f025f --- /dev/null +++ b/tools/meme-suite/services/MAST_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MCAST_5.5.4.xml b/tools/meme-suite/services/MCAST_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..b4db2f576089d0ed1167edbb12a980ac04321a26 --- /dev/null +++ b/tools/meme-suite/services/MCAST_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MCAST_5.5.5.xml b/tools/meme-suite/services/MCAST_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..8abf7f293856a35769db4b5f487bb44f9f9560b4 --- /dev/null +++ b/tools/meme-suite/services/MCAST_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MCAST_5.5.6.xml b/tools/meme-suite/services/MCAST_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..3ca39754978f43429820bd0f19af0500583c4a53 --- /dev/null +++ b/tools/meme-suite/services/MCAST_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MCAST_5.5.7.xml b/tools/meme-suite/services/MCAST_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..0ee280c938f75493a9eb4cd0a694b88dcf1425ad --- /dev/null +++ b/tools/meme-suite/services/MCAST_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MEMECHIP_5.5.4.xml b/tools/meme-suite/services/MEMECHIP_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..9de2fd510f66e06ef67753bda540a54b2dc37090 --- /dev/null +++ b/tools/meme-suite/services/MEMECHIP_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MEMECHIP_5.5.5.xml b/tools/meme-suite/services/MEMECHIP_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..cfedc425817f7f7c28d6d5130bdcba42e58c0d62 --- /dev/null +++ b/tools/meme-suite/services/MEMECHIP_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MEMECHIP_5.5.6.xml b/tools/meme-suite/services/MEMECHIP_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..eb1ffda11c0ee2f8a9204a0588fe11abf837936f --- /dev/null +++ b/tools/meme-suite/services/MEMECHIP_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MEMECHIP_5.5.7.xml b/tools/meme-suite/services/MEMECHIP_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..a2be7c6ee096ea780d3c408dc054e6a7bc802b4d --- /dev/null +++ b/tools/meme-suite/services/MEMECHIP_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MEME_5.5.4.xml b/tools/meme-suite/services/MEME_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..3a8b107f8a2006dd3e3bc4dd5090192404a0ac76 --- /dev/null +++ b/tools/meme-suite/services/MEME_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MEME_5.5.5.xml b/tools/meme-suite/services/MEME_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..11e144140a8fd56ab82aa607df0807d905137aa9 --- /dev/null +++ b/tools/meme-suite/services/MEME_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MEME_5.5.6.xml b/tools/meme-suite/services/MEME_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..f1ad50f8262c485c769cba36de3163ad14d7311d --- /dev/null +++ b/tools/meme-suite/services/MEME_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MEME_5.5.7.xml b/tools/meme-suite/services/MEME_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..04230e3a5d0e4391e8c0306017e481168e09bf8b --- /dev/null +++ b/tools/meme-suite/services/MEME_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MOMO_5.5.4.xml b/tools/meme-suite/services/MOMO_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..043d7626f54f27d2247c4189c9e134b00f67ca6f --- /dev/null +++ b/tools/meme-suite/services/MOMO_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MOMO_5.5.5.xml b/tools/meme-suite/services/MOMO_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..dad466b8472709f2275f27a6d809f03977dd5943 --- /dev/null +++ b/tools/meme-suite/services/MOMO_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MOMO_5.5.6.xml b/tools/meme-suite/services/MOMO_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..735ee551ff005142c7242d81a1a7a4b5506a5640 --- /dev/null +++ b/tools/meme-suite/services/MOMO_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/MOMO_5.5.7.xml b/tools/meme-suite/services/MOMO_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..9c1f87c436ccf94d4865f73f21cc890b6964ea75 --- /dev/null +++ b/tools/meme-suite/services/MOMO_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/SEA_5.5.4.xml b/tools/meme-suite/services/SEA_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..f563d4043fb5a6d1b68388703307e0fda46c9ad0 --- /dev/null +++ b/tools/meme-suite/services/SEA_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/SEA_5.5.5.xml b/tools/meme-suite/services/SEA_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..c09b8e088037a232ae24f85225e8b15ce43d910a --- /dev/null +++ b/tools/meme-suite/services/SEA_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/SEA_5.5.6.xml b/tools/meme-suite/services/SEA_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..95e844216a191314f2a6a8a82375eae4af1f83fe --- /dev/null +++ b/tools/meme-suite/services/SEA_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/SEA_5.5.7.xml b/tools/meme-suite/services/SEA_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..27886699d8999d10e7861b88670d8d9761473e8f --- /dev/null +++ b/tools/meme-suite/services/SEA_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/SPAMO_5.5.4.xml b/tools/meme-suite/services/SPAMO_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..421aa313bda7f148f9a0bb47e3bb4ffc713faab2 --- /dev/null +++ b/tools/meme-suite/services/SPAMO_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/SPAMO_5.5.5.xml b/tools/meme-suite/services/SPAMO_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..2047175192b0dc161bb5dc090c75b72308efd47b --- /dev/null +++ b/tools/meme-suite/services/SPAMO_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/SPAMO_5.5.6.xml b/tools/meme-suite/services/SPAMO_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..0fc14acc4c9ed4bb34bf3b7bceb10ed353ff6f3e --- /dev/null +++ b/tools/meme-suite/services/SPAMO_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/SPAMO_5.5.7.xml b/tools/meme-suite/services/SPAMO_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..d9231b5a53487b3624d742e9d78606f25fb904c5 --- /dev/null +++ b/tools/meme-suite/services/SPAMO_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/STREME_5.5,4.xml b/tools/meme-suite/services/STREME_5.5,4.xml new file mode 100644 index 0000000000000000000000000000000000000000..e46731c8dc399fa975aa61b01d5cfa65d6c64705 --- /dev/null +++ b/tools/meme-suite/services/STREME_5.5,4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/STREME_5.5.5.xml b/tools/meme-suite/services/STREME_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..b81e688577035573cfbf891f70c0600ff11582f0 --- /dev/null +++ b/tools/meme-suite/services/STREME_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/STREME_5.5.6.xml b/tools/meme-suite/services/STREME_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..f82b5a0e429f3d2568e51e76a624e460d34a67d0 --- /dev/null +++ b/tools/meme-suite/services/STREME_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/STREME_5.5.7.xml b/tools/meme-suite/services/STREME_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..43e6bdc476bdc36bbbe1db417793353d6c139cb4 --- /dev/null +++ b/tools/meme-suite/services/STREME_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/TGENE_5.5.4.xml b/tools/meme-suite/services/TGENE_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..331eb963b3dc05317ea15717fec68d6889010d3d --- /dev/null +++ b/tools/meme-suite/services/TGENE_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/TGENE_5.5.5.xml b/tools/meme-suite/services/TGENE_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..2c5112219e81f57c57209bd6fcd2331e2d93c2ef --- /dev/null +++ b/tools/meme-suite/services/TGENE_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/TGENE_5.5.6.xml b/tools/meme-suite/services/TGENE_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..8a1733e2e965f75e12142bc3346ffdf9402ead50 --- /dev/null +++ b/tools/meme-suite/services/TGENE_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/TGENE_5.5.7.xml b/tools/meme-suite/services/TGENE_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..914f64c996f5ad1ddfb3b17a9a2377c1a2bb5cc4 --- /dev/null +++ b/tools/meme-suite/services/TGENE_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/TOMTOM_5.5.4.xml b/tools/meme-suite/services/TOMTOM_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..ff8144e951c088d3ce81170ff92d2dd082be5022 --- /dev/null +++ b/tools/meme-suite/services/TOMTOM_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/TOMTOM_5.5.5.xml b/tools/meme-suite/services/TOMTOM_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..f31dd66e8893d59ab09df4221e9d4a9fd46a2ffb --- /dev/null +++ b/tools/meme-suite/services/TOMTOM_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/TOMTOM_5.5.6.xml b/tools/meme-suite/services/TOMTOM_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..45b29c418faf488ee7ef54379a6c07ac52aa251b --- /dev/null +++ b/tools/meme-suite/services/TOMTOM_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/TOMTOM_5.5.7.xml b/tools/meme-suite/services/TOMTOM_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..a741b07263fdd52f5c386f548689b022f076fb01 --- /dev/null +++ b/tools/meme-suite/services/TOMTOM_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/TOMTOM_SHORT_5.5.4.xml b/tools/meme-suite/services/TOMTOM_SHORT_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..cd51b147e658db0451f1bbe623a02f26fede6786 --- /dev/null +++ b/tools/meme-suite/services/TOMTOM_SHORT_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/TOMTOM_SHORT_5.5.5.xml b/tools/meme-suite/services/TOMTOM_SHORT_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..d95e7bbb48eef08877c44926492483ff6f9c97d9 --- /dev/null +++ b/tools/meme-suite/services/TOMTOM_SHORT_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/TOMTOM_SHORT_5.5.6.xml b/tools/meme-suite/services/TOMTOM_SHORT_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..7bd128781eb66891e9dc905235d35946fbc9efeb --- /dev/null +++ b/tools/meme-suite/services/TOMTOM_SHORT_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/TOMTOM_SHORT_5.5.7.xml b/tools/meme-suite/services/TOMTOM_SHORT_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..84411eaef68192f811e1cd0b1fe74b50060e4918 --- /dev/null +++ b/tools/meme-suite/services/TOMTOM_SHORT_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/Version.xml b/tools/meme-suite/services/Version.xml new file mode 100644 index 0000000000000000000000000000000000000000..8cb00b59e2dd0c1ce97379f6805e7340b7476cdd --- /dev/null +++ b/tools/meme-suite/services/Version.xml @@ -0,0 +1,62 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/XSTREME_5.5.4.xml b/tools/meme-suite/services/XSTREME_5.5.4.xml new file mode 100644 index 0000000000000000000000000000000000000000..a7713cf1bd21257cc9dbdf8e6085a1f15a12c229 --- /dev/null +++ b/tools/meme-suite/services/XSTREME_5.5.4.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/XSTREME_5.5.5.xml b/tools/meme-suite/services/XSTREME_5.5.5.xml new file mode 100644 index 0000000000000000000000000000000000000000..8561eac462eb286ca709f5bc96e8c2ea1f90e756 --- /dev/null +++ b/tools/meme-suite/services/XSTREME_5.5.5.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/XSTREME_5.5.6.xml b/tools/meme-suite/services/XSTREME_5.5.6.xml new file mode 100644 index 0000000000000000000000000000000000000000..1095a02d0d9602f88d1530036d698929b5fcfff0 --- /dev/null +++ b/tools/meme-suite/services/XSTREME_5.5.6.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/services/XSTREME_5.5.7.xml b/tools/meme-suite/services/XSTREME_5.5.7.xml new file mode 100644 index 0000000000000000000000000000000000000000..b77c19c673725eea3c098be87df07ec362e2dba4 --- /dev/null +++ b/tools/meme-suite/services/XSTREME_5.5.7.xml @@ -0,0 +1,730 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/tools/meme-suite/sources/meme-3.0.14-unpatched.tar.gz b/tools/meme-suite/sources/meme-3.0.14-unpatched.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..7079085a92093b31a782f88c747cf039418f187d --- /dev/null +++ b/tools/meme-suite/sources/meme-3.0.14-unpatched.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:31295e552d07246f703d58254ae31efe7cb52d34858411d62e1f123920c4639e +size 1013152 diff --git a/tools/meme-suite/sources/meme-3.0.14.tar.gz b/tools/meme-suite/sources/meme-3.0.14.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..7079085a92093b31a782f88c747cf039418f187d --- /dev/null +++ b/tools/meme-suite/sources/meme-3.0.14.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:31295e552d07246f703d58254ae31efe7cb52d34858411d62e1f123920c4639e +size 1013152 diff --git a/tools/meme-suite/sources/meme-5.0.2.tar.gz b/tools/meme-suite/sources/meme-5.0.2.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..eb5195ebdde2e223cc371695040fcf04a2927484 --- /dev/null +++ b/tools/meme-suite/sources/meme-5.0.2.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:5840bbfbfdf303c2707cad30f9a80b463cffed6ddcb5fa4a77451625532b23b7 +size 40393646 diff --git a/tools/meme-suite/sources/meme-5.0.3.tar.gz b/tools/meme-suite/sources/meme-5.0.3.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..b69ce52cb62956ed1c0b3529c64f782fd644cfe5 --- /dev/null +++ b/tools/meme-suite/sources/meme-5.0.3.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:ecc2fac76450f1b62e23f577f42385b5758e7ed497aa69c9688457c29b100f5a +size 40612722 diff --git a/tools/meme-suite/sources/meme-5.0.4.tar.gz b/tools/meme-suite/sources/meme-5.0.4.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..0f8c3857d21741edcf3399e77bc355ddbd5c6804 --- /dev/null +++ b/tools/meme-suite/sources/meme-5.0.4.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:b5e067c8b9d9fe4a2a35d4f4d053714beb380c0c06b54ed94737dd31d93c4cf4 +size 40618275 diff --git a/tools/meme-suite/sources/meme-5.0.5.tar.gz b/tools/meme-suite/sources/meme-5.0.5.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..848c8c0ed5630d19caf857611a48960efae8d5ad --- /dev/null +++ b/tools/meme-suite/sources/meme-5.0.5.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:94826793576f4dd2f10fef829426dcde57f3cc990e462d9428c84f83d71eaeeb +size 36560203 diff --git a/tools/meme-suite/sources/meme-5.1.0.tar.gz b/tools/meme-suite/sources/meme-5.1.0.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..9bba87d156448bcf9bab75c40b123972422008c2 --- /dev/null +++ b/tools/meme-suite/sources/meme-5.1.0.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:46b527cb0eebb6ca21976dcd87aae8a4dd9cf55756679c692fc99bae895d36c9 +size 46289182 diff --git a/tools/meme-suite/sources/meme-5.1.1.tar.gz b/tools/meme-suite/sources/meme-5.1.1.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..7a5bac8f9fd965cf0ff6ad3a59298ea5a025f6e7 --- /dev/null +++ b/tools/meme-suite/sources/meme-5.1.1.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:38d73d256d431ad4eb7da2c817ce56ff2b4e26c39387ff0d6ada088938b38eb5 +size 46199283 diff --git a/tools/meme-suite/sources/meme-5.2.0.tar.gz b/tools/meme-suite/sources/meme-5.2.0.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..6f1dbe742c8e216fc8538b52747198d3f57a5752 --- /dev/null +++ b/tools/meme-suite/sources/meme-5.2.0.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:0cbf8c2172e9b6c07855b8aeec457f4825f0b132f8cbb11192880e2f6033f54f +size 47470283 diff --git a/tools/meme-suite/sources/meme-5.3.0.tar.gz b/tools/meme-suite/sources/meme-5.3.0.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..7d3c13b22a0ce03ac0849ef039b06cc52e31fd33 --- /dev/null +++ b/tools/meme-suite/sources/meme-5.3.0.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:b2ddec9db972fcf77b29c7deb62df8b1dd8a6638c13c1aa06a5d563c4a7ff756 +size 47648721 diff --git a/tools/meme-suite/sources/meme-5.3.1.tar.gz b/tools/meme-suite/sources/meme-5.3.1.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..a9b6a03062f838b9f34942c2b50d50677c0d5451 --- /dev/null +++ b/tools/meme-suite/sources/meme-5.3.1.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:7ee8fd07b8d64dbf886c81436cc341a3bbe60f8c6b67e3dd69ee3beb7906b931 +size 47640071 diff --git a/tools/meme-suite/sources/meme-5.3.2.tar.gz b/tools/meme-suite/sources/meme-5.3.2.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..7d4005f33a9994ff3e421c7b08aadbed4e6ae091 --- /dev/null +++ b/tools/meme-suite/sources/meme-5.3.2.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:b985cec5410df67075d7c63293ed0e3d3617223df7de4fbcaaf7b320a0523a01 +size 47525986 diff --git a/tools/meme-suite/sources/meme-5.3.3.tar.gz b/tools/meme-suite/sources/meme-5.3.3.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..d68ac8a0dd27259b4c1588fe6a49b025cf2f413a --- /dev/null +++ b/tools/meme-suite/sources/meme-5.3.3.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:5f2679c944573a6cb3556e88f11529973753993fe227b2399fc06451270fa1ed +size 47515314 diff --git a/tools/meme-suite/sources/meme-5.4.0.tar.gz b/tools/meme-suite/sources/meme-5.4.0.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..5ba748c987782956b0f8f27ddcbc70e3eaaa3aaf --- /dev/null +++ b/tools/meme-suite/sources/meme-5.4.0.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:e446baf78ce8f9b9dc72723bc91c1d60523174a862af19971a92332a7298d56e +size 52140231 diff --git a/tools/meme-suite/sources/meme-5.4.1.tar.gz b/tools/meme-suite/sources/meme-5.4.1.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..7ffbe91a2856bc11a73111ebda6405200660f65e --- /dev/null +++ b/tools/meme-suite/sources/meme-5.4.1.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:c07fb8afafa60fc5e84ca24493c82fa6f4bd1df1a2622102edbf86a1c30fd11f +size 52143122 diff --git a/tools/meme-suite/sources/meme-5.5.0.tar.gz b/tools/meme-suite/sources/meme-5.5.0.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..0bcedd8a75acd5f4d6e9cbea0267ae4910c30628 --- /dev/null +++ b/tools/meme-suite/sources/meme-5.5.0.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:bc6f693bf5d81778b4e2901c2164c35c68f42ed080e2401b6e22960bf039a272 +size 52764373 diff --git a/tools/meme-suite/sources/meme-5.5.1.tar.gz b/tools/meme-suite/sources/meme-5.5.1.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..038335d298e52f131cbad2429e97394f199d80d2 --- /dev/null +++ b/tools/meme-suite/sources/meme-5.5.1.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:d7369cb01b55db477b7f73be1cf431d1ae86e92f14786e9891b9a9dff2b0975a +size 52798604 diff --git a/tools/meme-suite/sources/meme-5.5.2.tar.gz b/tools/meme-suite/sources/meme-5.5.2.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..06170dfa4af1c438a4e8020a92c819810e6f30d0 --- /dev/null +++ b/tools/meme-suite/sources/meme-5.5.2.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:340644438dac7584895ecffafa8c1fb7de57c705a34045c1ea1bde785bab05a3 +size 52796485 diff --git a/tools/meme-suite/sources/meme-5.5.3.tar.gz b/tools/meme-suite/sources/meme-5.5.3.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..d79a382031147e5a4b365e0d396b6bccad6370c9 --- /dev/null +++ b/tools/meme-suite/sources/meme-5.5.3.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:203abf6d89da15f346e6cbf25795fb0659020755df54e8b4b69cb0d4e636e8a1 +size 53706468 diff --git a/tools/meme-suite/sources/meme-5.5.4.tar.gz b/tools/meme-suite/sources/meme-5.5.4.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..011629307b71811558878b2aeed6a69666384bdc --- /dev/null +++ b/tools/meme-suite/sources/meme-5.5.4.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:cda6011c2b855bf2563c4e7a2c255e11e99b5b6e5e73736ff008942507580153 +size 53990145 diff --git a/tools/meme-suite/sources/meme-5.5.5.tar.gz b/tools/meme-suite/sources/meme-5.5.5.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..11af0cd711dd28cb266309860d12eb476e909a85 --- /dev/null +++ b/tools/meme-suite/sources/meme-5.5.5.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:bebb4a176e72d62e3a2d5ba5f22439185bbc4bbf4769604fbca12dff8e1f739f +size 55017311 diff --git a/tools/meme-suite/sources/meme-5.5.6.tar.gz b/tools/meme-suite/sources/meme-5.5.6.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..c2a48efefb23adfc22687b3aa34bed4ae182a655 --- /dev/null +++ b/tools/meme-suite/sources/meme-5.5.6.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:8f719002c3a2177f6bb9da6861098ccf4f08b3006f002a88bb3afe9473596c67 +size 56510161 diff --git a/tools/meme-suite/sources/meme-5.5.7.tar.gz b/tools/meme-suite/sources/meme-5.5.7.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..4543865874a1b895b969687fb66c2375e2660a3a --- /dev/null +++ b/tools/meme-suite/sources/meme-5.5.7.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:1dca8d0e6d1d36570c1a88ab8dbe7e4b177733fbbeacaa2e8c4674febf57aaf4 +size 56511205 diff --git a/tools/meme-suite/sources/meme.1.2-unpatched.tar.Z b/tools/meme-suite/sources/meme.1.2-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..f91ec2c3edf282da70689b5983cc33a63c94ab18 --- /dev/null +++ b/tools/meme-suite/sources/meme.1.2-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:2e9e6e01291718340dc578ab285f7cd274498a3845705d14ffbcc7731e572692 +size 202697 diff --git a/tools/meme-suite/sources/meme.1.2.tar.Z b/tools/meme-suite/sources/meme.1.2.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..f91ec2c3edf282da70689b5983cc33a63c94ab18 --- /dev/null +++ b/tools/meme-suite/sources/meme.1.2.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:2e9e6e01291718340dc578ab285f7cd274498a3845705d14ffbcc7731e572692 +size 202697 diff --git a/tools/meme-suite/sources/meme.1.3-unpatched.tar.Z b/tools/meme-suite/sources/meme.1.3-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..97f187af7fca887b544478354cdf8fcd094381c3 --- /dev/null +++ b/tools/meme-suite/sources/meme.1.3-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:9744fa75f50b2eb2cb1e5bc44e65c3be1bd62be425506aef5213af0cdf382237 +size 208229 diff --git a/tools/meme-suite/sources/meme.1.3.tar.Z b/tools/meme-suite/sources/meme.1.3.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..97f187af7fca887b544478354cdf8fcd094381c3 --- /dev/null +++ b/tools/meme-suite/sources/meme.1.3.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:9744fa75f50b2eb2cb1e5bc44e65c3be1bd62be425506aef5213af0cdf382237 +size 208229 diff --git a/tools/meme-suite/sources/meme.1.4-unpatched.tar.Z b/tools/meme-suite/sources/meme.1.4-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..8df6f0e06399a8eec4500c40bc7b99f86df26f99 --- /dev/null +++ b/tools/meme-suite/sources/meme.1.4-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:6b80c1f2013e056596e1db7100d9f5a47eddd8d8c8e7800f3c5c6a06779b16b7 +size 309259 diff --git a/tools/meme-suite/sources/meme.1.4.3-unpatched.tar.Z b/tools/meme-suite/sources/meme.1.4.3-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..433a1328e1a5713b2822197bfc7ec1cfd22fee55 --- /dev/null +++ b/tools/meme-suite/sources/meme.1.4.3-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:24a393764bfad40afb041d7e0295e02f16c183c7b3fcaf87f0696135a06d6cef +size 313699 diff --git a/tools/meme-suite/sources/meme.1.4.3.tar.Z b/tools/meme-suite/sources/meme.1.4.3.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..433a1328e1a5713b2822197bfc7ec1cfd22fee55 --- /dev/null +++ b/tools/meme-suite/sources/meme.1.4.3.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:24a393764bfad40afb041d7e0295e02f16c183c7b3fcaf87f0696135a06d6cef +size 313699 diff --git a/tools/meme-suite/sources/meme.1.4.tar.Z b/tools/meme-suite/sources/meme.1.4.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..8df6f0e06399a8eec4500c40bc7b99f86df26f99 --- /dev/null +++ b/tools/meme-suite/sources/meme.1.4.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:6b80c1f2013e056596e1db7100d9f5a47eddd8d8c8e7800f3c5c6a06779b16b7 +size 309259 diff --git a/tools/meme-suite/sources/meme.2.0-unpatched.tar.Z b/tools/meme-suite/sources/meme.2.0-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..36c55c9314f6e3f9ecf4b2d0c84899f3a247c4e1 --- /dev/null +++ b/tools/meme-suite/sources/meme.2.0-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:be6b209d127659c32f5bcf46adb8a74fba460d4dd614ab5c0261f4add85cd88f +size 499355 diff --git a/tools/meme-suite/sources/meme.2.0.tar.Z b/tools/meme-suite/sources/meme.2.0.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..36c55c9314f6e3f9ecf4b2d0c84899f3a247c4e1 --- /dev/null +++ b/tools/meme-suite/sources/meme.2.0.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:be6b209d127659c32f5bcf46adb8a74fba460d4dd614ab5c0261f4add85cd88f +size 499355 diff --git a/tools/meme-suite/sources/meme.2.1-unpatched.tar.Z b/tools/meme-suite/sources/meme.2.1-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..b1c83a32ee404ca7fafb2f61641dcc16e5359d0c --- /dev/null +++ b/tools/meme-suite/sources/meme.2.1-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:14afbf2e036f1be47789dd4c716e7f2dc3f7f8f2827ab4bd8cf233dc5226f923 +size 541430 diff --git a/tools/meme-suite/sources/meme.2.1.tar.Z b/tools/meme-suite/sources/meme.2.1.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..b1c83a32ee404ca7fafb2f61641dcc16e5359d0c --- /dev/null +++ b/tools/meme-suite/sources/meme.2.1.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:14afbf2e036f1be47789dd4c716e7f2dc3f7f8f2827ab4bd8cf233dc5226f923 +size 541430 diff --git a/tools/meme-suite/sources/meme.2.2-unpatched.tar.Z b/tools/meme-suite/sources/meme.2.2-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..b586fc201d590bc952a2ddb65d28f851d9ac6696 --- /dev/null +++ b/tools/meme-suite/sources/meme.2.2-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:9357c44341deaad6161f8898ffc3bcc99c7cb54830cfca508b9e359ae55ab157 +size 635637 diff --git a/tools/meme-suite/sources/meme.2.2.2-unpatched.tar.Z b/tools/meme-suite/sources/meme.2.2.2-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..ff18df0787b31fc8b770d5dd8cbc0e1d79326f31 --- /dev/null +++ b/tools/meme-suite/sources/meme.2.2.2-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:a96fc1a6899a28813e37ce9364210310ec6b5ff9b2a6a591c3f8b63676d88095 +size 687314 diff --git a/tools/meme-suite/sources/meme.2.2.2.tar.Z b/tools/meme-suite/sources/meme.2.2.2.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..ff18df0787b31fc8b770d5dd8cbc0e1d79326f31 --- /dev/null +++ b/tools/meme-suite/sources/meme.2.2.2.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:a96fc1a6899a28813e37ce9364210310ec6b5ff9b2a6a591c3f8b63676d88095 +size 687314 diff --git a/tools/meme-suite/sources/meme.2.2.tar.Z b/tools/meme-suite/sources/meme.2.2.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..b586fc201d590bc952a2ddb65d28f851d9ac6696 --- /dev/null +++ b/tools/meme-suite/sources/meme.2.2.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:9357c44341deaad6161f8898ffc3bcc99c7cb54830cfca508b9e359ae55ab157 +size 635637 diff --git a/tools/meme-suite/sources/meme.2.3.beta-unpatched.tar.Z b/tools/meme-suite/sources/meme.2.3.beta-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..458b6b8c489ffabd9d352305c0493aa9246cf353 --- /dev/null +++ b/tools/meme-suite/sources/meme.2.3.beta-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:2fa534edf3fed5f6f190bd83f4c133fd1e6d295aed194c3d5df897f9a26cae2c +size 697287 diff --git a/tools/meme-suite/sources/meme.2.3.beta.tar.Z b/tools/meme-suite/sources/meme.2.3.beta.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..458b6b8c489ffabd9d352305c0493aa9246cf353 --- /dev/null +++ b/tools/meme-suite/sources/meme.2.3.beta.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:2fa534edf3fed5f6f190bd83f4c133fd1e6d295aed194c3d5df897f9a26cae2c +size 697287 diff --git a/tools/meme-suite/sources/meme.3.0.10-unpatched.tar.Z b/tools/meme-suite/sources/meme.3.0.10-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..46e49c787b45babd06a81e443b349abf1df38f53 --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.10-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:2e250bea875f3eac5be8856925d8ac3e27362f11da8696d9de3cfca32516bba3 +size 1413663 diff --git a/tools/meme-suite/sources/meme.3.0.10.tar.Z b/tools/meme-suite/sources/meme.3.0.10.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..46e49c787b45babd06a81e443b349abf1df38f53 --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.10.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:2e250bea875f3eac5be8856925d8ac3e27362f11da8696d9de3cfca32516bba3 +size 1413663 diff --git a/tools/meme-suite/sources/meme.3.0.13-unpatched.tar.Z b/tools/meme-suite/sources/meme.3.0.13-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..173cb62c437a0649a3933b3a8cafaf1662a18fc2 --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.13-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:673393d608c1d1d047e066635edb219fc25bebc552092049a6abda0a7dd70310 +size 1414388 diff --git a/tools/meme-suite/sources/meme.3.0.13.tar.Z b/tools/meme-suite/sources/meme.3.0.13.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..173cb62c437a0649a3933b3a8cafaf1662a18fc2 --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.13.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:673393d608c1d1d047e066635edb219fc25bebc552092049a6abda0a7dd70310 +size 1414388 diff --git a/tools/meme-suite/sources/meme.3.0.2-unpatched.tar.Z b/tools/meme-suite/sources/meme.3.0.2-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..dd74b6560a81aeb9b26a43e538db9ab63de50ce8 --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.2-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:d50e693261a6232d76cb3b46b0512ed771399bec8c6c4568cfdbe7cc70c8245e +size 1372437 diff --git a/tools/meme-suite/sources/meme.3.0.2.tar.Z b/tools/meme-suite/sources/meme.3.0.2.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..dd74b6560a81aeb9b26a43e538db9ab63de50ce8 --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.2.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:d50e693261a6232d76cb3b46b0512ed771399bec8c6c4568cfdbe7cc70c8245e +size 1372437 diff --git a/tools/meme-suite/sources/meme.3.0.3-unpatched.tar.Z b/tools/meme-suite/sources/meme.3.0.3-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..2f77a359d31e138297f388b2e5ce7ac30f2842e8 --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.3-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:ab26fc5663c31e4b29e09df410ee3ccc7347e315880a7806c64ff8a4853614fa +size 1384749 diff --git a/tools/meme-suite/sources/meme.3.0.3.tar.Z b/tools/meme-suite/sources/meme.3.0.3.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..2f77a359d31e138297f388b2e5ce7ac30f2842e8 --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.3.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:ab26fc5663c31e4b29e09df410ee3ccc7347e315880a7806c64ff8a4853614fa +size 1384749 diff --git a/tools/meme-suite/sources/meme.3.0.4-unpatched.tar.Z b/tools/meme-suite/sources/meme.3.0.4-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..eacf17e9eb8c54a91718708efa12adc6e99024d9 --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.4-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:ddf33d5b0cb2787b1159d27bc563139e2db9e519521578694ce26675e461a4bf +size 1418957 diff --git a/tools/meme-suite/sources/meme.3.0.4.tar.Z b/tools/meme-suite/sources/meme.3.0.4.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..eacf17e9eb8c54a91718708efa12adc6e99024d9 --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.4.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:ddf33d5b0cb2787b1159d27bc563139e2db9e519521578694ce26675e461a4bf +size 1418957 diff --git a/tools/meme-suite/sources/meme.3.0.5-unpatched.tar.Z b/tools/meme-suite/sources/meme.3.0.5-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..814d77bc8331a7959781c8fed1eef87b9f522ea5 --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.5-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:a8081aeeaec56212f0b41847fdb3ecf687f6da09b5eda22fcbe070c5cb4292e3 +size 1349005 diff --git a/tools/meme-suite/sources/meme.3.0.5.tar.Z b/tools/meme-suite/sources/meme.3.0.5.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..814d77bc8331a7959781c8fed1eef87b9f522ea5 --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.5.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:a8081aeeaec56212f0b41847fdb3ecf687f6da09b5eda22fcbe070c5cb4292e3 +size 1349005 diff --git a/tools/meme-suite/sources/meme.3.0.6-unpatched.tar.Z b/tools/meme-suite/sources/meme.3.0.6-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..448d26b237bfd10eb78e13e5c0a2c05b26b8541c --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.6-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:68785e974256961169043b320494790dbf6f323cd29c94e7bfb59a9a986e49b6 +size 1553191 diff --git a/tools/meme-suite/sources/meme.3.0.6.tar.Z b/tools/meme-suite/sources/meme.3.0.6.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..448d26b237bfd10eb78e13e5c0a2c05b26b8541c --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.6.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:68785e974256961169043b320494790dbf6f323cd29c94e7bfb59a9a986e49b6 +size 1553191 diff --git a/tools/meme-suite/sources/meme.3.0.8-unpatched.tar.Z b/tools/meme-suite/sources/meme.3.0.8-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..816e22ef5226643fc05837dbe9914249273e754d --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.8-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:125fbeda5539646a1b60075ffdf84d87e588dc640952c740db0e7c715c26f0b4 +size 1623780 diff --git a/tools/meme-suite/sources/meme.3.0.8.tar.Z b/tools/meme-suite/sources/meme.3.0.8.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..816e22ef5226643fc05837dbe9914249273e754d --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.8.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:125fbeda5539646a1b60075ffdf84d87e588dc640952c740db0e7c715c26f0b4 +size 1623780 diff --git a/tools/meme-suite/sources/meme.3.0.9-unpatched.tar.Z b/tools/meme-suite/sources/meme.3.0.9-unpatched.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..8b704c0811d47b9ba8d0c391edb43e02a63f6358 --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.9-unpatched.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:e995a0d3fe8a0bbd3c6854a695c9d6cf5d441c0b415f737eded50dbd7defa746 +size 1404365 diff --git a/tools/meme-suite/sources/meme.3.0.9.tar.Z b/tools/meme-suite/sources/meme.3.0.9.tar.Z new file mode 100644 index 0000000000000000000000000000000000000000..8b704c0811d47b9ba8d0c391edb43e02a63f6358 --- /dev/null +++ b/tools/meme-suite/sources/meme.3.0.9.tar.Z @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:e995a0d3fe8a0bbd3c6854a695c9d6cf5d441c0b415f737eded50dbd7defa746 +size 1404365 diff --git a/tools/meme-suite/sources/meme_3.5.0.tar.gz b/tools/meme-suite/sources/meme_3.5.0.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..9dca44fb73dce97bb0ebc7d2b8562b00b3b649b2 --- /dev/null +++ b/tools/meme-suite/sources/meme_3.5.0.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:65757dba860fb38775700a35de85dd867c9960ad15f4344f6bf2b7ff79f8afc8 +size 912986 diff --git a/tools/meme-suite/sources/meme_3.5.1-unpatched.tar.gz b/tools/meme-suite/sources/meme_3.5.1-unpatched.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..0a488ffa8aedc3756565eb892d9356a989f633f1 --- /dev/null +++ b/tools/meme-suite/sources/meme_3.5.1-unpatched.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:846b89a443fead62959ce5dc8540993efa53c8e976003a229dae533a4698f340 +size 988389 diff --git a/tools/meme-suite/sources/meme_3.5.1.tar.gz b/tools/meme-suite/sources/meme_3.5.1.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..0a488ffa8aedc3756565eb892d9356a989f633f1 --- /dev/null +++ b/tools/meme-suite/sources/meme_3.5.1.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:846b89a443fead62959ce5dc8540993efa53c8e976003a229dae533a4698f340 +size 988389 diff --git a/tools/meme-suite/sources/meme_3.5.2-unpatched.tar.gz b/tools/meme-suite/sources/meme_3.5.2-unpatched.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..6ffbd1fd859d0e5c10a38413b117bdd04a7781e5 --- /dev/null +++ b/tools/meme-suite/sources/meme_3.5.2-unpatched.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:c60154b07c4f3031c5b8e4eb7e54358d6e08013bd34d5fd43494027d7932f8f2 +size 951911 diff --git a/tools/meme-suite/sources/meme_3.5.2.tar.gz b/tools/meme-suite/sources/meme_3.5.2.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..6ffbd1fd859d0e5c10a38413b117bdd04a7781e5 --- /dev/null +++ b/tools/meme-suite/sources/meme_3.5.2.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:c60154b07c4f3031c5b8e4eb7e54358d6e08013bd34d5fd43494027d7932f8f2 +size 951911 diff --git a/tools/meme-suite/sources/meme_3.5.3-unpatched.tar.gz b/tools/meme-suite/sources/meme_3.5.3-unpatched.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..60adb9113c22ca60e9d94773c84018fe7cc49709 --- /dev/null +++ b/tools/meme-suite/sources/meme_3.5.3-unpatched.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:dc844765fa0c3a96e4c30725f71f6ee58ab7c130cb9c46077fc0b6b70ab2279e +size 974518 diff --git a/tools/meme-suite/sources/meme_3.5.3.tar.gz b/tools/meme-suite/sources/meme_3.5.3.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..60adb9113c22ca60e9d94773c84018fe7cc49709 --- /dev/null +++ b/tools/meme-suite/sources/meme_3.5.3.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:dc844765fa0c3a96e4c30725f71f6ee58ab7c130cb9c46077fc0b6b70ab2279e +size 974518 diff --git a/tools/meme-suite/sources/meme_3.5.4.patch_1 b/tools/meme-suite/sources/meme_3.5.4.patch_1 new file mode 100644 index 0000000000000000000000000000000000000000..b072d7edc527caf862fa46c30a3bb035cb6b8411 --- /dev/null +++ b/tools/meme-suite/sources/meme_3.5.4.patch_1 @@ -0,0 +1,198 @@ +--- meme_3.5.4/website/cgi-bin/process_request.pl 2006-09-21 19:46:29.000000000 +0000 ++++ trunk/website/cgi-bin/process_request.pl 2007-05-30 01:35:02.000000000 +0000 +@@ -1,6 +1,6 @@ + #!@WHICHPERL@ + ## +-## $Id: process_request.pl 1339 2006-09-21 19:46:28Z tbailey $ ++## $Id: process_request.pl 1807 2007-05-30 01:34:31Z tbailey $ + ## + ## $Log: process_request.pl,v $ + ## Revision 1.6.6.1 2006/02/16 23:22:35 nadya +@@ -55,7 +55,8 @@ + $blocks_url = "http://blocks.fhcrc.org/blocks-bin/process_blocks.pl"; + # + # You can change this if you wish to use a different JASPAR server +-$jaspar_root = "http://mordor.cgb.ki.se"; ++#$jaspar_root = "http://mordor.cgb.ki.se"; ++$jaspar_root = "http://asp.ii.uib.no:8090"; + $jaspar_url = "$jaspar_root/cgi-bin/jaspar2005/jaspar_db.pl"; + # + # You can change this if you wish to use a different Meta-MEME server +@@ -221,7 +222,7 @@ + + $fasta = ""; # return value + @lines = split(/\n/, $block); # split block into lines +- for ($i = 1; $i<$#lines; $i++) { ++ for ($i = 2; $i<$#lines; $i++) { + last if $lines[$i] =~ /^\/\//; + @words = split(/\s+/, $lines[$i]); # split line into words + # get sequence line +@@ -239,7 +240,7 @@ + + $fasta = ""; # return value + @lines = split(/\n/, $block); # split block into lines +- for ($i = 1; $i<$#lines; $i++) { ++ for ($i = 2; $i<$#lines; $i++) { + last if $lines[$i] =~ /^\/\//; + @words = split(/\s+/, $lines[$i]); # split line into words + # get id line and sequence line +@@ -311,7 +312,8 @@ + $content = $request->content; + + # fix bug in JASPAR output; add database field to view buttons +- $content =~ s/rm=present/rm=present&db=$sub_db/g; ++ # remove fix: JASPAR fixed the bug ++ # $content =~ s/rm=present/rm=present&db=$sub_db/g; + + # display the page + print $content; +--- meme_3.5.4/src/ureadseq.c 2006-09-21 19:46:28.000000000 +0000 ++++ trunk/src/ureadseq.c 2007-05-18 08:18:05.000000000 +0000 +@@ -1,5 +1,5 @@ + /* +- * $Id: ureadseq.c 1339 2006-09-21 19:46:28Z tbailey $ ++ * $Id: ureadseq.c 1787 2007-05-18 08:17:28Z tbailey $ + * + * $Log$ + * Revision 1.2 2006/03/08 20:50:11 nadya +@@ -206,10 +206,9 @@ + + Local void addinfo(char *s, struct ReadSeqVars *V) + { +- char s2[256], *si; ++ char *si = (char *) malloc((strlen(s) + 40) * sizeof(char)); + boolean saveadd; + +- si = s2; + while (*s == ' ') s++; + sprintf(si, " %d) %s\n", V->nseq, s); + +@@ -217,6 +216,7 @@ + V->addit = true; + V->isseqchar = isAnyChar; + addseq( si, V); ++ free(si); + V->addit = saveadd; + V->isseqchar = isSeqChar; + } +@@ -966,7 +966,6 @@ + } while ((l == 0) && !feof(V->f)); + + if (feof(V->f)) V->err = eNoData; +- + else switch (format_) { + case kPlain : readPlain(V); break; + case kIG : readIG(V); break; +@@ -1181,7 +1180,7 @@ + int nlines= 0, k=0, splen= 0, otherlines= 0, aminolines= 0, dnalines= 0; + char sp[MAXLINE]; + long linestart=0; +- int maxlines2check=500; ++ int maxlines2check=5000; + + #define ReadOneLine(sp) \ + { done |= (feof(fseq)); \ +--- meme_3.5.4/src/include/ureadseq.h 2006-09-21 19:46:28.000000000 +0000 ++++ trunk/src/ureadseq.h 2007-05-18 08:18:05.000000000 +0000 +@@ -1,5 +1,5 @@ + /* +- * $Id: ureadseq.h 1339 2006-09-21 19:46:28Z tbailey $ ++ * $Id: ureadseq.h 1048 2006-07-06 20:07:44Z cegrant $ + * + * $Log$ + * Revision 1.1 2005/07/29 19:12:07 nadya +@@ -15,7 +15,7 @@ + #include "config.h" + #include "macros.h" + +-#define MAXLINE 1024 ++#define MAXLINE 10240 + + typedef char boolean; + #define NEWLINE '\n' +--- meme_3.5.4/src/read_seq_file.c 2006-09-21 19:46:28.000000000 +0000 ++++ ./read_seq_file.c 2007-05-18 06:51:06.000000000 +0000 +@@ -433,6 +433,7 @@ + name[i++] = c; /* non-blank: add to name */ + } + } ++ Resize(name, i+1, char); + name[i] = '\0'; + + /* read in description */ +--- meme_3.5.4/website/html/meme-install.html 2006-09-21 19:46:29.000000000 +0000 ++++ fred/meme-install.html 2007-05-30 02:00:56.000000000 +0000 +@@ -208,42 +208,39 @@ +

Getting and installing the patches

+

The distribution may have patches associated with it. They are available + from http://meme.nbcr.net/downloads/. +-The patch file name is filename.VERSION.patch. In addition, a +-patched file is distributed as well and can be used as a drop-in substitute +-for the original file. The drop-in file is filename.VERSION. +-It is necessary to download only one of the two files depending on the method used for +-patching. All patches for a specific version should be installed. The list +-below provides instructions for installation of availble patches for specific +-version. ++Patch files are located in a directory named ++VERSION.patches, ++for example, meme_3.5.4.patches. ++Patch file have names like: ++VERSION.patch_SERIAL_NO, for example, meme_3.5.4.patch_3. ++

To install a patch, download the patch file from the URL given above. ++Then perform the following commands to install it: ++
$ cp PATCH_FILE VERSION
$ cd VERSION ++
$ patch -p1 < PATCH_FILE ++
$ make install ++
$ make test ++

++

++For example, to install the first patch to version meme_3.5.4, you would perform the following commands: ++
$ cp meme_3.5.4.patch_1 meme_3.5.4 ++
$ cd meme_3.5.4 ++
$ patch -p1 < meme_3.5.4.patch_1 ++
$ make install ++
$ make test ++

++

++You must install all of the patches for a specific version in serial ++number order. For example, if you wish to install patch number 3, ++you must first have installed patches number 1 and 2 for that version. ++This is easy to do. Just download all the patches for your current ++version, copy them to your current versions's directory, and then ++install them in order by repeating the patch, ++command above, with each patch file. You only need to run the ++install and ++make test commands once, after ++the last patch command. +

+ +-
+- +- +- +- +- +- +- +- +- +- +- +-
VersionPatch listInstallation
3.5.0mast-client.txt +-
    +-
  1. If downloaded a patch file mast-client.txt.3.5.0.patch: +-
    # cp mast-client.txt.3.5.0 meme_3.5.0/scripts/ +-
    # cd meme_3.5.0/scripts/ +-
    # patch -p0 < mast-client.txt.3.5.0.patch +-
    +-
  2. +-
  3. If downloaded a patched file mast-client.txt.3.5.0: +-
    # cp mast-client.txt.3.5.0 meme_3.5.0/scripts/mast-client.txt +-
  4. +-
+-
+-
+- +

+

[ Top ]

+ diff --git a/tools/meme-suite/sources/meme_3.5.4.patch_2 b/tools/meme-suite/sources/meme_3.5.4.patch_2 new file mode 100644 index 0000000000000000000000000000000000000000..cc07a98307f2712124e52fbacdc5c4f726adb58b --- /dev/null +++ b/tools/meme-suite/sources/meme_3.5.4.patch_2 @@ -0,0 +1,70 @@ +--- meme_3.5.4/website/cgi-bin/meme.pl 2006-09-21 19:46:29.000000000 +0000 ++++ trunk/website/cgi-bin/meme.pl 2007-09-10 00:28:33.000000000 +0000 +@@ -1,6 +1,6 @@ + #!@WHICHPERL@ + ## +-## $Id: meme.pl 1339 2006-09-21 19:46:28Z tbailey $ ++## $Id: meme.pl 2054 2007-09-10 00:27:42Z tbailey $ + ## + ## $Log$ + ## Revision 1.12 2006/03/07 23:30:19 nadya +@@ -467,21 +467,21 @@ + + # check against allowed dna letters + $x = $_; +- $x =~ tr/ABCDGHKMNRSTUVWY//cd; ++ $x =~ tr/ABCDGHKMNRSTUVWY*-//cd; + $new = length $x; + if ($old == $new) { + "dna"; + } else { + # check against allowed protein letters + $x = $_; +- $x =~ tr/ABCDEFGHIKLMNPQRSTUVWXYZ//cd; ++ $x =~ tr/ABCDEFGHIKLMNPQRSTUVWXYZ*-//cd; + $new = length $x; + if ($old == $new) { + "protein"; + } else { + # get the unknown letters + $x = $_; +- $x =~ tr/ABCDEFGHIKLMNPQRSTUVWXYZ//d; ++ $x =~ tr/ABCDEFGHIKLMNPQRSTUVWXYZ*-//d; + &whine(" + Your sequences contained the following unrecognized letters: $x. +
+--- meme_3.5.4/website/cgi-bin/mast.pl 2006-09-21 19:46:29.000000000 +0000 ++++ trunk/website/cgi-bin/mast.pl 2007-09-10 00:38:14.000000000 +0000 +@@ -1,6 +1,6 @@ + #!@WHICHPERL@ + ## +-## $Id: mast.pl 1339 2006-09-21 19:46:28Z tbailey $ ++## $Id: mast.pl 2055 2007-09-10 00:37:11Z tbailey $ + ## + ## $Log$ + ## Revision 1.8 2006/03/07 23:30:19 nadya +@@ -479,21 +479,21 @@ + + # check against allowed nucleotide letters + $x = $_; +- $x =~ tr/ABCDGHKMNRSTUVWY//cd; ++ $x =~ tr/ABCDGHKMNRSTUVWY*-//cd; + $new = length $x; + if ($old == $new) { + return("DNA"); + } else { + # check against allowed protein letters + $x = $_; +- $x =~ tr/ABCDEFGHIKLMNPQRSTUVWXYZ//cd; ++ $x =~ tr/ABCDEFGHIKLMNPQRSTUVWXYZ*-//cd; + $new = length $x; + if ($old == $new) { + return("PROTEIN"); + } else { + # get the unknown letters + $x = $_; +- $x =~ tr/ABCDEFGHIKLMNPQRSTUVWXYZ//d; ++ $x =~ tr/ABCDEFGHIKLMNPQRSTUVWXYZ*-//d; + &whine(" + Your sequences contained the following unrecognized letters: $x. +
diff --git a/tools/meme-suite/sources/meme_3.5.4.tar.gz b/tools/meme-suite/sources/meme_3.5.4.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..01ae8ca904c6c7d980d9abb589d084ba52edee95 --- /dev/null +++ b/tools/meme-suite/sources/meme_3.5.4.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:b753ee276bc5eafeab8ff310e6d938977da11f466d26cfd3ae9c0f0a7a91de86 +size 1045501 diff --git a/tools/meme-suite/sources/meme_3.5.7-unpatched.tar.gz b/tools/meme-suite/sources/meme_3.5.7-unpatched.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..df0422f32af5e1e0a0903156a91ad5648f918c2e --- /dev/null +++ b/tools/meme-suite/sources/meme_3.5.7-unpatched.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:b5d84d969f69dbe02f2636e2161c53212f7c9a5b141ae2ed759f99a322f221a9 +size 1101383 diff --git a/tools/meme-suite/sources/meme_3.5.7.tar.gz b/tools/meme-suite/sources/meme_3.5.7.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..df0422f32af5e1e0a0903156a91ad5648f918c2e --- /dev/null +++ b/tools/meme-suite/sources/meme_3.5.7.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:b5d84d969f69dbe02f2636e2161c53212f7c9a5b141ae2ed759f99a322f221a9 +size 1101383 diff --git a/tools/meme-suite/sources/meme_4.0.0-unpatched.tar.gz b/tools/meme-suite/sources/meme_4.0.0-unpatched.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..40eeda0f11bea77af9438b00e43becd1838704ba --- /dev/null +++ b/tools/meme-suite/sources/meme_4.0.0-unpatched.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:154ec37a7bee4f446cfba213c059893a4156538e3c8955bf52f0a175181006bc +size 4344008 diff --git a/tools/meme-suite/sources/meme_4.0.0.tar.gz b/tools/meme-suite/sources/meme_4.0.0.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..40eeda0f11bea77af9438b00e43becd1838704ba --- /dev/null +++ b/tools/meme-suite/sources/meme_4.0.0.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:154ec37a7bee4f446cfba213c059893a4156538e3c8955bf52f0a175181006bc +size 4344008 diff --git a/tools/meme-suite/sources/meme_4.1.0-unpatched.tar.gz b/tools/meme-suite/sources/meme_4.1.0-unpatched.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..7554342689693ec6bb38fa006bfd0a747c9e9a32 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.1.0-unpatched.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:b80a380353144c4ea434583b9cece5f050e798c5bbe1c13f20257e53fb0b9514 +size 4490664 diff --git a/tools/meme-suite/sources/meme_4.1.0.tar.gz b/tools/meme-suite/sources/meme_4.1.0.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..7554342689693ec6bb38fa006bfd0a747c9e9a32 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.1.0.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:b80a380353144c4ea434583b9cece5f050e798c5bbe1c13f20257e53fb0b9514 +size 4490664 diff --git a/tools/meme-suite/sources/meme_4.1.1-unpatched.tar.gz b/tools/meme-suite/sources/meme_4.1.1-unpatched.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..4dcd42dd04971b5f73222b8644ebf9fb1d8239f6 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.1.1-unpatched.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:681ecf3fe56cf5822365d3abd9727ae3c5503d49f8817bb0fe328d9f07b91011 +size 4662066 diff --git a/tools/meme-suite/sources/meme_4.1.1.tar.gz b/tools/meme-suite/sources/meme_4.1.1.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..4dcd42dd04971b5f73222b8644ebf9fb1d8239f6 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.1.1.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:681ecf3fe56cf5822365d3abd9727ae3c5503d49f8817bb0fe328d9f07b91011 +size 4662066 diff --git a/tools/meme-suite/sources/meme_4.10.0.tar.gz b/tools/meme-suite/sources/meme_4.10.0.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..5ec88f66825ace4d52081c0f553296d85751f01d --- /dev/null +++ b/tools/meme-suite/sources/meme_4.10.0.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:f5e4d6c898f7a0002b679020c912ef41c3ae3985faf9a88631f8aab506ad952e +size 16387193 diff --git a/tools/meme-suite/sources/meme_4.10.0_4.tar.gz b/tools/meme-suite/sources/meme_4.10.0_4.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..0301a31a24bacc29a5e6cfa91417fe6df68e0e22 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.10.0_4.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:2e0266102f5a510ed75b9275e8c1d138891bb8012ee4261a7f9f5c011c315a50 +size 16573961 diff --git a/tools/meme-suite/sources/meme_4.10.1.tar.gz b/tools/meme-suite/sources/meme_4.10.1.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..0a04af8a1752dc5025373bbe33575f61ca2a4cc3 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.10.1.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:642838908e9f26eabea04c8fea2f9f2f4d24def5603436d3db1e96c954fc92eb +size 16336694 diff --git a/tools/meme-suite/sources/meme_4.10.1_4.tar.gz b/tools/meme-suite/sources/meme_4.10.1_4.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..c7815b58d724df620ba0f095125005621a6ce684 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.10.1_4.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:cc17de16cce0f8ba6bdf4b57a9ea47b2b1130ede7ce30882d077b24ef0f7e1cd +size 16472636 diff --git a/tools/meme-suite/sources/meme_4.10.2.tar.gz b/tools/meme-suite/sources/meme_4.10.2.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..d8242a360086006320c71c3834ea3dec01c8b474 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.10.2.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:f280270d9ff95a0f863aac4362d35d4183e2df62dc2a090a5d704ab6a231193c +size 16156712 diff --git a/tools/meme-suite/sources/meme_4.11.0.tar.gz b/tools/meme-suite/sources/meme_4.11.0.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..9052c56e6793c00601b3be19866b2b4240325808 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.11.0.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:5dc4841f4816ef25bdb4bd088c76606c1b42726e7d65cc417f0f8c49fe7e237f +size 14378600 diff --git a/tools/meme-suite/sources/meme_4.11.1.tar.gz b/tools/meme-suite/sources/meme_4.11.1.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..c27fd416f59c4bb8b0e82673522c8317368acd7c --- /dev/null +++ b/tools/meme-suite/sources/meme_4.11.1.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:62602045b25c8422c59f441025b710629c2fbb602bf618fffeeab5654f521088 +size 17752135 diff --git a/tools/meme-suite/sources/meme_4.11.2.tar.gz b/tools/meme-suite/sources/meme_4.11.2.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..11be9a50e5976ff26b4b7d60f02b749a8dc59171 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.11.2.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:6e3ff843366588ea13fa8060306be9e2c144521912dfb268f03638003bcdd581 +size 18004930 diff --git a/tools/meme-suite/sources/meme_4.11.2_2.tar.gz b/tools/meme-suite/sources/meme_4.11.2_2.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..e619806e104a4c7a76622b51572ad3a3dbd5ca50 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.11.2_2.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:377238c2a9dda64e01ffae8ecdbc1492c100df9b0f84132d50c1cf2f68921b22 +size 18003628 diff --git a/tools/meme-suite/sources/meme_4.11.3.tar.gz b/tools/meme-suite/sources/meme_4.11.3.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..7f16199da0a7a9437ea32760cff112939d31511f --- /dev/null +++ b/tools/meme-suite/sources/meme_4.11.3.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:3a6875ce940113b56c10fdd664f25fd40b83e2f44b8acb3b29c3b628ebf60322 +size 19130156 diff --git a/tools/meme-suite/sources/meme_4.11.3_1.tar.gz b/tools/meme-suite/sources/meme_4.11.3_1.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..d00a6b492e9cc535a27f832052c7dabe6ade389f --- /dev/null +++ b/tools/meme-suite/sources/meme_4.11.3_1.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:eca526fa1c06f07ed255bbb111091e0f02d74eae97ea44cec06a851f1f27ae21 +size 19155825 diff --git a/tools/meme-suite/sources/meme_4.11.4.tar.gz b/tools/meme-suite/sources/meme_4.11.4.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..04d5a616e5a13d24e988826340cb3e4ea402f220 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.11.4.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:3e869ff57e327a9c8615dbef784e3f1095f7f7a0120cecd55efe10c3f2ee8eb3 +size 19499190 diff --git a/tools/meme-suite/sources/meme_4.11.4_1.tar.gz b/tools/meme-suite/sources/meme_4.11.4_1.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..0493592923c2c31db82a7f4c566cc4552e8dd27f --- /dev/null +++ b/tools/meme-suite/sources/meme_4.11.4_1.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:418c4f4c3a56a852ee277445f0c16157e02fd6ebb0e01b6a7d7190cbce338ddb +size 20384384 diff --git a/tools/meme-suite/sources/meme_4.12.0.tar.gz b/tools/meme-suite/sources/meme_4.12.0.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..478451813c19a0a8424d31222c578f569571bf94 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.12.0.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:49ff80f842b59d328588acfcd1d15bf94c55fed661d22b0f95f37430cc363a06 +size 21134349 diff --git a/tools/meme-suite/sources/meme_4.2.0-unpatched.tar.gz b/tools/meme-suite/sources/meme_4.2.0-unpatched.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..f5a2f265b7f2f8ee0049d0b55456cbe83f6acc45 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.2.0-unpatched.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:9a74d976288f6b0a0f49bd126d14efbdc5be60812d53d1ec88f506f3b16d8cff +size 4581167 diff --git a/tools/meme-suite/sources/meme_4.2.0.tar.gz b/tools/meme-suite/sources/meme_4.2.0.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..f5a2f265b7f2f8ee0049d0b55456cbe83f6acc45 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.2.0.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:9a74d976288f6b0a0f49bd126d14efbdc5be60812d53d1ec88f506f3b16d8cff +size 4581167 diff --git a/tools/meme-suite/sources/meme_4.3.0.tar.gz b/tools/meme-suite/sources/meme_4.3.0.tar.gz new file mode 100644 index 0000000000000000000000000000000000000000..516f7dc999184f4a5d7563458c2e815ba5d04701 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.3.0.tar.gz @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:6a6a04f168f8ac6dbba022461701e0327bc8ececcb375b2dd387a084cd8ba17b +size 4658395 diff --git a/tools/meme-suite/sources/meme_4.4.0.patch_1 b/tools/meme-suite/sources/meme_4.4.0.patch_1 new file mode 100644 index 0000000000000000000000000000000000000000..07609dd27681398766f9be049b5cf2669532906d --- /dev/null +++ b/tools/meme-suite/sources/meme_4.4.0.patch_1 @@ -0,0 +1,660 @@ +Index: scripts/ama-qvalues.txt +=================================================================== +--- scripts/ama-qvalues.txt (revision 0) ++++ scripts/ama-qvalues.txt (revision 4529) +@@ -0,0 +1,128 @@ ++#!@WHICHPERL@ ++# AUTHOR: Timothy L. Bailey ++# CREATE DATE: May 7, 2010 ++#use strict; ++use File::Basename; ++ ++$PGM = $0; # name of program ++$PGM =~ s#.*/##; # remove part up to last slash ++#@args = @ARGV; # arguments to program ++$| = 1; # flush after all prints ++$SIG{'INT'} = \&cleanup; # interrupt handler ++# Note: so that interrupts work, always use for system calls: ++# if ($status = system("$command")) {&cleanup($status)} ++ ++# requires ++push(@INC, split(":", $ENV{'PATH'})); # look in entire path ++ ++# defaults ++my $seed = 1; ++my $bootstraps = 1000; ++ ++my $usage = <] seed for random numbers; default: $seed ++ [-bootstraps ] number of bootstraps to perform ++ while computing pi_0; default: 1000 ++ ++ Read an AMA output file and output each sequence name, p-value ++ and q-value. At the end of file, the value of pi_0 (number of ++ sequences not showing significant binding to motif) is shown, ++ unless there are fewer than 100 p-values in the input. ++ ++ Reads standard input. ++ Writes standard output. ++ ++ Copyright ++ (2010) The University of Queensland ++ All Rights Reserved. ++ Author: Timothy L. Bailey ++USAGE ++ ++$nargs = 0; # number of required args ++if ($#ARGV+1 < $nargs) { &print_usage("$usage", 1); } ++ ++# get input arguments ++while ($#ARGV >= 0) { ++ $_ = shift; ++ if ($_ eq "-h") { # help ++ &print_usage("$usage", 0); ++ } elsif ($_ eq "-seed") { ++ $seed = shift; ++ } elsif ($_ eq "-bootstraps") { ++ $bootstraps = shift; ++ } else { ++ &print_usage("$usage", 1); ++ } ++} ++ ++# open a pipe to the qvalue program, reading standard input ++$pzfile = "$PGM.$$.pzfile.tmp"; ++open(QVALUE, "|qvalue --append --column 2 --pi-zero-file $pzfile --seed $seed --bootstraps $bootstraps -") || ++ die("Can't open qvalue program.\n"); ++ ++# compute the qvalues ++print "# sequence_name\t\t\tp-value\t\tq-value\n"; ++my($pvalue, @w, $name); ++my $npvalues = 0; ++while () { ++ if (/pvalue="([^"]*)"/) { ++ $pvalue = $1; ++ /name="([^"]*)"/; ++ $name = $1; ++ print(QVALUE "$name\t$pvalue\n"); ++ $npvalues++; ++ } ++}; ++close(QVALUE); ++ ++printf("# Fraction of sequences not showing significant binding: "); ++system("cat $pzfile") if ($npvalues >= 100); ++unlink $pzfile; ++ ++$status = 1; ++ ++# cleanup files ++&cleanup($status, ""); ++ ++################################################################################ ++# Subroutines # ++################################################################################ ++ ++################################################################################ ++# ++# print_usage ++# ++# Print the usage message and exit. ++# ++################################################################################ ++sub print_usage { ++ my($usage, $status) = @_; ++ ++ if (-c STDOUT) { # standard output is a terminal ++ open(C, "| more"); ++ print C $usage; ++ close C; ++ } else { # standard output not a terminal ++ print STDERR $usage; ++ } ++ ++ exit $status; ++} ++ ++################################################################################ ++# cleanup ++# ++# cleanup stuff ++# ++################################################################################ ++sub cleanup { ++ my($status, $msg) = @_; ++ if ($status eq "INT") { ++ exit(1); ++ } else { ++ if ($status && "$msg") {print STDERR "$msg: $status\n";} ++ } ++} +Index: scripts/fasta-subsample.txt +=================================================================== +--- scripts/fasta-subsample.txt (revision 0) ++++ scripts/fasta-subsample.txt (revision 4529) +@@ -0,0 +1,142 @@ ++#!/usr/bin/perl ++##!@WHICHPERL@ ++ ++my $pgm = $0; # name of program ++$pgm =~ s#.*/##; # remove part up to last slash ++my $seed = 1; # random number seed ++my $line_size = 50; # size of lines to print ++my $off = 1; # first position of sequence to print ++my $len = -1; # maximum length of sequence to print ++my $rest = ""; # file to receive remainder of seqs ++ ++$usage = < [-seed ] [-rest ] ++ [-off ] [-len ] ++ ++ name of FASTA sequence file ++ number of sequences to output ++ [-seed ] random number seed; default: $seed ++ [-rest ] name of file to receive the FASTA ++ sequences not being output; default: none ++ [-off ] print starting at position in each ++ sequence; default: $off ++ [-len ] print up to characters for each ++ sequence; default: print entire sequence ++ ++ Output a random subsample of size of the sequences in ++ a FASTA sequence file. The seed of the random generator can be ++ changed using -seed, otherwise the same subset of sequences will ++ always be output. If requested, the remaining sequences will ++ be output to a file named , which is useful for ++ cross-validation. ++ ++ You can also choose to only output portions of each sequence ++ using the -off and -len switches. ++ ++ Writes to standard output. ++USAGE ++ ++if ($#ARGV+1 < 2) { # wrong number of arguments ++ die $usage; ++} ++ ++# get input arguments ++my $fasta = shift; # name of fasta file ++my $n = shift; # size of subsample ++while ($#ARGV >= 0) { ++ $_ = shift; ++ if ($_ eq "-seed") { # random seed ++ $seed = shift; ++ } elsif ($_ eq "-rest") { # rest file name ++ $rest = shift; ++ } elsif ($_ eq "-off") { # offset ++ $off = shift; ++ } elsif ($_ eq "-len") { # maximum length ++ $len = shift; ++ } elsif ($_ eq "-rest") { # file for remainder ++ $rest = shift; ++ } else { ++ die $usage; ++ } ++} ++ ++# read in FASTA file and make index ++open(FASTA, "<$fasta") || die "Couldn't open file `$fasta'.\n"; ++my $byte = 0; ++my %index; # ID-to-start index ++my $id; # sequence ID ++my @rest; # dummy ++my @id_list; # list of all IDs ++while () { ++ if (/^>/) { ++ ($id, @rest) = split; ++ $index{$id} = $byte; # start of sequence record ++ push @id_list, $id; ++ } ++ $byte += length; ++} # read FASTA file ++ ++# check that there are enough IDs ++my $nseqs = @id_list; ++die ("Not enough sequences ($nseqs); $n requested.\n") if ($nseqs < $n); ++ ++# shuffle the list of IDs ++srand($seed); ++shuffle(\@id_list); ++#print join " ", @id_list, "\n"; ++ ++# output the requested number of FASTA sequences to STDOUT ++foreach $id (@id_list[0..$n-1]) { ++ print_fasta_seq_portion(*FASTA, *STDOUT, $id, $off, $len, \%index); ++} # id ++ ++# output the remainder of the sequences if requested ++# to the "rest" file ++if ($rest) { ++ open(REST, ">$rest") || die("Can't open file `$rest'.\n"); ++ foreach $id (@id_list[$n..$nseqs-1]) { ++ print_fasta_seq_portion(*FASTA, *REST, $id, $off, $len, \%index); ++ } ++} ++ ++################################################################################ ++# print (a portion of) a FASTA sequence ++# Assumes FASTA file is open and the index contains ++# the file byte offset for a given ID. ++sub print_fasta_seq_portion { ++ my ($fasta, $output, $id, $off, $len, $index) = @_; ++ ++ my $addr = $index{$id}; # address of sequence ++ die "Can't find target $id.\n" if ($addr eq undef); ++ seek($fasta, $addr, 0); # move to start of target ++ $_ = <$fasta>; ++ print $output $_; # print ID for this sequence ++ my $seq = ""; ++ # read in sequence lines for this sequence ++ while (<$fasta>) { # read sequence lines ++ if (/^>/) {last} # start of next sequence ++ chop; ++ $seq .= $_; ++ } ++ # print sequence in lines of length $line_size ++ # get portion of sequence to print if -off and/or -len given ++ if ($off != 1 || $len != -1) { ++ if ($len == -1) { ++ $seq = substr($seq, $off-1); ++ } else { ++ $seq = substr($seq, $off-1, $len); ++ } ++ } ++ for ($i=0; $i $@ ++ama-qvalues: ama-qvalues.txt Makefile ++ $(SED) $(SEDSPEC) $< > $@ + cat_max: cat_max.txt Makefile + $(SED) $(SEDSPEC) $< > $@ + chen2meme: chen2meme.pl Makefile +@@ -134,6 +140,8 @@ + $(SED) $(SEDSPEC) $< > $@ + fasta-shuffle-letters: fasta-shuffle-letters.txt Makefile + $(SED) $(SEDSPEC) $< > $@ ++fasta-subsample: fasta-subsample.txt Makefile ++ $(SED) $(SEDSPEC) $< > $@ + fasta-unique-names: fasta-unique-names.txt Makefile + $(SED) $(SEDSPEC) $< > $@ + get_db_csv: get_db_csv.txt Makefile + +Index: doc/release-notes.html +=================================================================== +--- doc/release-notes.html (revision 4519) ++++ doc/release-notes.html (working copy) +@@ -28,6 +28,29 @@ +

MEME Suite System Release Notes

+
+

++ MEME version NEXT ++

++
    ++
  • ++ fasta-subsample --
    ++ New script for extracting a random sampling of the sequences ++ in a FASTA file. This is especially useful for ChIP-seq ++ peak datasets to be input to MEME. Using this script, a ++ FASTA file containing a subset of the ChIP-seq peak sequences ++ (or any other FASTA file) can be created. The total ++ number of sequences should be less than 1000 (peferably less ++ than 500), and the total sequence length should be less ++ than a few hundred thousand. MEME typically takes about 20 minutes ++ per motif with files of 100,000 characters (DNA, both strands, ZOOPS model), ++ and scales quadratically in the total sequence length (so a file of ++ 200,000 characters will take four times as long.) ++ This new script can also output the remaining sequences (in a sepqrate ++ file) for use in cross-validation. ++
  • ++
++ ++
++

+ MEME version 4.4.0 -- April 23, 2010 +

+
    +Index: doc/mast.html +=================================================================== +--- doc/mast.html (revision 4529) ++++ doc/mast.html (working copy) +@@ -87,6 +87,7 @@ + + [-minseqs <ms>]lower bound on number of sequences in db + [-nostatus]do not print progress report ++ [-notext]do not create text output + [-nohtml]do not create html output + +

    +@@ -113,7 +114,8 @@ + for human viewing. The text format is available for backwards compatibility + though due to design decisions made to optimise the xml for html generation + the output for separate scoring mode is not identical and some options were +- removed. ++ removed. The text format will be unsupported in future releases and so we ++ recommend you migrate any programs reading mast output to the xml format. +

    +

    + MAST outputs three things: +Index: doc/mast2txt.html +=================================================================== +--- doc/mast2txt.html (revision 4529) ++++ doc/mast2txt.html (working copy) +@@ -16,7 +16,8 @@ +

    Usage: mast2txt <mast xml file> <output text file>

    +

    Description:

    +

    +-Convert a mast xml file into a mast text file. ++Provides backwards compatibility by converting a mast xml file into a mast text file. ++Warning: Mast text format will not be supported in the next release. +

    +

    Input:

    +

    <mast xml file> - An xml file created by the mast program.

    +Index: src/mast2txt.c +=================================================================== +--- src/mast2txt.c (revision 4529) ++++ src/mast2txt.c (working copy) +@@ -15,7 +15,7 @@ + #include "utils.h" + + /*debugging macros {{{*/ +-VERBOSE_T verbosity = HIGH_VERBOSE; ++VERBOSE_T verbosity = QUIET_VERBOSE; + BOOLEAN_T status = TRUE; + time_t status_last = 0; //last time a status message was output + time_t status_delay = 5; //minimum time between status messages +@@ -2234,7 +2234,7 @@ + + + int main(int argc, char **argv) { +- ++ int result; + //Using SAX scan through the xml document + //load the model parameters, + //load the alphabet +@@ -2244,11 +2244,12 @@ + //keep a ordered tree of scores which haven't been inserted yet and write out the data to file + //and keep a pointer to it, + if (argc == 3) { +- parse_xml_file(argv[1], argv[2]); ++ result = parse_xml_file(argv[1], argv[2]); + } else { + fprintf(stdout, "mast2txt \n"); ++ result = 1; + } + +- return 0; ++ return result; + } + /*}}}*/ +Index: src/mast.c +=================================================================== +--- src/mast.c (revision 4529) ++++ src/mast.c (working copy) +@@ -98,6 +98,8 @@ + static const char *XML_FILENAME = "mast.xml"; + static const char *HTML_STYLESHEET = "mast-to-html.xsl"; + static const char *HTML_FILENAME = "mast.html"; ++static const char *TXT_FILENAME = "mast.txt"; ++static const char *MAST2TXT_FILENAME = "mast2txt"; + + /* MAST DTD */ + /*{{{*/ +@@ -1692,6 +1694,7 @@ + BOOLEAN lump = FALSE; /* combine spacings into one p-value */ + BOOLEAN status = TRUE; /* show progress */ + BOOLEAN html = TRUE; /* generate html output */ ++ BOOLEAN mast2txt = TRUE; /* run mast2txt on the xml output */ + STYPE stype = Combine; /* handling of DNA strands */ + BOOLEAN translate_dna = FALSE; /* don't translate DNA sequences */ + BOOLEAN best_motifs = FALSE; /* only print best motif in diagrams */ +@@ -1803,6 +1806,7 @@ + DATA_OPTN(1, minseqs, , \tlower bound on number of sequences in db, + min_seqs = atoi(_OPTION_)); + FLAG_OPTN(1, nostatus, \tdo not print progress report, status = FALSE); ++ FLAG_OPTN(1, notext, \tdo not generate text output, mast2txt = FALSE); + FLAG_OPTN(1, nohtml, \tdo not generate html output, html = FALSE); + // DEBUG AND EXPERIMENTAL OPTIONS + FLAG_OPTN(EXP, shuffle, \tshuffle columns of motifs, shuffle = TRUE); +@@ -2004,6 +2008,27 @@ + // finish xml output + if (mast_out != stdout) fclose(mast_out); + ++ // finish status report ++ if (status) fprintf(stderr, "\n"); ++ ++ //cleanup ++ for (i = 0; i < arraylst_size(sequences); ++i) { ++ SSEQ_T *sseq = (SSEQ_T*)arraylst_get(i, sequences); ++ sseq_destroy(sseq, nmotifs); ++ } ++ arraylst_destroy(sequences); ++ for (i = 0; i < arraylst_size(databases); ++i) { ++ DATABASE_T *db = (DATABASE_T*)arraylst_get(i, databases); ++ myfree(db->source); ++ myfree(db->name); ++ myfree(db->link); ++ if (db->save) fclose(db->save); ++ if (db->file != stdin) fclose(db->file); ++ myfree(db); ++ } ++ arraylst_destroy(databases); ++ ++ //output alternate formats + if (xml_path && html) { + char *stylesheet_path, *html_path; + stylesheet_path = make_path_to_file(ETC_DIR, HTML_STYLESHEET); +@@ -2022,28 +2047,30 @@ + myfree(stylesheet_path); + myfree(html_path); + } ++ if (xml_path && mast2txt) { ++ char *mast2txt_path, *txt_path; ++ mast2txt_path = make_path_to_file(BIN_DIR, MAST2TXT_FILENAME); ++ txt_path = make_path_to_file(out_dir, TXT_FILENAME); ++ if (file_exists(mast2txt_path)) { ++ char *cmd; ++ int len; ++ len = strlen(mast2txt_path) + strlen(xml_path) + strlen(txt_path) + 9; ++ cmd = mm_malloc(sizeof(char) * len); ++ snprintf(cmd, len, "\"%s\" \"%s\" \"%s\"", mast2txt_path, xml_path, txt_path); ++ if (system(cmd)) { ++ fprintf(stderr, "Warning: program mast2txt failed to run.\n"); ++ } ++ myfree(cmd); ++ } else { ++ if (verbosity >= NORMAL_VERBOSE) ++ fprintf(stderr, "Warning: could not find the program \"%s\" required for transformation of xml to txt. Have you installed %s correctly?\n", ++ mast2txt_path, program_name); ++ } ++ myfree(mast2txt_path); ++ myfree(txt_path); ++ } + +- // finish status report +- if (status) fprintf(stderr, "\n"); +- +- //cleanup +- for (i = 0; i < arraylst_size(sequences); ++i) { +- SSEQ_T *sseq = (SSEQ_T*)arraylst_get(i, sequences); +- sseq_destroy(sseq, nmotifs); +- } +- arraylst_destroy(sequences); +- for (i = 0; i < arraylst_size(databases); ++i) { +- DATABASE_T *db = (DATABASE_T*)arraylst_get(i, databases); +- myfree(db->source); +- myfree(db->name); +- myfree(db->link); +- if (db->save) fclose(db->save); +- if (db->file != stdin) fclose(db->file); +- myfree(db); +- } +- arraylst_destroy(databases); + myfree(xml_path); +- + return 0; + } /* main */ + +Index: etc/mast.sh.in +=================================================================== +--- etc/mast.sh.in (revision 4529) ++++ etc/mast.sh.in (working copy) +@@ -86,6 +86,7 @@ + echo "

    Results


    " >> index.html +Index: etc/mast-to-html.xsl +=================================================================== +--- etc/mast-to-html.xsl (revision 4529) ++++ etc/mast-to-html.xsl (working copy) +@@ -126,6 +126,9 @@ + calculate_wrap(); + if (previous_wrap != wrap) { + for (var seqid in loadedSequences) { ++ //exclude inherited properties and undefined properties ++ if (!loadedSequences.hasOwnProperty(seqid) || loadedSequences[seqid] === undefined) continue; ++ + var sequence = loadedSequences[seqid]; + var annobox = document.getElementById(seqid + "_annotation"); + var leftPos = parseInt(document.getElementById(seqid + "_dnl").firstChild.firstChild.nodeValue); +@@ -871,6 +874,9 @@ + var mysegs = document.getElementById(seqid + "_segs"); + var lines = mysegs.value.split(/\n/); + for (var i in lines) { ++ //exclude inherited properties and undefined properties ++ if (!lines.hasOwnProperty(i) || lines[i] === undefined) continue; ++ + var line = lines[i]; + var chunks = line.split(/\t/); + if (chunks.length != 2) continue; +@@ -881,6 +887,9 @@ + var myhits = document.getElementById(seqid + "_hits"); + lines = myhits.value.split(/\n/); + for (var i in lines) { ++ //exclude inherited properties and undefined properties ++ if (!lines.hasOwnProperty(i) || lines[i] === undefined) continue; ++ + var line = lines[i]; + var chunks = line.split(/\t/); + if (chunks.length != 6) continue; +Index: etc/meme-mast.sh.in +=================================================================== +--- etc/meme-mast.sh.in (revision 4529) ++++ etc/meme-mast.sh.in (working copy) +@@ -89,6 +89,7 @@ + if (-s meme.xsl) echo "
  • XSLT Stylsheet for converting MEME XML to HTML.
  • " >> index.html + if (-s mast.html) echo "
  • MAST output as HTML
  • " >> index.html + if (-s mast.xml) echo "
  • MAST output as XML
  • " >> index.html ++ if (-s mast.txt) echo "
  • MAST output as txt (format being phased out in next release)
  • " >> index.html + if (-s sequences) echo "
  • input sequences
  • " >> index.html + if (-s uploaded_bfile) echo "
  • background Markov model
  • " >> index.html + if (-s negfile) echo "
  • Negative sequences
  • " >> index.html +Index: etc/logo.js +=================================================================== +--- etc/logo.js (revision 4529) ++++ etc/logo.js (working copy) +@@ -227,6 +227,9 @@ + var line_num = 0; + var col_num = 0; + for (line_index in lines) { ++ //exclude inherited properties and undefined properties ++ if (!lines.hasOwnProperty(line_index) || lines[line_index] === undefined) continue; ++ + var line = lines[line_index]; + if (is_empty.test(line)) { + continue; +@@ -248,6 +251,9 @@ + col_num = 0; + var parts = line.split(/\s+/); + for (part_index in parts) { ++ //exclude inherited properties and undefined properties ++ if (!parts.hasOwnProperty(part_index) || parts[part_index] === undefined) continue; ++ + var prob = parts[part_index]; + if (!is_prob.test(prob)) continue; + if (col_num >= this.alph_length) { +@@ -368,6 +374,9 @@ + function Pspm_to_string() { + var str = ""; + for (row_index in this.pspm) { ++ //exclude inherited properties and undefined properties ++ if (!this.pspm.hasOwnProperty(row_index) || this.pspm[row_index] === undefined) continue; ++ + var row = this.pspm[row_index]; + str += row.join("\t") + "\n"; + } +@@ -618,6 +627,9 @@ + var lpad = 2; + var pos = metrics.stack_height; + for (var i in symbols) { ++ //exclude inherited properties and undefined properties ++ if (!symbols.hasOwnProperty(i) || symbols[i] === undefined) continue; ++ + var sym = symbols[i]; + var sym_height = metrics.stack_height*sym.get_scale(); + var letter = metrics.get_letter_metrics(sym.get_symbol()); diff --git a/tools/meme-suite/sources/meme_4.4.0.patch_2 b/tools/meme-suite/sources/meme_4.4.0.patch_2 new file mode 100644 index 0000000000000000000000000000000000000000..9e629235d54be72b4b590b78386a21f00565d9e5 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.4.0.patch_2 @@ -0,0 +1,143 @@ +Index: etc/mast-to-html.xsl +=================================================================== +--- etc/mast-to-html.xsl (revision 4530) ++++ etc/mast-to-html.xsl (working copy) +@@ -395,6 +395,12 @@ + seqDispSeq.style.height = "1.5em"; + return seqDispSeq; + } ++ function annobox_boundary() { ++ var seqDispSeq = document.createElement('div'); ++ seqDispSeq.className = "sequence"; ++ seqDispSeq.style.height = "1.5em"; ++ return seqDispSeq; ++ } + + function create_seq_handle(container, seqid, isleft, pos, max) { + var vbar = document.createElement('div'); +@@ -557,7 +563,7 @@ + function set_data(start, width, show_rc_only, data, annobox) { + var child = annobox.firstChild; + var line_width = Math.min(wrap, width); +- var num_per_wrap = 54; ++ var num_per_wrap = 65; + var end = start + width; + for (var i = start; i < end; i += line_width, line_width = Math.min(wrap, end - i)) { + for (var j = 0; j < num_per_wrap; ++j) { +@@ -575,13 +581,23 @@ + child = annobox_matches(); + break; + case 3: +- ++ ++ + child = annobox_translations(); + break; + case 4: +- + child = annobox_sequence(); + break; ++ case 5: ++ ++ ++ child = annobox_sequence(); ++ break; ++ case 4: ++ ++ ++ child = annobox_boundary(); ++ break; + } + annobox.appendChild(child); + } +@@ -596,13 +612,23 @@ + data.append_matches(child, i, line_width, show_rc_only); + break; + case 3: +- ++ ++ + data.append_translation(child, i, line_width, show_rc_only); + break; + case 4: +- + data.append_seq(child, i, line_width, show_rc_only); + break; ++ case 5: ++ ++ ++ data.append_seq(child, i, line_width, show_rc_only); ++ break; ++ case 4: ++ ++ ++ data.append_boundary(child, i, line_width, show_rc_only); ++ break; + } + child = child.nextSibling; + } +@@ -870,6 +896,7 @@ + this.append_hits = Sequence_append_hits; + this.append_matches = Sequence_append_matches; + this.append_labels = Sequence_append_labels; ++ this.append_boundary = Sequence_append_boundary; + //init + var mysegs = document.getElementById(seqid + "_segs"); + var lines = mysegs.value.split(/\n/); +@@ -1176,6 +1203,47 @@ + container.appendChild(oTable); + + } ++ ++ function Sequence_append_boundary(container, start, width, is_rc) { ++ if (start > this.length) { ++ alert("start: " + start + " length: " + this.length); ++ throw "INDEX_OUT_OF_BOUNDS"; ++ } ++ if ((start + width - 1) > this.length) { ++ alert("start: " + start + " width: " + width + " length: " + this.length); ++ throw "RANGE_OUT_OF_BOUNDS"; ++ } ++ //make a sub container to put the sequence in ++ var mycontainer = document.createElement('span'); ++ var pos = start; ++ var text = ""; ++ var iter = this.get_overlapping_hits(start, width, is_rc); ++ while (iter.has_next()) { ++ var o = iter.next(); ++ var end; ++ while (o.start > pos) { ++ text += " "; ++ ++pos; ++ } ++ if (o.start == o.hit.pos) { ++ text += "\\"; ++ ++pos; ++ } ++ end = o.start + o.length - 1; ++ while (end > pos) { ++ text += "_"; ++ ++pos; ++ } ++ if (end == (o.hit.pos + o.hit.width -1)) { ++ text += "/" ++ } else { ++ text += "_" ++ } ++ ++pos; ++ } ++ mycontainer.appendChild(document.createTextNode(text)); ++ container.appendChild(mycontainer); ++ } + //+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ + // End Sequence Object + //+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ +@@ -1992,7 +2060,7 @@ + &tab; + &tab; + +- ++ + + + + diff --git a/tools/meme-suite/sources/meme_4.4.0.patch_3 b/tools/meme-suite/sources/meme_4.4.0.patch_3 new file mode 100644 index 0000000000000000000000000000000000000000..b9439d3180122df02940e81a5d8916d2ca580c73 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.4.0.patch_3 @@ -0,0 +1,50 @@ +Index: website/html/meme-download.html +=================================================================== +--- website/html/meme-download.html (revision 4534) ++++ website/html/meme-download.html (revision 4557) +@@ -38,7 +38,7 @@ + Copyright for terms and + conditions before downloading the software. For-profit licenses + are also available; click +- ++ + here for details.

    +

    + The downloadable software includes the complete source code for the MEME suite, +@@ -55,7 +55,7 @@ +

  • Download databases for use with the MEME Suite
  • +
  • Installation Guide
  • +
  • Copyright
  • +-
  • License (for-profit only)
  • ++
  • License (for-profit only)
  • +
  • View MEME man page
  • +
  • View GLAM2 man page
  • +
  • View MAST man page
  • +Index: website/html/downloads.html +=================================================================== +--- website/html/downloads.html (revision 4534) ++++ website/html/downloads.html (revision 4557) +@@ -29,7 +29,7 @@ +

    Download MEME Suite Software

    +

    Installation Guide

    +

    Copyright

    +-

    Commercial Licenses

    ++

    Commercial Licenses

    + +Index: website/cgi-bin/meme_request.pl +=================================================================== +--- website/cgi-bin/meme_request.pl (revision 4579) ++++ website/cgi-bin/meme_request.pl (working copy) +@@ -258,8 +258,8 @@ + # write the motifs to a temporary file that will be deleted when perl exits + my ($fh, $tmpname); + ($fh, $tmpname) = tempfile(UNLINK => 1); +- $fh->print($motifs); +- $fh->close(); ++ print($fh $motifs); ++ close($fh); + + #print "Content-type: text/plain", "\n\n"; + #print "cat $tmpname", "\n"; diff --git a/tools/meme-suite/sources/meme_4.4.0.patch_4 b/tools/meme-suite/sources/meme_4.4.0.patch_4 new file mode 100644 index 0000000000000000000000000000000000000000..a782c66b2dc67828d86a3c95ce8c9e845467df0c --- /dev/null +++ b/tools/meme-suite/sources/meme_4.4.0.patch_4 @@ -0,0 +1,153 @@ +Index: src/cisml.c +=================================================================== +--- src/cisml.c (revision 4587) ++++ src/cisml.c (working copy) +@@ -7,6 +7,7 @@ + ********************************************************************/ + + #include ++#include + #include + #include + #include +@@ -1508,27 +1509,62 @@ + pattern->name + ); + } +- // Delete least significant items. +- double max_sig_pvalue = 1.0; ++ // Delete least significant matched elements. ++ double min_pvalue_discarded = 1.0; + MATCHED_ELEMENT_T *victim = NULL; + int deletion_count = 0; + for (deletion_count = 0; deletion_count < num_elements_to_delete; ++deletion_count) { + victim = (MATCHED_ELEMENT_T *) pop_heap_root(heap); +- max_sig_pvalue = *(victim->pvalue); ++ min_pvalue_discarded = *(victim->pvalue); + --pattern->num_stored_matches; + free_matched_element(victim); + } + +- // Delete further elements with pvalue equal the to the +- // minimum pvalue of the removed elements. +- while (*(((MATCHED_ELEMENT_T *) get_node(heap, 1))->pvalue) >= max_sig_pvalue) { ++ // Keep deleting matched elements until we find an element more ++ // significant then the elements we've already deleted. ++ while (*(((MATCHED_ELEMENT_T *) get_node(heap, 1))->pvalue) ++ >= min_pvalue_discarded) { + victim = (MATCHED_ELEMENT_T *) pop_heap_root(heap); ++ assert(victim != NULL); + --pattern->num_stored_matches; + free_matched_element(victim); ++ if (get_num_nodes(heap) == 0) { ++ // All the matched elements have been deleted! ++ break; ++ } + } + ++ if (verbosity >= NORMAL_VERBOSE) { ++ fprintf( ++ stderr, ++ "Warning: Reached max stored scores (%d).\n" ++ "Motif matches with p-value >= %3.2g have been " ++ "deleted to reclaim memory.\n", ++ pattern->max_stored_matches, ++ min_pvalue_discarded ++ ); ++ } ++ ++ if (get_num_nodes(heap) > 0) { ++ // Get the largest p-value retained from the top element of the heap. ++ pattern->max_pvalue_retained = *((MATCHED_ELEMENT_T *) get_node(heap, 1))->pvalue; ++ } ++ else { ++ // All items have been deleted! ++ fprintf( ++ stderr, ++ "Warning: there are no motif matches with p-value < %3.2g.\n" ++ "Use --max-stored-scores to allocate more space for " ++ "storing motif matches.\n", ++ min_pvalue_discarded ++ ); ++ // Set the largest p-value retained to something ++ // slightly less the smallest p-value discarded. ++ pattern->max_pvalue_retained ++ = get_next_smaller_double(min_pvalue_discarded); ++ } ++ + set_pattern_has_all_pvalues(pattern, FALSE); +- pattern->max_pvalue_retained = *((MATCHED_ELEMENT_T *) get_node(heap, 1))->pvalue; + } + + /********************************************************************** +Index: src/utils.c +=================================================================== +--- src/utils.c (revision 4597) ++++ src/utils.c (working copy) +@@ -532,8 +532,32 @@ + return(lower_value + interpolation); + } + ++/************************************************************************** ++ * Return the nearest double smaller then the given double ++ **************************************************************************/ ++double get_next_smaller_double(double x) { ++ // IEEE doubles run in lexigraphical order ++ // so if we want the next smaller double ++ // we just need to cast to integer type and ++ // decrement. ++ *(long long *) &x = *(long long *) &x - 1; ++ return x; ++} + + /************************************************************************** ++ * Return the nearest double larger then the given double ++ **************************************************************************/ ++double get_next_larger_double(double x) { ++ // IEEE doubles run in lexigraphical order ++ // so if we want the next larger double ++ // we just need to cast to integer type and ++ // increment. ++ *(long long *) &x = *(long long *) &x + 1; ++ return x; ++} ++ ++ ++/************************************************************************** + * See .h file for description. + **************************************************************************/ + BOOLEAN_T is_zero +Index: src/utils.h +=================================================================== +--- src/utils.h (revision 4597) ++++ src/utils.h (working copy) +@@ -267,6 +267,16 @@ + ) + + /************************************************************************** ++ * Return the nearest double smaller then the given double ++ **************************************************************************/ ++double get_next_smaller_double(double x); ++ ++/************************************************************************** ++ * Return the nearest double larger then the given double ++ **************************************************************************/ ++double get_next_larger_double(double x); ++ ++/************************************************************************** + * Test for zero on a value that may be either a log or a raw float. + **************************************************************************/ + BOOLEAN_T is_zero +Index: website/html/meme-suite-menu.in +=================================================================== +--- website/html/meme-suite-menu.in (revision 4587) ++++ website/html/meme-suite-menu.in (working copy) +@@ -33,7 +33,7 @@ + ['Downloads', html_path+'downloads.html', + ['Download MEME Suite Software', html_path+'meme-download.html'], + ['Copyright', html_path+'COPYRIGHT.html'], +- ['Commercial Licenses', 'http://invent.ucsd.edu/technology/cases/2002/SD2002-802.htm'], ++ ['Commercial Licenses', 'http://invent.ucsd.edu/technology/cases/2010/SD2010-808.shtml'], + //['Download GLAM2/GLAM2SCAN software separately', glam2_web.concat('/archive')] + ], + ['User Support', html_path+'resources.html', diff --git a/tools/meme-suite/sources/meme_4.4.0.patch_5 b/tools/meme-suite/sources/meme_4.4.0.patch_5 new file mode 100644 index 0000000000000000000000000000000000000000..3ccdb94b7bc3875e6ea7b93e1ee77c49aedb8922 --- /dev/null +++ b/tools/meme-suite/sources/meme_4.4.0.patch_5 @@ -0,0 +1,113 @@ +Index: website/html/search.in +=================================================================== +--- website/html/search.in (revision 4698) ++++ website/html/search.in (working copy) +@@ -9,7 +9,7 @@ + + + +- ++ + + + + + + + + + + +- ++ + + + +@@ -794,163 +794,163 @@ + + + +- +- ++ ++ + + +- + +- ++ + ++deoC (24), iraP (31), fucA (51), fucP (52), exuT (64), uxaC (65), tdcA (71), rhaB (80), araB (143), fruB (147), ...49 more... + + +- +- ++ ++ + + +- + +- ++ + ++deoC (24), fucA (51), fucP (52), exuT (64), uxaC (65), tdcA (71), rhaB (80), araB (143), fruB (147), fruB (148), ...42 more... + + + + +- +- ++ ++ + + + + + + + + +- +- ++ ++ + + + + + + + + +- +- ++ ++ + + + + ++fucA (51), fucP (52), rhaB (80), araB (143), fruB (147), fruB (148), nagB (153), xylA (176), idnD (196), nanA (204), ...10 more... + + + + +- +- ++ ++ + + + + + + + + +- +- ++ ++ + + + + ++fucP (52), uxaC (65), rhaB (80), srlA (111), araB (143), nagB (153), xylA (176), hisL (637), yihU (858), rpiB (895), ...3 more... + + + + +- +- ++ ++ + + + + ++fucP (52), uxaC (65), rhaB (80), srlA (111), araB (143), nagB (153), xylA (176), hisL (637), yihU (858), rpiB (895), ...4 more... + + + + +- +- ++ ++ + + + + ++fucA (51), fucP (52), rhaB (80), araB (143), fruB (147), fruB (148), nagB (153), ybjQ (159), xylA (176), idnD (196), ...14 more... + + + + +- +- ++ ++ + + + + ++iraP (31), fucA (51), fucP (52), rhaB (80), araB (143), fruB (147), fruB (148), nagB (153), ybjQ (159), xylA (176), ...20 more... + + + + +- +- ++ ++ + + + + ++fucP (52), uxaC (65), yqcC (78), rhaB (80), srlA (111), araB (143), nagB (153), xylA (176), nanA (204), nanC (238), ...27 more... + + + + +- +- ++ ++ + + + + ++fucA (51), fucP (52), rhaB (80), araB (143), fruB (147), fruB (148), nagB (153), xylA (176), idnD (196), nanA (204), ...13 more... + + + + +- +- ++ ++ + + + + + + +@@ -998,116 +998,116 @@ + + + +- +- ++ ++ + + + + ++srlA (79), solA (182), yjbE (305), bhsA (374), ymgC (388), dcuB (442), yihR (478), hlyE (535), ttdA (589), zwf (720), ...3 more... + + + + +- +- ++ ++ + + + + ++srlA (79), solA (182), yjbE (305), bhsA (374), ymgC (388), dcuB (442), yihR (478), ttdA (589), ymgA (822), yjiP (893), ...1 more... + +- +- ++ ++ + +- +- +- ++ ++ + +- ++ + + + + + +- +- ++ ++ + + + + + + + + +- +- ++ ++ + + + + + +- +- ++ ++ + +- +- +- ++ ++ + +- ++ + + + + + +- +- ++ ++ + + + + + +- +- ++ ++ + +- +- +- ++ ++ + +- ++ + + +- +- ++ ++ + +- +- +- ++ ++ + +- ++ + + + +@@ -1155,179 +1155,167 @@ + + + +- +- ++ ++ + + + + ++fdnG (3), nirB (9), narG (21), frdA (25), dmsA (32), torC (228), lldP (716), narZ (797), zwf (2161), ...1 more... + + + + +- +- ++ ++ + + + + ++fdnG (3), nirB (9), narG (21), frdA (25), dmsA (32), torC (228), sdhC (674), lldP (716), narZ (797), cyoA (980), ...5 more... + + + + +- +- ++ ++ + + + + + + +- ++ + +- +- +- ++ ++ + +- ++ + ++fdnG (3), nirB (9), narG (21), frdA (25), dmsA (32), torC (228), sdhC (674), lldP (716), narZ (797), cyoA (980), ...6 more... + + +- ++ + +- +- +- ++ ++ + +- ++ + ++fdnG (3), nirB (9), narG (21), frdA (25), dmsA (32), torC (228), sdhC (674), lldP (716), narZ (797), cyoA (980), ...6 more... + + + + +- +- ++ ++ + + + + + + + + +- +- ++ ++ + + + + + ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ + + + +- +- ++ ++ + + + + ++aqpZ (27), nhaB (30), adiC (60), gadB (77), mscS (156), gadA (252), adiA (363), nhaA (533), kefA (566), mscL (823), ...3 more... + + + + +- +- ++ ++ + + + + +- +- +- +- +- +- +- +- +- +- ++aqpZ (27), nhaB (30), adiC (60), gadB (77), mscS (156), gadA (252), adiA (363), nhaA (533), kefA (566), mscL (823), ...3 more... + + + + +- +- ++ ++ + + + + ++fdnG (3), narG (21), frdA (25), dmsA (32), torC (228), cydA (607), sdhC (674), narZ (797), cyoA (980), ndh (1014), ...4 more... + + + + +- +- ++ ++ + + + + ++napF (2), aqpZ (27), nhaB (30), adiC (60), gadB (77), acnA (106), lptA (145), mscS (156), sohA (226), alaS (236), ...36 more... + + + + +- +- ++ ++ + + + + +- +- +- +- +- +- +- +- +- +- ++aqpZ (27), nhaB (30), adiC (60), gadB (77), mscS (156), sohA (226), gadA (252), adiA (363), nhaA (533), kefA (566), ...5 more... + + +
    Missing Motif nagC Logo9 +-BP biofilm formation
    BP peptidoglycan-based cell wall organization
    BP peptidoglycan biosynthetic process
    MF hydrolase activity, hydrolyzing O-glycosyl compounds
    ++BP biofilm formation
    BP peptidoglycan biosynthetic process
    BP peptidoglycan-based cell wall organization
    MF hydrolase activity, hydrolyzing O-glycosyl compounds
    +
    narPMissing Motif narP Logo1413 +-BP anaerobic respiration
    MF molybdenum ion binding
    BP cytochrome complex assembly
    BP chemical homeostasis
    BP cellular homeostasis
    ++BP anaerobic respiration
    MF molybdenum ion binding
    BP cytochrome complex assembly
    BP cellular homeostasis
    BP chemical homeostasis
    +
    GO:00442481.341e-06GO:00090568.869e-075.615e-074.550e-04~1% ++~0% + BP cellular catabolic processcatabolic process +-deoC (25), fucP (51), fucA (52), uxaC (64), exuT (65), tdcA (71), rhaB (83), araB (144), fruB (147), fruB (148), ...42 more...
    GO:00090568.869e-07GO:00442481.341e-065.615e-074.550e-04~0% ++~1% + BP catabolic processcellular catabolic process +-deoC (25), iraP (37), fucP (51), fucA (52), uxaC (64), exuT (65), tdcA (71), rhaB (83), araB (144), fruB (147), ...49 more...
    GO:00086431.075e-047.299e-063.943e-038.422e-064.550e-03~4% + BP carbohydrate transport +-fucP (51), malK (138), malE (139), ulaA (174), xylF (179), idnD (197), yjjL (824) ++fucP (52), malE (135), malK (136), ulaA (172), xylF (177), idnD (196), yjjL (840) +
    GO:00511192.285e-042.527e-058.948e-032.077e-057.583e-03~5% + MF sugar transmembrane transporter activity +-fucP (51), glpT (99), malK (138), malE (139), xylF (179) ++fucP (52), glpT (99), malE (135), malK (136), xylF (177) +
    GO:00442752.652e-043.313e-058.948e-032.695e-057.583e-03~7% + BP cellular carbohydrate catabolic process +-fucP (51), fucA (52), rhaB (83), araB (144), fruB (147), fruB (148), nagB (153), xylA (178), idnD (197), nanA (201), ...10 more...
    GO:00151442.665e-043.313e-058.948e-032.807e-057.583e-03~3% + MF carbohydrate transmembrane transporter activity +-fucP (51), glpT (99), malK (138), malE (139), ulaA (174), xylF (179), ycaI (1391) ++fucP (52), glpT (99), malE (135), malK (136), ulaA (172), xylF (177), ycaI (1391) +
    GO:00168613.954e-044.773e-051.083e-024.604e-051.058e-02~14% + MF intramolecular oxidoreductase activity, interconverting aldoses and ketoses +-fucP (51), uxaC (64), rhaB (83), srlA (111), araB (144), nagB (153), xylA (178), hisL (641), yihU (858), rpiB (897), ...3 more...
    GO:00168604.737e-045.896e-051.083e-025.222e-051.058e-02~4% + MF intramolecular oxidoreductase activity +-fucP (51), uxaC (64), rhaB (83), srlA (111), araB (144), nagB (153), xylA (178), hisL (641), yihU (858), rpiB (897), ...4 more...
    GO:00160525.421e-046.569e-051.083e-026.176e-051.112e-02~3% + BP carbohydrate catabolic process +-fucP (51), fucA (52), rhaB (83), araB (144), fruB (147), fruB (148), nagB (153), ybjQ (158), xylA (178), idnD (197), ...14 more...
    GO:00090575.850e-046.682e-051.083e-026.962e-051.128e-02~2% + BP macromolecule catabolic process +-iraP (37), fucP (51), fucA (52), rhaB (83), araB (144), fruB (147), fruB (148), nagB (153), ybjQ (158), xylA (178), ...20 more...
    GO:00168537.322e-049.938e-051.464e-029.321e-051.373e-02~1% + MF isomerase activity +-fucP (51), uxaC (64), yqcC (77), rhaB (83), srlA (111), araB (144), nagB (153), xylA (178), nanA (201), nanC (239), ...27 more...
    GO:00442658.893e-041.235e-041.668e-021.157e-041.562e-02~6% + BP cellular macromolecule catabolic process +-fucP (51), fucA (52), rhaB (83), araB (144), fruB (147), fruB (148), nagB (153), xylA (178), idnD (197), nanA (201), ...13 more...
    GO:00193211.272e-031.898e-042.366e-021.752e-042.184e-02~16% + BP pentose metabolic process +-fucP (51), fucA (52), rhaB (83), araB (144), xylA (178), rbsD (364), aldA (1071), yiaK (1938) ++fucA (51), fucP (52), rhaB (80), araB (143), xylA (176), rbsD (365), aldA (1059), yiaK (1950) +
    GO:00517041.801e-041.628e-052.444e-022.190e-052.269e-02~0% + BP multi-organism process +-srlA (79), solA (181), yjbE (305), bhsA (376), ymgC (387), dcuB (442), yihR (478), hlyE (536), ttdA (588), zwf (720), ...3 more...
    GO:00427104.020e-044.155e-052.444e-025.278e-052.269e-02~15% + BP biofilm formation +-srlA (79), solA (181), yjbE (305), bhsA (376), ymgC (387), dcuB (442), yihR (478), ttdA (588), ymgA (821), yjiP (889), ...1 more...
    GO:0031504
    GO:00070478.308e-041.095e-042.444e-02100% ++1.089e-042.269e-02~37% + BP peptidoglycan-based cell wall organizationcellular cell wall organization +-mltB (78), mltA (98), mipA (128), mraZ (166), zwf (720) ++mltB (78), mltA (98), mipA (129), mraZ (166), zwf (720) +
    GO:00092528.308e-041.095e-042.444e-021.089e-042.269e-02~89% + BP peptidoglycan biosynthetic process +-mltB (78), mltA (98), mipA (128), mraZ (166), zwf (720) ++mltB (78), mltA (98), mipA (129), mraZ (166), zwf (720) +
    GO:00092738.308e-041.095e-042.444e-021.089e-042.269e-02~29% + BP peptidoglycan-based cell wall biogenesis +-mltB (78), mltA (98), mipA (128), mraZ (166), zwf (720) ++mltB (78), mltA (98), mipA (129), mraZ (166), zwf (720) +
    GO:0007047
    GO:00315048.308e-041.095e-042.444e-02~37% ++1.089e-042.269e-02100% + BP cellular cell wall organizationpeptidoglycan-based cell wall organization +-mltB (78), mltA (98), mipA (128), mraZ (166), zwf (720) ++mltB (78), mltA (98), mipA (129), mraZ (166), zwf (720) +
    GO:00425468.308e-041.095e-042.444e-021.089e-042.269e-02~8% + BP cell wall biogenesis +-mltB (78), mltA (98), mipA (128), mraZ (166), zwf (720) ++mltB (78), mltA (98), mipA (129), mraZ (166), zwf (720) +
    GO:0016798
    GO:00045531.101e-031.724e-042.992e-02~1% ++1.617e-042.620e-02~2% + MF hydrolase activity, acting on glycosyl bondshydrolase activity, hydrolyzing O-glycosyl compounds +-chiA (11), uidA (95), mltA (98), essD (386) ++chiA (11), uidA (94), mltA (98), essD (384) +
    GO:0004553
    GO:00167981.101e-031.724e-042.992e-02~2% ++1.617e-042.620e-02~1% + MF hydrolase activity, hydrolyzing O-glycosyl compoundshydrolase activity, acting on glycosyl bonds +-chiA (11), uidA (95), mltA (98), essD (386) ++chiA (11), uidA (94), mltA (98), essD (384) +
    GO:00090613.737e-044.380e-053.811e-025.446e-054.021e-02~54% + BP anaerobic respiration +-fdnG (3), nirB (9), narG (21), frdA (25), dmsA (32), torC (228), lldP (715), narZ (798), zwf (2156), ...1 more...
    GO:00453335.182e-046.625e-053.811e-027.580e-054.021e-0215% + BP cellular respiration +-fdnG (3), nirB (9), narG (21), frdA (25), dmsA (32), torC (228), sdhC (672), lldP (715), narZ (798), cyoA (984), ...5 more...
    GO:00301516.633e-049.882e-053.811e-029.938e-054.021e-02100% + MF molybdenum ion binding +-fdnG (3), narG (21), dmsA (32), torC (228), narZ (798) ++fdnG (3), narG (21), dmsA (32), torC (228), narZ (797) +
    GO:0015980GO:00060919.717e-041.494e-043.811e-02~6% ++1.454e-044.021e-02~4% + BP energy derivation by oxidation of organic compoundsgeneration of precursor metabolites and energy +-fdnG (3), nirB (9), narG (21), frdA (25), dmsA (32), torC (228), sdhC (672), lldP (715), narZ (798), cyoA (984), ...6 more...
    GO:0006091GO:00159809.717e-041.494e-043.811e-02~4% ++1.454e-044.021e-02~6% + BP generation of precursor metabolites and energyenergy derivation by oxidation of organic compounds +-fdnG (3), nirB (9), narG (21), frdA (25), dmsA (32), torC (228), sdhC (672), lldP (715), narZ (798), cyoA (984), ...6 more...
    GO:00170041.063e-031.628e-043.811e-021.623e-044.021e-02~46% + BP cytochrome complex assembly +-napF (1), fdnG (3), narG (21), cydA (609), sdhC (672) ++napF (2), fdnG (3), narG (21), cydA (607), sdhC (674) +
    GO:00436231.063e-031.628e-043.811e-021.623e-044.021e-02~9% + BP cellular protein complex assembly +-napF (1), fdnG (3), narG (21), cydA (609), sdhC (672) ++napF (2), fdnG (3), narG (21), cydA (607), sdhC (674) +
    GO:00197251.382e-032.442e-044.237e-02~4% ++ BP cellular homeostasis ++aqpZ (27), nhaB (30), adiC (60), gadB (77), mscS (156), gadA (252), adiA (363), nhaA (533), kefA (566), mscL (823), ...3 more...
    GO:00425921.382e-032.190e-043.811e-022.442e-044.237e-02~1% + BP homeostatic process +-aqpZ (28), nhaB (30), adiC (60), gadB (80), mscS (155), gadA (255), adiA (370), nhaA (532), kefA (565), mscL (821), ...3 more...
    GO:00488781.382e-032.190e-043.811e-022.442e-044.237e-02~2% + BP chemical homeostasis +-aqpZ (28), nhaB (30), adiC (60), gadB (80), mscS (155), gadA (255), adiA (370), nhaA (532), kefA (565), mscL (821), ...3 more...
    GO:00197251.382e-032.190e-043.811e-02~4% +- BP cellular homeostasis +-aqpZ (28), nhaB (30), adiC (60), gadB (80), mscS (155), gadA (255), adiA (370), nhaA (532), kefA (565), mscL (821), ...3 more...
    GO:00090551.539e-032.448e-043.873e-022.858e-044.507e-02~13% + MF electron carrier activity +-fdnG (3), narG (21), frdA (25), dmsA (32), torC (228), cydA (609), sdhC (672), narZ (798), cyoA (984), ndh (1013), ...4 more...
    GO:00650071.695e-032.746e-043.982e-023.273e-044.732e-02~0% + BP biological regulation +-napF (1), aqpZ (28), nhaB (30), adiC (60), gadB (80), acnA (106), lptA (147), mscS (155), sohA (224), alaS (236), ...36 more...
    GO:00650081.839e-033.099e-044.149e-023.734e-044.982e-02~0% + BP regulation of biological quality +-aqpZ (28), nhaB (30), adiC (60), gadB (80), mscS (155), sohA (224), gadA (255), adiA (370), nhaA (532), kefA (565), ...5 more...
    GO:00431692.049e-033.543e-044.404e-02~9% +- MF cation binding +-fdnG (3), nirB (9), narG (21), dmsA (32), uxaC (172), torC (228), alaS (236), nagB (246), yfdR (378), fucA (510), ...16 more...
    + +
    +-GOMo version:
    4.10.0 (Release date: Tue May 06 16:46:04 2014 +1000)

    Reference:
    ++GOMo version:
    4.10.0 (Release date: Wed May 21 10:35:36 2014 +1000)

    Reference:
    + Mikael Bodén and Timothy L. Bailey, + "Associating transcription factor binding site motifs with target Go terms and target genes", + Nucleic Acids Research, 36, 4108-4117, 2008. +@@ -1345,7 +1333,7 @@ + This information can also be useful in the event you wish to report + a problem with the GOMo software.

    + Command:


    +- Seed: 200467453

    ++ Seed: 3993088087

    + Significance Threshold: 0.05
    +
    + +diff -ruN a/doc/examples/gomo_example_output_files/gomo.xml b/doc/examples/gomo_example_output_files/gomo.xml +--- a/doc/examples/gomo_example_output_files/gomo.xml 2014-05-13 08:33:41.000000000 +1000 ++++ b/doc/examples/gomo_example_output_files/gomo.xml 2014-10-07 16:20:12.000000000 +1000 +@@ -50,9 +50,9 @@ + rank CDATA #REQUIRED + > + ]> +- ++ + + + +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ + +- +- ++ ++ + +- + +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ + +- +- ++ ++ + ++ + +- +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ + +- +- ++ + +- +- +- ++ ++ ++ + +- +- +- +- +- ++ ++ ++ ++ + + + +- +- +- ++ ++ ++ + +- +- ++ + +- +- +- +- ++ ++ ++ ++ + + +- +- +- +- ++ ++ ++ + +- ++ + +- +- ++ ++ + +- ++ + +- +- +- +- ++ ++ ++ + +- ++ + +- +- ++ ++ + +- ++ + +- +- +- +- +- ++ ++ ++ ++ + + + +- +- +- ++ ++ ++ + +- +- +- +- +- +- ++ ++ ++ ++ ++ + + + +- +- ++ ++ + +- +- +- +- +- ++ ++ ++ ++ + +- ++ + +- +- +- ++ ++ ++ + +- +- +- +- +- ++ ++ ++ ++ + + + +- +- +- ++ ++ ++ + +- +- +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ ++ + + + +- + +- ++ + +- +- ++ ++ + + +- +- ++ ++ + + +- + +- ++ + +- +- ++ ++ + + +- +- +- ++ ++ ++ + +- ++ + + +- ++ + + + +- + + +- ++ + + + +- + + +- ++ + + + +- ++ + + +- ++ + + + +- + + +- ++ + + + +- ++ + +- ++ + +- ++ + +- ++ + +- ++ + +- ++ + + + +- + + +@@ -312,11 +312,11 @@ + + + +- +- +- ++ ++ ++ + +- + + +@@ -324,151 +324,138 @@ + + + +- +- +- +- ++ ++ ++ ++ + +- + + + + +- ++ + +- ++ + + + + + + +- +- +- +- ++ ++ ++ ++ + +- ++ + + + + + + +- +- +- +- ++ ++ ++ ++ + +- +- ++ + + +- +- ++ ++ + +- +- ++ + + +- +- ++ ++ + +- +- ++ ++ + + +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ + +- +- ++ ++ + + +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ + +- +- ++ ++ + + +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ + +- + + + + + +- +- +- +- +- ++ ++ ++ ++ ++ + +- +- +- ++ ++ + + +- ++ + +- +- +- ++ ++ ++ + + +- +- ++ + + +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ + + + +Binary files a/doc/examples/gomo_example_output_files/res/logocrp.png and b/doc/examples/gomo_example_output_files/res/logocrp.png differ +Binary files a/doc/examples/gomo_example_output_files/res/logonagC.png and b/doc/examples/gomo_example_output_files/res/logonagC.png differ +Binary files a/doc/examples/gomo_example_output_files/res/logonarP.png and b/doc/examples/gomo_example_output_files/res/logonarP.png differ +diff -ruN a/doc/examples/Makefile.in b/doc/examples/Makefile.in +--- a/doc/examples/Makefile.in 2014-05-21 10:36:42.904537883 +1000 ++++ b/doc/examples/Makefile.in 2014-10-08 13:28:02.454029418 +1000 +@@ -128,229 +128,222 @@ + sample-dna-Klf1.fa sample-dna-motif.meme-io \ + sample-protein-motif.meme-io ame_example_output_files/ame.html \ + ame_example_output_files/ame.txt \ ++ centrimo_example_output_files/site_counts.txt \ + centrimo_example_output_files/centrimo.html \ + centrimo_example_output_files/centrimo.txt \ +- centrimo_example_output_files/site_counts.txt \ +- dreme_example_output_files/dreme.html \ ++ dreme_example_output_files/m07rc_MCGCCCT.png \ ++ dreme_example_output_files/m03nc_MCRCCCA.png \ + dreme_example_output_files/dreme.txt \ +- dreme_example_output_files/dreme.xml \ ++ dreme_example_output_files/m15rc_TCACGTS.png \ ++ dreme_example_output_files/m06nc_CTGTSTS.png \ ++ dreme_example_output_files/dreme.html \ ++ dreme_example_output_files/m12rc_GTGKCTG.png \ + dreme_example_output_files/m01nc_CCMCRCCC.png \ +- dreme_example_output_files/m01rc_GGGYGKGG.png \ +- dreme_example_output_files/m02nc_BTTATCW.png \ + dreme_example_output_files/m02rc_WGATAAV.png \ +- dreme_example_output_files/m03nc_MCRCCCA.png \ +- dreme_example_output_files/m03rc_TGGGYGK.png \ +- dreme_example_output_files/m04nc_RARGAAA.png \ +- dreme_example_output_files/m04rc_TTTCYTY.png \ +- dreme_example_output_files/m05nc_AKAAAM.png \ +- dreme_example_output_files/m05rc_KTTTMT.png \ +- dreme_example_output_files/m06nc_CTGTSTS.png \ +- dreme_example_output_files/m06rc_SASACAG.png \ +- dreme_example_output_files/m07nc_AGGGCGK.png \ +- dreme_example_output_files/m07rc_MCGCCCT.png \ +- dreme_example_output_files/m08nc_CCTKCCY.png \ +- dreme_example_output_files/m08rc_RGGMAGG.png \ +- dreme_example_output_files/m09nc_TTAAAAW.png \ +- dreme_example_output_files/m09rc_WTTTTAA.png \ +- dreme_example_output_files/m10nc_AAATAH.png \ +- dreme_example_output_files/m10rc_DTATTT.png \ + dreme_example_output_files/m11nc_CATYTCC.png \ ++ dreme_example_output_files/m05nc_AKAAAM.png \ ++ dreme_example_output_files/m14nc_CTGGRGA.png \ + dreme_example_output_files/m11rc_GGARATG.png \ + dreme_example_output_files/m12nc_CAGMCAC.png \ +- dreme_example_output_files/m12rc_GTGKCTG.png \ ++ dreme_example_output_files/m02nc_BTTATCW.png \ ++ dreme_example_output_files/m10nc_AAATAH.png \ ++ dreme_example_output_files/m15nc_SACGTGA.png \ ++ dreme_example_output_files/m08nc_CCTKCCY.png \ + dreme_example_output_files/m13nc_CACAGY.png \ +- dreme_example_output_files/m13rc_RCTGTG.png \ +- dreme_example_output_files/m14nc_CTGGRGA.png \ ++ dreme_example_output_files/m09rc_WTTTTAA.png \ ++ dreme_example_output_files/m05rc_KTTTMT.png \ + dreme_example_output_files/m14rc_TCYCCAG.png \ +- dreme_example_output_files/m15nc_SACGTGA.png \ +- dreme_example_output_files/m15rc_TCACGTS.png \ +- fimo_example_output_files/cisml.css \ ++ dreme_example_output_files/m06rc_SASACAG.png \ ++ dreme_example_output_files/m04nc_RARGAAA.png \ ++ dreme_example_output_files/m04rc_TTTCYTY.png \ ++ dreme_example_output_files/m13rc_RCTGTG.png \ ++ dreme_example_output_files/dreme.xml \ ++ dreme_example_output_files/m09nc_TTAAAAW.png \ ++ dreme_example_output_files/m10rc_DTATTT.png \ ++ dreme_example_output_files/m03rc_TGGGYGK.png \ ++ dreme_example_output_files/m08rc_RGGMAGG.png \ ++ dreme_example_output_files/m07nc_AGGGCGK.png \ ++ dreme_example_output_files/m01rc_GGGYGKGG.png \ + fimo_example_output_files/cisml.xml \ +- fimo_example_output_files/fimo-to-html.xsl \ + fimo_example_output_files/fimo.gff \ +- fimo_example_output_files/fimo.html \ + fimo_example_output_files/fimo.txt \ ++ fimo_example_output_files/fimo-to-html.xsl \ ++ fimo_example_output_files/fimo.html \ + fimo_example_output_files/fimo.xml \ +- glam2_example_output_files/glam2.html \ ++ fimo_example_output_files/cisml.css \ + glam2_example_output_files/glam2.meme \ ++ glam2_example_output_files/logo6.eps \ ++ glam2_example_output_files/glam2.html \ ++ glam2_example_output_files/logo8.png \ ++ glam2_example_output_files/logo_ssc5.eps \ ++ glam2_example_output_files/logo_ssc4.eps \ ++ glam2_example_output_files/logo_ssc1.png \ ++ glam2_example_output_files/logo5.png \ ++ glam2_example_output_files/logo_ssc3.png \ ++ glam2_example_output_files/logo_ssc6.png \ ++ glam2_example_output_files/logo2.eps \ + glam2_example_output_files/glam2.txt \ + glam2_example_output_files/logo1.eps \ ++ glam2_example_output_files/logo4.png \ ++ glam2_example_output_files/logo_ssc2.eps \ + glam2_example_output_files/logo1.png \ +- glam2_example_output_files/logo10.eps \ +- glam2_example_output_files/logo10.png \ +- glam2_example_output_files/logo2.eps \ +- glam2_example_output_files/logo2.png \ +- glam2_example_output_files/logo3.eps \ ++ glam2_example_output_files/logo_ssc9.eps \ + glam2_example_output_files/logo3.png \ +- glam2_example_output_files/logo4.eps \ +- glam2_example_output_files/logo4.png \ ++ glam2_example_output_files/logo3.eps \ ++ glam2_example_output_files/logo_ssc8.eps \ ++ glam2_example_output_files/logo_ssc5.png \ + glam2_example_output_files/logo5.eps \ +- glam2_example_output_files/logo5.png \ +- glam2_example_output_files/logo6.eps \ +- glam2_example_output_files/logo6.png \ +- glam2_example_output_files/logo7.eps \ +- glam2_example_output_files/logo7.png \ +- glam2_example_output_files/logo8.eps \ +- glam2_example_output_files/logo8.png \ +- glam2_example_output_files/logo9.eps \ +- glam2_example_output_files/logo9.png \ +- glam2_example_output_files/logo_ssc1.eps \ +- glam2_example_output_files/logo_ssc1.png \ + glam2_example_output_files/logo_ssc10.eps \ ++ glam2_example_output_files/logo_ssc7.eps \ + glam2_example_output_files/logo_ssc10.png \ +- glam2_example_output_files/logo_ssc2.eps \ ++ glam2_example_output_files/logo_ssc8.png \ ++ glam2_example_output_files/logo9.eps \ ++ glam2_example_output_files/logo9.png \ + glam2_example_output_files/logo_ssc2.png \ +- glam2_example_output_files/logo_ssc3.eps \ +- glam2_example_output_files/logo_ssc3.png \ +- glam2_example_output_files/logo_ssc4.eps \ +- glam2_example_output_files/logo_ssc4.png \ +- glam2_example_output_files/logo_ssc5.eps \ +- glam2_example_output_files/logo_ssc5.png \ +- glam2_example_output_files/logo_ssc6.eps \ +- glam2_example_output_files/logo_ssc6.png \ +- glam2_example_output_files/logo_ssc7.eps \ ++ glam2_example_output_files/logo10.eps \ + glam2_example_output_files/logo_ssc7.png \ +- glam2_example_output_files/logo_ssc8.eps \ +- glam2_example_output_files/logo_ssc8.png \ +- glam2_example_output_files/logo_ssc9.eps \ + glam2_example_output_files/logo_ssc9.png \ +- glam2scan_example_output_files/glam2scan.html \ ++ glam2_example_output_files/logo7.eps \ ++ glam2_example_output_files/logo2.png \ ++ glam2_example_output_files/logo_ssc1.eps \ ++ glam2_example_output_files/logo_ssc6.eps \ ++ glam2_example_output_files/logo10.png \ ++ glam2_example_output_files/logo4.eps \ ++ glam2_example_output_files/logo8.eps \ ++ glam2_example_output_files/logo7.png \ ++ glam2_example_output_files/logo6.png \ ++ glam2_example_output_files/logo_ssc4.png \ ++ glam2_example_output_files/logo_ssc3.eps \ + glam2scan_example_output_files/glam2scan.txt \ +- gomo_example_output_files/gomo.html \ ++ glam2scan_example_output_files/glam2scan.html \ + gomo_example_output_files/gomo.xml \ +- gomo_example_output_files/res/logocrp.png \ ++ gomo_example_output_files/gomo.html \ + gomo_example_output_files/res/logonagC.png \ ++ gomo_example_output_files/res/logocrp.png \ + gomo_example_output_files/res/logonarP.png \ +- mast_example_output_files/mast.html \ +- mast_example_output_files/mast.txt \ + mast_example_output_files/mast.xml \ +- mcast_example_output_files/block-diagram.xsl \ ++ mast_example_output_files/mast.txt \ ++ mast_example_output_files/mast.html \ + mcast_example_output_files/cisml.xml \ ++ mcast_example_output_files/mcast.xml \ + mcast_example_output_files/constants.xsl \ +- mcast_example_output_files/mcast-to-bed.xsl \ ++ mcast_example_output_files/mcast.txt \ ++ mcast_example_output_files/block-diagram.xsl \ ++ mcast_example_output_files/meme.css.xsl \ ++ mcast_example_output_files/mcast.html \ + mcast_example_output_files/mcast-to-html.xsl \ + mcast_example_output_files/mcast-to-text.xsl \ + mcast_example_output_files/mcast.bed \ +- mcast_example_output_files/mcast.html \ +- mcast_example_output_files/mcast.txt \ +- mcast_example_output_files/mcast.xml \ +- mcast_example_output_files/meme.css.xsl \ ++ mcast_example_output_files/mcast-to-bed.xsl \ ++ meme_example_output_files/logo_rc2.eps \ ++ meme_example_output_files/logo_rc3.eps \ ++ meme_example_output_files/meme.txt \ ++ meme_example_output_files/logo2.eps \ + meme_example_output_files/logo1.eps \ + meme_example_output_files/logo1.png \ +- meme_example_output_files/logo2.eps \ +- meme_example_output_files/logo2.png \ +- meme_example_output_files/logo3.eps \ +- meme_example_output_files/logo3.png \ ++ meme_example_output_files/logo_rc3.png \ + meme_example_output_files/logo_rc1.eps \ ++ meme_example_output_files/logo3.png \ ++ meme_example_output_files/logo3.eps \ ++ meme_example_output_files/meme.html \ + meme_example_output_files/logo_rc1.png \ +- meme_example_output_files/logo_rc2.eps \ ++ meme_example_output_files/logo2.png \ + meme_example_output_files/logo_rc2.png \ +- meme_example_output_files/logo_rc3.eps \ +- meme_example_output_files/logo_rc3.png \ +- meme_example_output_files/meme.html \ +- meme_example_output_files/meme.txt \ + meme_example_output_files/meme.xml \ +- memechip_example_output_files/align_msgs.txt \ +- memechip_example_output_files/background \ +- memechip_example_output_files/combined.meme \ ++ memechip_example_output_files/centrimo_out/site_counts.txt \ ++ memechip_example_output_files/centrimo_out/centrimo.html \ ++ memechip_example_output_files/centrimo_out/centrimo.txt \ ++ memechip_example_output_files/fimo_out_5/cisml.xml \ ++ memechip_example_output_files/fimo_out_5/fimo.gff \ ++ memechip_example_output_files/fimo_out_5/fimo.txt \ ++ memechip_example_output_files/fimo_out_5/fimo-to-html.xsl \ ++ memechip_example_output_files/fimo_out_5/fimo.html \ ++ memechip_example_output_files/fimo_out_5/fimo.xml \ ++ memechip_example_output_files/fimo_out_5/cisml.css \ ++ memechip_example_output_files/fimo_out_2/cisml.xml \ ++ memechip_example_output_files/fimo_out_2/fimo.gff \ ++ memechip_example_output_files/fimo_out_2/fimo.txt \ ++ memechip_example_output_files/fimo_out_2/fimo-to-html.xsl \ ++ memechip_example_output_files/fimo_out_2/fimo.html \ ++ memechip_example_output_files/fimo_out_2/fimo.xml \ ++ memechip_example_output_files/fimo_out_2/cisml.css \ ++ memechip_example_output_files/dreme_out/dreme.txt \ ++ memechip_example_output_files/dreme_out/dreme.html \ ++ memechip_example_output_files/dreme_out/m02rc_WGATAA.png \ ++ memechip_example_output_files/dreme_out/m03nc_AGAWA.png \ ++ memechip_example_output_files/dreme_out/m02nc_TTATCW.png \ ++ memechip_example_output_files/dreme_out/m03rc_TWTCT.png \ ++ memechip_example_output_files/dreme_out/dreme.xml \ ++ memechip_example_output_files/dreme_out/m01nc_GGGYGK.png \ ++ memechip_example_output_files/dreme_out/m01rc_MCRCCC.png \ ++ memechip_example_output_files/seqs-sampled \ ++ memechip_example_output_files/spamo_out_3/spamo.html \ ++ memechip_example_output_files/spamo_out_3/spamo.xml \ + memechip_example_output_files/index.html \ +- memechip_example_output_files/meme_msgs.txt \ +- memechip_example_output_files/motif_alignment.txt \ + memechip_example_output_files/progress_log.txt \ +- memechip_example_output_files/sample-dna-Klf1.fa \ +- memechip_example_output_files/seqs-centered \ +- memechip_example_output_files/seqs-discarded \ +- memechip_example_output_files/seqs-sampled \ +- memechip_example_output_files/seqs-shuffled \ +- memechip_example_output_files/spamo_out_7/spamo.html \ +- memechip_example_output_files/spamo_out_7/spamo.xml \ +- memechip_example_output_files/spamo_out_6/spamo.html \ +- memechip_example_output_files/spamo_out_6/spamo.xml \ +- memechip_example_output_files/spamo_out_5/spamo.html \ +- memechip_example_output_files/spamo_out_5/spamo.xml \ ++ memechip_example_output_files/combined.meme \ + memechip_example_output_files/spamo_out_4/spamo.html \ + memechip_example_output_files/spamo_out_4/spamo.xml \ +- memechip_example_output_files/spamo_out_3/spamo.html \ +- memechip_example_output_files/spamo_out_3/spamo.xml \ +- memechip_example_output_files/spamo_out_2/spamo.html \ +- memechip_example_output_files/spamo_out_2/spamo.xml \ + memechip_example_output_files/spamo_out_1/spamo.html \ + memechip_example_output_files/spamo_out_1/spamo.xml \ +- memechip_example_output_files/fimo_out_7/cisml.css \ +- memechip_example_output_files/fimo_out_7/cisml.xml \ +- memechip_example_output_files/fimo_out_7/fimo-to-html.xsl \ +- memechip_example_output_files/fimo_out_7/fimo.gff \ +- memechip_example_output_files/fimo_out_7/fimo.html \ +- memechip_example_output_files/fimo_out_7/fimo.txt \ +- memechip_example_output_files/fimo_out_7/fimo.xml \ +- memechip_example_output_files/fimo_out_6/cisml.css \ +- memechip_example_output_files/fimo_out_6/cisml.xml \ +- memechip_example_output_files/fimo_out_6/fimo-to-html.xsl \ +- memechip_example_output_files/fimo_out_6/fimo.gff \ +- memechip_example_output_files/fimo_out_6/fimo.html \ +- memechip_example_output_files/fimo_out_6/fimo.txt \ +- memechip_example_output_files/fimo_out_6/fimo.xml \ +- memechip_example_output_files/fimo_out_5/cisml.css \ +- memechip_example_output_files/fimo_out_5/cisml.xml \ +- memechip_example_output_files/fimo_out_5/fimo-to-html.xsl \ +- memechip_example_output_files/fimo_out_5/fimo.gff \ +- memechip_example_output_files/fimo_out_5/fimo.html \ +- memechip_example_output_files/fimo_out_5/fimo.txt \ +- memechip_example_output_files/fimo_out_5/fimo.xml \ +- memechip_example_output_files/fimo_out_4/cisml.css \ ++ memechip_example_output_files/seqs-centered \ ++ memechip_example_output_files/background \ ++ memechip_example_output_files/meme_tomtom_out/tomtom.html \ ++ memechip_example_output_files/meme_tomtom_out/tomtom.txt \ ++ memechip_example_output_files/meme_tomtom_out/tomtom.xml \ + memechip_example_output_files/fimo_out_4/cisml.xml \ +- memechip_example_output_files/fimo_out_4/fimo-to-html.xsl \ + memechip_example_output_files/fimo_out_4/fimo.gff \ +- memechip_example_output_files/fimo_out_4/fimo.html \ + memechip_example_output_files/fimo_out_4/fimo.txt \ ++ memechip_example_output_files/fimo_out_4/fimo-to-html.xsl \ ++ memechip_example_output_files/fimo_out_4/fimo.html \ + memechip_example_output_files/fimo_out_4/fimo.xml \ +- memechip_example_output_files/fimo_out_3/cisml.css \ ++ memechip_example_output_files/fimo_out_4/cisml.css \ + memechip_example_output_files/fimo_out_3/cisml.xml \ +- memechip_example_output_files/fimo_out_3/fimo-to-html.xsl \ + memechip_example_output_files/fimo_out_3/fimo.gff \ +- memechip_example_output_files/fimo_out_3/fimo.html \ + memechip_example_output_files/fimo_out_3/fimo.txt \ ++ memechip_example_output_files/fimo_out_3/fimo-to-html.xsl \ ++ memechip_example_output_files/fimo_out_3/fimo.html \ + memechip_example_output_files/fimo_out_3/fimo.xml \ +- memechip_example_output_files/fimo_out_2/cisml.css \ +- memechip_example_output_files/fimo_out_2/cisml.xml \ +- memechip_example_output_files/fimo_out_2/fimo-to-html.xsl \ +- memechip_example_output_files/fimo_out_2/fimo.gff \ +- memechip_example_output_files/fimo_out_2/fimo.html \ +- memechip_example_output_files/fimo_out_2/fimo.txt \ +- memechip_example_output_files/fimo_out_2/fimo.xml \ +- memechip_example_output_files/fimo_out_1/cisml.css \ ++ memechip_example_output_files/fimo_out_3/cisml.css \ + memechip_example_output_files/fimo_out_1/cisml.xml \ +- memechip_example_output_files/fimo_out_1/fimo-to-html.xsl \ + memechip_example_output_files/fimo_out_1/fimo.gff \ +- memechip_example_output_files/fimo_out_1/fimo.html \ + memechip_example_output_files/fimo_out_1/fimo.txt \ ++ memechip_example_output_files/fimo_out_1/fimo-to-html.xsl \ ++ memechip_example_output_files/fimo_out_1/fimo.html \ + memechip_example_output_files/fimo_out_1/fimo.xml \ ++ memechip_example_output_files/fimo_out_1/cisml.css \ ++ memechip_example_output_files/spamo_out_2/spamo.html \ ++ memechip_example_output_files/spamo_out_2/spamo.xml \ ++ memechip_example_output_files/meme_out/logo_rc2.eps \ ++ memechip_example_output_files/meme_out/logo_rc3.eps \ ++ memechip_example_output_files/meme_out/meme.txt \ ++ memechip_example_output_files/meme_out/logo2.eps \ ++ memechip_example_output_files/meme_out/logo1.eps \ ++ memechip_example_output_files/meme_out/logo_rc1.eps \ ++ memechip_example_output_files/meme_out/logo3.eps \ ++ memechip_example_output_files/meme_out/meme.html \ ++ memechip_example_output_files/meme_out/meme.xml \ ++ memechip_example_output_files/seqs-discarded \ + memechip_example_output_files/dreme_tomtom_out/tomtom.html \ + memechip_example_output_files/dreme_tomtom_out/tomtom.txt \ + memechip_example_output_files/dreme_tomtom_out/tomtom.xml \ +- memechip_example_output_files/dreme_out/dreme.html \ +- memechip_example_output_files/dreme_out/dreme.txt \ +- memechip_example_output_files/dreme_out/dreme.xml \ +- memechip_example_output_files/dreme_out/m01nc_GGGYGK.png \ +- memechip_example_output_files/dreme_out/m01rc_MCRCCC.png \ +- memechip_example_output_files/dreme_out/m02nc_TTATCW.png \ +- memechip_example_output_files/dreme_out/m02rc_WGATAA.png \ +- memechip_example_output_files/dreme_out/m03nc_AGAWA.png \ +- memechip_example_output_files/dreme_out/m03rc_TWTCT.png \ +- memechip_example_output_files/centrimo_out/centrimo.html \ +- memechip_example_output_files/centrimo_out/centrimo.txt \ +- memechip_example_output_files/centrimo_out/site_counts.txt \ ++ memechip_example_output_files/spamo_out_5/spamo.html \ ++ memechip_example_output_files/spamo_out_5/spamo.xml \ ++ memechip_example_output_files/motif_alignment.txt \ ++ memechip_example_output_files/seqs-shuffled \ ++ memechip_example_output_files/align_msgs.txt \ ++ memechip_example_output_files/sample-dna-Klf1.fa \ ++ spamo_example_output_files/hist_MA0039.2_db1_MA0307.1.png \ ++ spamo_example_output_files/hist_MA0039.2_db1_MA0300.1.png \ ++ spamo_example_output_files/hist_MA0039.2_db1_MA0140.1.png \ ++ spamo_example_output_files/hist_MA0039.2_db1_MA0217.1.png \ ++ spamo_example_output_files/spamo.html \ + spamo_example_output_files/hist_MA0039.2_db1_MA0013.1.png \ ++ spamo_example_output_files/hist_MA0039.2_db1_MA0429.1.png \ + spamo_example_output_files/hist_MA0039.2_db1_MA0035.2.png \ + spamo_example_output_files/hist_MA0039.2_db1_MA0037.1.png \ +- spamo_example_output_files/hist_MA0039.2_db1_MA0140.1.png \ +- spamo_example_output_files/hist_MA0039.2_db1_MA0217.1.png \ +- spamo_example_output_files/hist_MA0039.2_db1_MA0289.1.png \ +- spamo_example_output_files/hist_MA0039.2_db1_MA0300.1.png \ +- spamo_example_output_files/hist_MA0039.2_db1_MA0307.1.png \ + spamo_example_output_files/hist_MA0039.2_db1_MA0309.1.png \ +- spamo_example_output_files/hist_MA0039.2_db1_MA0429.1.png \ +- spamo_example_output_files/spamo.html \ ++ spamo_example_output_files/hist_MA0039.2_db1_MA0289.1.png \ + spamo_example_output_files/spamo.xml \ + tomtom_example_output_files/tomtom.html \ + tomtom_example_output_files/tomtom.txt \ +@@ -615,229 +608,222 @@ + EXAMPLE_OUTPUT_FILES = \ + ame_example_output_files/ame.html \ + ame_example_output_files/ame.txt \ ++ centrimo_example_output_files/site_counts.txt \ + centrimo_example_output_files/centrimo.html \ + centrimo_example_output_files/centrimo.txt \ +- centrimo_example_output_files/site_counts.txt \ +- dreme_example_output_files/dreme.html \ ++ dreme_example_output_files/m07rc_MCGCCCT.png \ ++ dreme_example_output_files/m03nc_MCRCCCA.png \ + dreme_example_output_files/dreme.txt \ +- dreme_example_output_files/dreme.xml \ ++ dreme_example_output_files/m15rc_TCACGTS.png \ ++ dreme_example_output_files/m06nc_CTGTSTS.png \ ++ dreme_example_output_files/dreme.html \ ++ dreme_example_output_files/m12rc_GTGKCTG.png \ + dreme_example_output_files/m01nc_CCMCRCCC.png \ +- dreme_example_output_files/m01rc_GGGYGKGG.png \ +- dreme_example_output_files/m02nc_BTTATCW.png \ + dreme_example_output_files/m02rc_WGATAAV.png \ +- dreme_example_output_files/m03nc_MCRCCCA.png \ +- dreme_example_output_files/m03rc_TGGGYGK.png \ +- dreme_example_output_files/m04nc_RARGAAA.png \ +- dreme_example_output_files/m04rc_TTTCYTY.png \ +- dreme_example_output_files/m05nc_AKAAAM.png \ +- dreme_example_output_files/m05rc_KTTTMT.png \ +- dreme_example_output_files/m06nc_CTGTSTS.png \ +- dreme_example_output_files/m06rc_SASACAG.png \ +- dreme_example_output_files/m07nc_AGGGCGK.png \ +- dreme_example_output_files/m07rc_MCGCCCT.png \ +- dreme_example_output_files/m08nc_CCTKCCY.png \ +- dreme_example_output_files/m08rc_RGGMAGG.png \ +- dreme_example_output_files/m09nc_TTAAAAW.png \ +- dreme_example_output_files/m09rc_WTTTTAA.png \ +- dreme_example_output_files/m10nc_AAATAH.png \ +- dreme_example_output_files/m10rc_DTATTT.png \ + dreme_example_output_files/m11nc_CATYTCC.png \ ++ dreme_example_output_files/m05nc_AKAAAM.png \ ++ dreme_example_output_files/m14nc_CTGGRGA.png \ + dreme_example_output_files/m11rc_GGARATG.png \ + dreme_example_output_files/m12nc_CAGMCAC.png \ +- dreme_example_output_files/m12rc_GTGKCTG.png \ ++ dreme_example_output_files/m02nc_BTTATCW.png \ ++ dreme_example_output_files/m10nc_AAATAH.png \ ++ dreme_example_output_files/m15nc_SACGTGA.png \ ++ dreme_example_output_files/m08nc_CCTKCCY.png \ + dreme_example_output_files/m13nc_CACAGY.png \ +- dreme_example_output_files/m13rc_RCTGTG.png \ +- dreme_example_output_files/m14nc_CTGGRGA.png \ ++ dreme_example_output_files/m09rc_WTTTTAA.png \ ++ dreme_example_output_files/m05rc_KTTTMT.png \ + dreme_example_output_files/m14rc_TCYCCAG.png \ +- dreme_example_output_files/m15nc_SACGTGA.png \ +- dreme_example_output_files/m15rc_TCACGTS.png \ +- fimo_example_output_files/cisml.css \ ++ dreme_example_output_files/m06rc_SASACAG.png \ ++ dreme_example_output_files/m04nc_RARGAAA.png \ ++ dreme_example_output_files/m04rc_TTTCYTY.png \ ++ dreme_example_output_files/m13rc_RCTGTG.png \ ++ dreme_example_output_files/dreme.xml \ ++ dreme_example_output_files/m09nc_TTAAAAW.png \ ++ dreme_example_output_files/m10rc_DTATTT.png \ ++ dreme_example_output_files/m03rc_TGGGYGK.png \ ++ dreme_example_output_files/m08rc_RGGMAGG.png \ ++ dreme_example_output_files/m07nc_AGGGCGK.png \ ++ dreme_example_output_files/m01rc_GGGYGKGG.png \ + fimo_example_output_files/cisml.xml \ +- fimo_example_output_files/fimo-to-html.xsl \ + fimo_example_output_files/fimo.gff \ +- fimo_example_output_files/fimo.html \ + fimo_example_output_files/fimo.txt \ ++ fimo_example_output_files/fimo-to-html.xsl \ ++ fimo_example_output_files/fimo.html \ + fimo_example_output_files/fimo.xml \ +- glam2_example_output_files/glam2.html \ ++ fimo_example_output_files/cisml.css \ + glam2_example_output_files/glam2.meme \ ++ glam2_example_output_files/logo6.eps \ ++ glam2_example_output_files/glam2.html \ ++ glam2_example_output_files/logo8.png \ ++ glam2_example_output_files/logo_ssc5.eps \ ++ glam2_example_output_files/logo_ssc4.eps \ ++ glam2_example_output_files/logo_ssc1.png \ ++ glam2_example_output_files/logo5.png \ ++ glam2_example_output_files/logo_ssc3.png \ ++ glam2_example_output_files/logo_ssc6.png \ ++ glam2_example_output_files/logo2.eps \ + glam2_example_output_files/glam2.txt \ + glam2_example_output_files/logo1.eps \ ++ glam2_example_output_files/logo4.png \ ++ glam2_example_output_files/logo_ssc2.eps \ + glam2_example_output_files/logo1.png \ +- glam2_example_output_files/logo10.eps \ +- glam2_example_output_files/logo10.png \ +- glam2_example_output_files/logo2.eps \ +- glam2_example_output_files/logo2.png \ +- glam2_example_output_files/logo3.eps \ ++ glam2_example_output_files/logo_ssc9.eps \ + glam2_example_output_files/logo3.png \ +- glam2_example_output_files/logo4.eps \ +- glam2_example_output_files/logo4.png \ ++ glam2_example_output_files/logo3.eps \ ++ glam2_example_output_files/logo_ssc8.eps \ ++ glam2_example_output_files/logo_ssc5.png \ + glam2_example_output_files/logo5.eps \ +- glam2_example_output_files/logo5.png \ +- glam2_example_output_files/logo6.eps \ +- glam2_example_output_files/logo6.png \ +- glam2_example_output_files/logo7.eps \ +- glam2_example_output_files/logo7.png \ +- glam2_example_output_files/logo8.eps \ +- glam2_example_output_files/logo8.png \ +- glam2_example_output_files/logo9.eps \ +- glam2_example_output_files/logo9.png \ +- glam2_example_output_files/logo_ssc1.eps \ +- glam2_example_output_files/logo_ssc1.png \ + glam2_example_output_files/logo_ssc10.eps \ ++ glam2_example_output_files/logo_ssc7.eps \ + glam2_example_output_files/logo_ssc10.png \ +- glam2_example_output_files/logo_ssc2.eps \ ++ glam2_example_output_files/logo_ssc8.png \ ++ glam2_example_output_files/logo9.eps \ ++ glam2_example_output_files/logo9.png \ + glam2_example_output_files/logo_ssc2.png \ +- glam2_example_output_files/logo_ssc3.eps \ +- glam2_example_output_files/logo_ssc3.png \ +- glam2_example_output_files/logo_ssc4.eps \ +- glam2_example_output_files/logo_ssc4.png \ +- glam2_example_output_files/logo_ssc5.eps \ +- glam2_example_output_files/logo_ssc5.png \ +- glam2_example_output_files/logo_ssc6.eps \ +- glam2_example_output_files/logo_ssc6.png \ +- glam2_example_output_files/logo_ssc7.eps \ ++ glam2_example_output_files/logo10.eps \ + glam2_example_output_files/logo_ssc7.png \ +- glam2_example_output_files/logo_ssc8.eps \ +- glam2_example_output_files/logo_ssc8.png \ +- glam2_example_output_files/logo_ssc9.eps \ + glam2_example_output_files/logo_ssc9.png \ +- glam2scan_example_output_files/glam2scan.html \ ++ glam2_example_output_files/logo7.eps \ ++ glam2_example_output_files/logo2.png \ ++ glam2_example_output_files/logo_ssc1.eps \ ++ glam2_example_output_files/logo_ssc6.eps \ ++ glam2_example_output_files/logo10.png \ ++ glam2_example_output_files/logo4.eps \ ++ glam2_example_output_files/logo8.eps \ ++ glam2_example_output_files/logo7.png \ ++ glam2_example_output_files/logo6.png \ ++ glam2_example_output_files/logo_ssc4.png \ ++ glam2_example_output_files/logo_ssc3.eps \ + glam2scan_example_output_files/glam2scan.txt \ +- gomo_example_output_files/gomo.html \ ++ glam2scan_example_output_files/glam2scan.html \ + gomo_example_output_files/gomo.xml \ +- gomo_example_output_files/res/logocrp.png \ ++ gomo_example_output_files/gomo.html \ + gomo_example_output_files/res/logonagC.png \ ++ gomo_example_output_files/res/logocrp.png \ + gomo_example_output_files/res/logonarP.png \ +- mast_example_output_files/mast.html \ +- mast_example_output_files/mast.txt \ + mast_example_output_files/mast.xml \ +- mcast_example_output_files/block-diagram.xsl \ ++ mast_example_output_files/mast.txt \ ++ mast_example_output_files/mast.html \ + mcast_example_output_files/cisml.xml \ ++ mcast_example_output_files/mcast.xml \ + mcast_example_output_files/constants.xsl \ +- mcast_example_output_files/mcast-to-bed.xsl \ ++ mcast_example_output_files/mcast.txt \ ++ mcast_example_output_files/block-diagram.xsl \ ++ mcast_example_output_files/meme.css.xsl \ ++ mcast_example_output_files/mcast.html \ + mcast_example_output_files/mcast-to-html.xsl \ + mcast_example_output_files/mcast-to-text.xsl \ + mcast_example_output_files/mcast.bed \ +- mcast_example_output_files/mcast.html \ +- mcast_example_output_files/mcast.txt \ +- mcast_example_output_files/mcast.xml \ +- mcast_example_output_files/meme.css.xsl \ ++ mcast_example_output_files/mcast-to-bed.xsl \ ++ meme_example_output_files/logo_rc2.eps \ ++ meme_example_output_files/logo_rc3.eps \ ++ meme_example_output_files/meme.txt \ ++ meme_example_output_files/logo2.eps \ + meme_example_output_files/logo1.eps \ + meme_example_output_files/logo1.png \ +- meme_example_output_files/logo2.eps \ +- meme_example_output_files/logo2.png \ +- meme_example_output_files/logo3.eps \ +- meme_example_output_files/logo3.png \ ++ meme_example_output_files/logo_rc3.png \ + meme_example_output_files/logo_rc1.eps \ ++ meme_example_output_files/logo3.png \ ++ meme_example_output_files/logo3.eps \ ++ meme_example_output_files/meme.html \ + meme_example_output_files/logo_rc1.png \ +- meme_example_output_files/logo_rc2.eps \ ++ meme_example_output_files/logo2.png \ + meme_example_output_files/logo_rc2.png \ +- meme_example_output_files/logo_rc3.eps \ +- meme_example_output_files/logo_rc3.png \ +- meme_example_output_files/meme.html \ +- meme_example_output_files/meme.txt \ + meme_example_output_files/meme.xml \ +- memechip_example_output_files/align_msgs.txt \ +- memechip_example_output_files/background \ +- memechip_example_output_files/combined.meme \ ++ memechip_example_output_files/centrimo_out/site_counts.txt \ ++ memechip_example_output_files/centrimo_out/centrimo.html \ ++ memechip_example_output_files/centrimo_out/centrimo.txt \ ++ memechip_example_output_files/fimo_out_5/cisml.xml \ ++ memechip_example_output_files/fimo_out_5/fimo.gff \ ++ memechip_example_output_files/fimo_out_5/fimo.txt \ ++ memechip_example_output_files/fimo_out_5/fimo-to-html.xsl \ ++ memechip_example_output_files/fimo_out_5/fimo.html \ ++ memechip_example_output_files/fimo_out_5/fimo.xml \ ++ memechip_example_output_files/fimo_out_5/cisml.css \ ++ memechip_example_output_files/fimo_out_2/cisml.xml \ ++ memechip_example_output_files/fimo_out_2/fimo.gff \ ++ memechip_example_output_files/fimo_out_2/fimo.txt \ ++ memechip_example_output_files/fimo_out_2/fimo-to-html.xsl \ ++ memechip_example_output_files/fimo_out_2/fimo.html \ ++ memechip_example_output_files/fimo_out_2/fimo.xml \ ++ memechip_example_output_files/fimo_out_2/cisml.css \ ++ memechip_example_output_files/dreme_out/dreme.txt \ ++ memechip_example_output_files/dreme_out/dreme.html \ ++ memechip_example_output_files/dreme_out/m02rc_WGATAA.png \ ++ memechip_example_output_files/dreme_out/m03nc_AGAWA.png \ ++ memechip_example_output_files/dreme_out/m02nc_TTATCW.png \ ++ memechip_example_output_files/dreme_out/m03rc_TWTCT.png \ ++ memechip_example_output_files/dreme_out/dreme.xml \ ++ memechip_example_output_files/dreme_out/m01nc_GGGYGK.png \ ++ memechip_example_output_files/dreme_out/m01rc_MCRCCC.png \ ++ memechip_example_output_files/seqs-sampled \ ++ memechip_example_output_files/spamo_out_3/spamo.html \ ++ memechip_example_output_files/spamo_out_3/spamo.xml \ + memechip_example_output_files/index.html \ +- memechip_example_output_files/meme_msgs.txt \ +- memechip_example_output_files/motif_alignment.txt \ + memechip_example_output_files/progress_log.txt \ +- memechip_example_output_files/sample-dna-Klf1.fa \ +- memechip_example_output_files/seqs-centered \ +- memechip_example_output_files/seqs-discarded \ +- memechip_example_output_files/seqs-sampled \ +- memechip_example_output_files/seqs-shuffled \ +- memechip_example_output_files/spamo_out_7/spamo.html \ +- memechip_example_output_files/spamo_out_7/spamo.xml \ +- memechip_example_output_files/spamo_out_6/spamo.html \ +- memechip_example_output_files/spamo_out_6/spamo.xml \ +- memechip_example_output_files/spamo_out_5/spamo.html \ +- memechip_example_output_files/spamo_out_5/spamo.xml \ ++ memechip_example_output_files/combined.meme \ + memechip_example_output_files/spamo_out_4/spamo.html \ + memechip_example_output_files/spamo_out_4/spamo.xml \ +- memechip_example_output_files/spamo_out_3/spamo.html \ +- memechip_example_output_files/spamo_out_3/spamo.xml \ +- memechip_example_output_files/spamo_out_2/spamo.html \ +- memechip_example_output_files/spamo_out_2/spamo.xml \ + memechip_example_output_files/spamo_out_1/spamo.html \ + memechip_example_output_files/spamo_out_1/spamo.xml \ +- memechip_example_output_files/fimo_out_7/cisml.css \ +- memechip_example_output_files/fimo_out_7/cisml.xml \ +- memechip_example_output_files/fimo_out_7/fimo-to-html.xsl \ +- memechip_example_output_files/fimo_out_7/fimo.gff \ +- memechip_example_output_files/fimo_out_7/fimo.html \ +- memechip_example_output_files/fimo_out_7/fimo.txt \ +- memechip_example_output_files/fimo_out_7/fimo.xml \ +- memechip_example_output_files/fimo_out_6/cisml.css \ +- memechip_example_output_files/fimo_out_6/cisml.xml \ +- memechip_example_output_files/fimo_out_6/fimo-to-html.xsl \ +- memechip_example_output_files/fimo_out_6/fimo.gff \ +- memechip_example_output_files/fimo_out_6/fimo.html \ +- memechip_example_output_files/fimo_out_6/fimo.txt \ +- memechip_example_output_files/fimo_out_6/fimo.xml \ +- memechip_example_output_files/fimo_out_5/cisml.css \ +- memechip_example_output_files/fimo_out_5/cisml.xml \ +- memechip_example_output_files/fimo_out_5/fimo-to-html.xsl \ +- memechip_example_output_files/fimo_out_5/fimo.gff \ +- memechip_example_output_files/fimo_out_5/fimo.html \ +- memechip_example_output_files/fimo_out_5/fimo.txt \ +- memechip_example_output_files/fimo_out_5/fimo.xml \ +- memechip_example_output_files/fimo_out_4/cisml.css \ ++ memechip_example_output_files/seqs-centered \ ++ memechip_example_output_files/background \ ++ memechip_example_output_files/meme_tomtom_out/tomtom.html \ ++ memechip_example_output_files/meme_tomtom_out/tomtom.txt \ ++ memechip_example_output_files/meme_tomtom_out/tomtom.xml \ + memechip_example_output_files/fimo_out_4/cisml.xml \ +- memechip_example_output_files/fimo_out_4/fimo-to-html.xsl \ + memechip_example_output_files/fimo_out_4/fimo.gff \ +- memechip_example_output_files/fimo_out_4/fimo.html \ + memechip_example_output_files/fimo_out_4/fimo.txt \ ++ memechip_example_output_files/fimo_out_4/fimo-to-html.xsl \ ++ memechip_example_output_files/fimo_out_4/fimo.html \ + memechip_example_output_files/fimo_out_4/fimo.xml \ +- memechip_example_output_files/fimo_out_3/cisml.css \ ++ memechip_example_output_files/fimo_out_4/cisml.css \ + memechip_example_output_files/fimo_out_3/cisml.xml \ +- memechip_example_output_files/fimo_out_3/fimo-to-html.xsl \ + memechip_example_output_files/fimo_out_3/fimo.gff \ +- memechip_example_output_files/fimo_out_3/fimo.html \ + memechip_example_output_files/fimo_out_3/fimo.txt \ ++ memechip_example_output_files/fimo_out_3/fimo-to-html.xsl \ ++ memechip_example_output_files/fimo_out_3/fimo.html \ + memechip_example_output_files/fimo_out_3/fimo.xml \ +- memechip_example_output_files/fimo_out_2/cisml.css \ +- memechip_example_output_files/fimo_out_2/cisml.xml \ +- memechip_example_output_files/fimo_out_2/fimo-to-html.xsl \ +- memechip_example_output_files/fimo_out_2/fimo.gff \ +- memechip_example_output_files/fimo_out_2/fimo.html \ +- memechip_example_output_files/fimo_out_2/fimo.txt \ +- memechip_example_output_files/fimo_out_2/fimo.xml \ +- memechip_example_output_files/fimo_out_1/cisml.css \ ++ memechip_example_output_files/fimo_out_3/cisml.css \ + memechip_example_output_files/fimo_out_1/cisml.xml \ +- memechip_example_output_files/fimo_out_1/fimo-to-html.xsl \ + memechip_example_output_files/fimo_out_1/fimo.gff \ +- memechip_example_output_files/fimo_out_1/fimo.html \ + memechip_example_output_files/fimo_out_1/fimo.txt \ ++ memechip_example_output_files/fimo_out_1/fimo-to-html.xsl \ ++ memechip_example_output_files/fimo_out_1/fimo.html \ + memechip_example_output_files/fimo_out_1/fimo.xml \ ++ memechip_example_output_files/fimo_out_1/cisml.css \ ++ memechip_example_output_files/spamo_out_2/spamo.html \ ++ memechip_example_output_files/spamo_out_2/spamo.xml \ ++ memechip_example_output_files/meme_out/logo_rc2.eps \ ++ memechip_example_output_files/meme_out/logo_rc3.eps \ ++ memechip_example_output_files/meme_out/meme.txt \ ++ memechip_example_output_files/meme_out/logo2.eps \ ++ memechip_example_output_files/meme_out/logo1.eps \ ++ memechip_example_output_files/meme_out/logo_rc1.eps \ ++ memechip_example_output_files/meme_out/logo3.eps \ ++ memechip_example_output_files/meme_out/meme.html \ ++ memechip_example_output_files/meme_out/meme.xml \ ++ memechip_example_output_files/seqs-discarded \ + memechip_example_output_files/dreme_tomtom_out/tomtom.html \ + memechip_example_output_files/dreme_tomtom_out/tomtom.txt \ + memechip_example_output_files/dreme_tomtom_out/tomtom.xml \ +- memechip_example_output_files/dreme_out/dreme.html \ +- memechip_example_output_files/dreme_out/dreme.txt \ +- memechip_example_output_files/dreme_out/dreme.xml \ +- memechip_example_output_files/dreme_out/m01nc_GGGYGK.png \ +- memechip_example_output_files/dreme_out/m01rc_MCRCCC.png \ +- memechip_example_output_files/dreme_out/m02nc_TTATCW.png \ +- memechip_example_output_files/dreme_out/m02rc_WGATAA.png \ +- memechip_example_output_files/dreme_out/m03nc_AGAWA.png \ +- memechip_example_output_files/dreme_out/m03rc_TWTCT.png \ +- memechip_example_output_files/centrimo_out/centrimo.html \ +- memechip_example_output_files/centrimo_out/centrimo.txt \ +- memechip_example_output_files/centrimo_out/site_counts.txt \ ++ memechip_example_output_files/spamo_out_5/spamo.html \ ++ memechip_example_output_files/spamo_out_5/spamo.xml \ ++ memechip_example_output_files/motif_alignment.txt \ ++ memechip_example_output_files/seqs-shuffled \ ++ memechip_example_output_files/align_msgs.txt \ ++ memechip_example_output_files/sample-dna-Klf1.fa \ ++ spamo_example_output_files/hist_MA0039.2_db1_MA0307.1.png \ ++ spamo_example_output_files/hist_MA0039.2_db1_MA0300.1.png \ ++ spamo_example_output_files/hist_MA0039.2_db1_MA0140.1.png \ ++ spamo_example_output_files/hist_MA0039.2_db1_MA0217.1.png \ ++ spamo_example_output_files/spamo.html \ + spamo_example_output_files/hist_MA0039.2_db1_MA0013.1.png \ ++ spamo_example_output_files/hist_MA0039.2_db1_MA0429.1.png \ + spamo_example_output_files/hist_MA0039.2_db1_MA0035.2.png \ + spamo_example_output_files/hist_MA0039.2_db1_MA0037.1.png \ +- spamo_example_output_files/hist_MA0039.2_db1_MA0140.1.png \ +- spamo_example_output_files/hist_MA0039.2_db1_MA0217.1.png \ +- spamo_example_output_files/hist_MA0039.2_db1_MA0289.1.png \ +- spamo_example_output_files/hist_MA0039.2_db1_MA0300.1.png \ +- spamo_example_output_files/hist_MA0039.2_db1_MA0307.1.png \ + spamo_example_output_files/hist_MA0039.2_db1_MA0309.1.png \ +- spamo_example_output_files/hist_MA0039.2_db1_MA0429.1.png \ +- spamo_example_output_files/spamo.html \ ++ spamo_example_output_files/hist_MA0039.2_db1_MA0289.1.png \ + spamo_example_output_files/spamo.xml \ + tomtom_example_output_files/tomtom.html \ + tomtom_example_output_files/tomtom.txt \ +diff -ruN a/doc/examples/mast_example_output_files/mast.html b/doc/examples/mast_example_output_files/mast.html +--- a/doc/examples/mast_example_output_files/mast.html 2014-05-13 08:33:41.000000000 +1000 ++++ b/doc/examples/mast_example_output_files/mast.html 2014-10-07 16:20:12.000000000 +1000 +@@ -1983,7 +1983,7 @@ +
    +
    + +

    +@@ -2032,7 +2032,7 @@ + adh.s + 33 + 9996 +-Fri Jan 17 15:20:49 2014 ++Tue Oct 7 14:14:10 2014 + + + Total +@@ -2044,7 +2044,7 @@ +

    +

    Motifs

    +
    +-

    The following motifs were supplied to MAST from "meme.adh.zoops" last modified on Mon Apr 14 15:15:01 2014. ++

    The following motifs were supplied to MAST from "meme.adh.zoops" last modified on Tue Oct 7 14:14:08 2014. +

    + + +@@ -2530,7 +2530,7 @@ +
    + +
    +-
    MAST version
    4.10.0 (Release date: Tue May 06 16:46:04 2014 +1000) ++
    MAST version
    4.10.0 (Release date: Wed May 21 10:35:36 2014 +1000) +
    +
    +
    Reference
    +@@ -2543,7 +2543,7 @@ +
    +
    Command line summary
    +
    Background letter frequencies (from non-redundant database):
    A: 0.073   C: 0.018   D: 0.052   E: 0.062   F: 0.040   G: 0.069   H: 0.022   I: 0.056   K: 0.058   L: 0.092   M: 0.023   N: 0.046   P: 0.051   Q: 0.041   R: 0.052   S: 0.074   T: 0.059   V: 0.064   W: 0.013   Y: 0.033
    +-
    Result calculation took 0.035 seconds
    ++
    Result calculation took 0.050 seconds
    +
    + show model parameters... + +diff -ruN a/doc/examples/mast_example_output_files/mast.txt b/doc/examples/mast_example_output_files/mast.txt +--- a/doc/examples/mast_example_output_files/mast.txt 2014-05-13 08:33:41.000000000 +1000 ++++ b/doc/examples/mast_example_output_files/mast.txt 2014-10-07 16:20:12.000000000 +1000 +@@ -1,7 +1,7 @@ + ******************************************************************************** + MAST - Motif Alignment and Search Tool + ******************************************************************************** +- MAST version 4.10.0 (Release date: Tue May 06 16:46:04 2014 +1000) ++ MAST version 4.10.0 (Release date: Wed May 21 10:35:36 2014 +1000) + + For further information on how to interpret these results or to get + a copy of the MAST software please access http://meme.nbcr.net. +@@ -23,7 +23,7 @@ + DATABASE AND MOTIFS + ******************************************************************************** + DATABASE adh.s (peptide) +- Last updated on Fri Jan 17 15:20:49 2014 ++ Last updated on Tue Oct 7 14:14:10 2014 + Database contains 33 sequences, 9996 residues + + MOTIFS meme.adh.zoops (peptide) +@@ -846,7 +846,7 @@ + ******************************************************************************** + + +-CPU: d-108-179-169-207.dhcp4.washington.edu +-Time 0.035000 secs. ++CPU: IMB12-010665 ++Time 0.050000 secs. + + mast -oc mast_example_output_files meme.adh.zoops adh.s +diff -ruN a/doc/examples/mast_example_output_files/mast.xml b/doc/examples/mast_example_output_files/mast.xml +--- a/doc/examples/mast_example_output_files/mast.xml 2014-05-13 08:33:41.000000000 +1000 ++++ b/doc/examples/mast_example_output_files/mast.xml 2014-10-07 16:20:12.000000000 +1000 +@@ -62,7 +62,7 @@ + + + ]> +- ++ + + mast -oc mast_example_output_files meme.adh.zoops adh.s + 0.60 +@@ -73,8 +73,8 @@ + + 0.0001 + 0.0001 +- d-108-179-169-207.dhcp4.washington.edu +- Mon May 12 15:33:41 2014 ++ IMB12-010665 ++ Tue Oct 7 16:20:12 2014 + + + +@@ -98,13 +98,13 @@ + + + +- ++ + + + + + +- ++ + + + +@@ -604,5 +604,5 @@ + + + +- ++ + +diff -ruN a/doc/examples/mcast_example_output_files/constants.xsl b/doc/examples/mcast_example_output_files/constants.xsl +--- a/doc/examples/mcast_example_output_files/constants.xsl 2014-05-13 08:33:42.000000000 +1000 ++++ b/doc/examples/mcast_example_output_files/constants.xsl 2014-10-07 16:20:12.000000000 +1000 +@@ -1,5 +1,5 @@ + + +- ++ + + +diff -ruN a/doc/examples/mcast_example_output_files/mcast.html b/doc/examples/mcast_example_output_files/mcast.html +--- a/doc/examples/mcast_example_output_files/mcast.html 2014-05-13 08:33:42.000000000 +1000 ++++ b/doc/examples/mcast_example_output_files/mcast.html 2014-10-07 16:20:12.000000000 +1000 +@@ -1171,7 +1171,7 @@ + +
    + +

    +@@ -1660,7 +1660,7 @@ +

    + +
    +-
    MCAST version
    4.10.0 (Release date: Tue May 06 16:46:04 2014 +1000) ++
    MCAST version
    4.10.0 (Release date: Wed May 21 10:35:36 2014 +1000) +
    +
    +
    Command line summary
    +diff -ruN a/doc/examples/mcast_example_output_files/mcast.xml b/doc/examples/mcast_example_output_files/mcast.xml +--- a/doc/examples/mcast_example_output_files/mcast.xml 2014-05-13 08:33:42.000000000 +1000 ++++ b/doc/examples/mcast_example_output_files/mcast.xml 2014-10-07 16:20:12.000000000 +1000 +@@ -1,6 +1,6 @@ + + +- ++ + xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" + xsi:schemaLocation= xmlns:mhmmscan="http://noble.gs.washington.edu/schema/fimo" + > +diff -ruN a/doc/examples/memechip_example_output_files/align_msgs.txt b/doc/examples/memechip_example_output_files/align_msgs.txt +--- a/doc/examples/memechip_example_output_files/align_msgs.txt 2014-05-13 08:34:33.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/align_msgs.txt 2014-10-07 17:18:22.000000000 +1000 +@@ -1,3 +1,3 @@ + +-Warning: Target database size too small (23). Provide at least 50 motifs for accurate p-value computation ++Warning: Target database size too small (26). Provide at least 50 motifs for accurate p-value computation + +diff -ruN a/doc/examples/memechip_example_output_files/centrimo_out/centrimo.html b/doc/examples/memechip_example_output_files/centrimo_out/centrimo.html +--- a/doc/examples/memechip_example_output_files/centrimo_out/centrimo.html 2014-05-13 08:34:31.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/centrimo_out/centrimo.html 2014-10-07 17:18:02.000000000 +1000 +@@ -7,14 +7,15 @@ + //@JSON_VAR data + var data = { + "version": "4.10.0", +- "revision": "4f3599b86c7ee1597e34ec256e25771bc545b1dd", +- "release": "Tue May 06 16:46:04 2014 +1000", ++ "revision": "994f5bf522b6536cb8e2324fa497ed91a1404a20", ++ "release": "Wed May 21 10:35:36 2014 +1000", + "program": "CentriMo", + "cmd": [ + "centrimo", "-seqlen", "500", "-verbosity", "1", "-oc", + "memechip_example_output_files\/centrimo_out", "-bgfile", + "memechip_example_output_files\/background", + "memechip_example_output_files\/sample-dna-Klf1.fa", ++ "memechip_example_output_files\/meme_out\/meme.xml", + "memechip_example_output_files\/dreme_out\/dreme.xml", + "JASPAR_CORE_2009.meme" + ], +@@ -35,7 +36,7 @@ + "mcc": false + }, + "seqlen": 500, +- "tested": 479, ++ "tested": 482, + "sequence_db": { + "source": "memechip_example_output_files\/sample-dna-Klf1.fa", + "count": 904, +@@ -43,6 +44,9 @@ + }, + "motif_dbs": [ + { ++ "source": "memechip_example_output_files\/meme_out\/meme.xml", ++ "count": 3 ++ }, { + "source": "memechip_example_output_files\/dreme_out\/dreme.xml", + "count": 3 + }, { +@@ -507,6 +511,176 @@ + "motifs": [ + { + "db": 0, ++ "id": "1", ++ "alt": "MEME", ++ "len": 12, ++ "motif_evalue": "3.0e-225", ++ "motif_nsites": 225, ++ "n_tested": 244, ++ "score_threshold": 5, ++ "pwm": [ ++ [0.16118, 0.39213, 0.32105, 0.12564], ++ [0.352206, 0.156679, 0.329935, 0.16118], ++ [0.347763, 0.0322901, 0.600925, 0.0190213], ++ [0.0590036, 0.800837, 0.0767143, 0.0634456], ++ [0.0134408, 0.897488, 0.00455042, 0.0845202], ++ [0.684254, 0.284426, 0.0134355, 0.0178838], ++ [0.000113727, 0.999664, 0.000108396, 0.000113727], ++ [0.795316, 0.000108396, 0.191134, 0.0134408], ++ [0.00569325, 0.991864, 0.00119191, 0.00125122], ++ [0.0101363, 0.974094, 0.010077, 0.00569325], ++ [0.00125122, 0.987421, 0.00119191, 0.0101363], ++ [0.464405, 0.100011, 0.00227643, 0.433308] ++ ], ++ "total_sites": 663, ++ "sites": [ ++ 2, 0, 0, 0, 0, 1, 2, 1, 1, 0, 0, 0, 0, 3, 0, 0, 0, 0, 2, 0, 0, ++ 2, 0, 2, 1, 2, 1, 2, 0, 1, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, ++ 1, 0, 0, 0, 0, 2, 0, 1, 0, 2, 3, 0, 0, 1, 1, 0, 0, 0, 0, 0, 0, ++ 0, 0, 0, 1, 1, 1, 1, 0, 0, 1, 0, 1, 2, 3, 0, 0, 2, 2, 0, 0, 0, ++ 1, 2, 0, 0, 1, 0, 0, 0, 0, 3, 0, 2, 0, 2, 0, 0, 1, 0, 1, 0, 1, ++ 0, 0, 0, 0, 2, 5, 0, 0, 0, 1, 0, 0, 1, 2, 2, 1, 1, 2, 3, 0, 1, ++ 0, 1, 1, 2, 0, 2, 1, 3, 0, 0, 2, 1, 0, 1, 2, 0, 0, 1, 1, 0, 1, ++ 1, 2, 0, 2, 0, 0, 1, 0, 0, 2, 2, 2, 0, 2, 1, 2, 2, 2, 4, 1, 0, ++ 1, 1, 0, 3, 2, 2, 3, 0, 1, 1, 0, 0, 2, 2, 4, 1, 0.5, 0, 1, 2, 1, ++ 0, 4, 1, 1, 1, 0, 2, 4, 2, 1, 2, 2, 2, 1.5, 0, 2, 3, 2, 3, 2, 6, ++ 3, 3, 1, 3, 1, 3, 3, 3, 6, 7, 3, 2, 5, 4, 2, 4, 5, 4, 7, 3, 5, ++ 4, 8, 2, 5, 6, 4, 6, 2, 4, 2, 8, 3, 6, 4, 4, 7, 6, 5, 5, 2, 4, ++ 6, 4, 4, 2, 4, 4, 5, 4, 3, 4, 3, 5, 3, 4, 3, 0, 4, 2, 3, 4, 2, ++ 3, 2, 3, 6, 3, 1, 6.5, 3, 0, 2, 6, 2, 2, 1, 5, 0, 4, 2, 3, 5, 3, ++ 1, 3, 2, 3, 2, 3, 0, 2, 2, 1, 2, 1, 2, 1, 2, 2, 1, 0, 3, 2, 0, ++ 0, 1, 1, 1, 2, 0, 1, 0, 1, 0, 2, 1, 2, 1, 0, 0, 1.5, 2, 1, 1, 4, ++ 1.5, 1, 0, 1, 0, 0, 1, 2, 0, 0, 3, 1.5, 1, 1, 0, 2, 5, 4, 1, 1, ++ 0, 1, 1, 0, 2, 0, 1, 1, 0, 1, 0, 1, 0, 0, 2, 0, 0, 1, 1, 0, 0, ++ 1, 0, 3, 1, 1, 2, 1, 0, 0, 0, 0, 0, 0, 2, 0, 1, 1, 0, 0, 1, 0, ++ 0, 0, 0, 0, 1, 0, 1, 1, 0, 1, 1, 0, 0, 0, 0, 0, 1, 2, 1, 0, 0, ++ 0, 0, 1, 0, 0, 0, 0, 1, 1, 1, 0, 0, 0, 2, 0, 0, 1, 0, 0, 0, 0, ++ 1, 0, 0, 0, 0, 1, 0, 1, 0, 0, 0, 1, 1, 0, 0, 1, 1, 1, 0, 1, 1, ++ 0, 0, 0, 1, 2, 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 1, 3, 1, 3, 2, ++ 0, 0, 0, 0, 2, 1, 0 ++ ], ++ "seqs": [ ++ 0, 7, 15, 16, 18, 19, 25, 28, 30, 31, 32, 33, 35, 40, 41, 43, ++ 48, 55, 58, 59, 62, 71, 77, 78, 82, 84, 88, 91, 92, 95, 100, ++ 101, 102, 106, 117, 118, 119, 121, 122, 124, 125, 131, 135, 136, ++ 140, 141, 145, 155, 157, 159, 161, 163, 164, 165, 170, 175, 179, ++ 180, 181, 184, 185, 186, 187, 191, 192, 193, 194, 198, 203, 204, ++ 212, 215, 217, 222, 223, 224, 225, 227, 230, 231, 233, 235, 237, ++ 238, 239, 242, 244, 246, 247, 248, 249, 251, 253, 254, 255, 258, ++ 262, 268, 270, 274, 276, 279, 284, 285, 287, 290, 293, 294, 295, ++ 299, 304, 309, 310, 312, 313, 314, 318, 327, 334, 341, 342, 343, ++ 345, 346, 347, 348, 350, 352, 356, 360, 361, 367, 369, 370, 373, ++ 379, 381, 383, 385, 386, 389, 391, 392, 393, 396, 397, 401, 407, ++ 411, 414, 417, 419, 420, 425, 428, 429, 430, 438, 441, 442, 443, ++ 444, 445, 447, 449, 456, 460, 462, 463, 464, 466, 469, 470, 471, ++ 474, 475, 476, 477, 478, 483, 486, 488, 491, 492, 501, 502, 504, ++ 508, 510, 514, 521, 522, 523, 528, 540, 543, 544, 545, 548, 549, ++ 551, 560, 561, 564, 565, 566, 567, 568, 571, 573, 574, 575, 576, ++ 579, 580, 581, 582, 586, 587, 590, 592, 593, 600, 602, 604, 605, ++ 608, 609, 610, 611, 612, 615, 618, 620, 622, 623, 624, 626, 631, ++ 633, 634, 638, 642, 649, 652, 653, 657, 659, 661, 662, 667, 668, ++ 672, 674, 675, 676, 678, 680, 684, 688, 690, 693, 694, 695, 696, ++ 698, 701, 704, 705, 710, 711, 712, 716, 717, 724, 732, 733, 741, ++ 742, 744, 747, 750, 754, 755, 756, 757, 758, 759, 760, 762, 765, ++ 770, 775, 776, 780, 783, 784, 785, 786, 788, 789, 791, 792, 795, ++ 799, 800, 801, 803, 804, 807, 809, 811, 812, 813, 816, 824, 826, ++ 828, 829, 830, 834, 837, 838, 840, 841, 842, 843, 850, 853, 854, ++ 855, 864, 866, 876, 877, 881, 882, 883, 888, 892, 895, 897, 898, ++ 900, 901 ++ ], ++ "peaks": [ ++ { ++ "center": 0, ++ "spread": 99, ++ "sites": 344, ++ "log_adj_pvalue": -160.239 ++ } ++ ] ++ }, { ++ "db": 0, ++ "id": "2", ++ "alt": "MEME", ++ "len": 8, ++ "motif_evalue": "7.4e-025", ++ "motif_nsites": 176, ++ "n_tested": 246, ++ "score_threshold": 5, ++ "pwm": [ ++ [0.211707, 0.376311, 0.308169, 0.103813], ++ [0.573683, 0.0171739, 0.000138558, 0.409004], ++ [0.000145372, 0.000138558, 0.999571, 0.000145372], ++ [0.999578, 0.000138558, 0.000138558, 0.000145372], ++ [0.000145372, 0.000138558, 0.000138558, 0.999578], ++ [0.999578, 0.000138558, 0.000138558, 0.000145372], ++ [0.999578, 0.000138558, 0.000138558, 0.000145372], ++ [0.27985, 0.18324, 0.518276, 0.0186349] ++ ], ++ "total_sites": 504, ++ "sites": [ ++ 0, 2, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 0, 0, ++ 1, 0, 0, 1, 1, 1, 1, 0, 1, 1, 0, 0, 1, 1, 0, 0, 0, 0, 1, 0, 1, ++ 0, 1, 0, 1, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, ++ 0.5, 3, 0, 0, 1, 1, 1, 0, 2, 0, 0, 1, 0, 0, 1, 1, 1, 2, 0, 0, 0, ++ 0, 0, 2, 0, 0, 0, 1, 1, 0, 0, 1, 0, 0, 0, 1, 1, 0, 0, 1, 0, 1, ++ 0, 0, 0, 1, 0, 0, 1, 0, 0, 0, 1, 0, 0, 2, 2, 1, 0, 1, 1, 0, 1, ++ 1, 0, 1, 0, 1, 0, 0, 1, 0, 0, 3, 2, 0, 0, 0, 1, 2, 0, 0, 0, 0, ++ 0, 0, 1, 0, 1, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 5, 1, 0, 4, 0, ++ 0.5, 1, 3, 1, 0, 2, 1, 1, 0.5, 2, 3, 2, 0, 1, 2, 4, 1, 0, 1, 3, ++ 1, 4, 1, 0, 1, 0, 3, 2, 2, 3, 4, 2, 4, 0, 0, 0, 1, 4, 1, 0, 1, ++ 5, 2, 3, 3, 0, 3, 5, 1, 3, 3, 3, 1, 0, 1, 4, 2, 2, 3, 2, 3, 0, ++ 5, 5, 1.5, 1, 1, 2, 4, 5, 3, 0.5, 2, 3, 2, 4, 4, 4, 2, 1, 3, 4, ++ 1, 3, 4, 2, 0, 2, 4, 5, 2, 0, 3, 1.5, 0, 1, 1, 3, 1, 4, 5, 3, 2, ++ 1, 0, 3, 3, 0, 2, 4, 2, 2, 6, 0, 2, 0, 1, 6, 2, 0, 0.5, 3, 2, 3, ++ 1, 1, 3, 2, 3, 1, 2, 6, 1, 3, 2.5, 0, 0.5, 1, 3.5, 2, 1, 1, 1, ++ 0, 1, 1, 2, 2, 1.5, 3, 1, 2, 1, 0, 0, 1, 0, 0, 1, 2, 0, 1, 0, 1, ++ 4, 1.5, 1, 2, 0, 4, 1.5, 0, 0, 0, 4, 2, 0, 0, 2, 0, 0, 1, 0, 0, ++ 0, 0, 1, 1, 0, 0, 2, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 1, 1, 2, ++ 1, 3, 1, 1, 1, 0, 2, 0, 0, 0, 0, 1, 1, 1, 1, 1, 2, 0, 0, 1, 1, ++ 2, 1, 2, 0, 0, 2, 0, 1, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0.5, 1, 0, ++ 0.5, 0, 0, 0, 0, 0, 0.5, 1, 0, 1, 1, 0, 0, 1, 1, 0, 1, 0, 0, 1, ++ 2, 0, 1, 0, 0, 0, 0, 0, 2, 0, 0, 0, 1.5, 0, 0.5, 0, 1, 2, 0, 1, ++ 0, 0, 0, 1, 1, 1, 2, 0, 0, 1, 0, 0, 0, 0, 1, 0, 1, 0, 0, 0, 1, ++ 0, 0, 0, 1, 0, 1, 0, 2, 0, 0, 0, 1, 0, 0, 0, 1, 1 ++ ], ++ "seqs": [ ++ 3, 7, 8, 10, 16, 18, 20, 25, 32, 37, 41, 43, 48, 52, 55, 57, 62, ++ 64, 66, 69, 73, 74, 75, 78, 79, 81, 82, 87, 88, 91, 93, 101, ++ 104, 105, 108, 110, 112, 118, 119, 120, 121, 122, 123, 126, 131, ++ 133, 134, 135, 137, 139, 141, 145, 146, 151, 154, 155, 157, 158, ++ 161, 162, 163, 164, 165, 166, 167, 170, 173, 175, 178, 180, 181, ++ 183, 184, 185, 187, 188, 189, 191, 192, 193, 194, 202, 205, 214, ++ 217, 223, 224, 225, 226, 227, 228, 230, 231, 232, 233, 238, 240, ++ 242, 244, 246, 249, 251, 252, 253, 255, 266, 268, 273, 276, 277, ++ 278, 280, 282, 284, 295, 298, 299, 300, 301, 305, 312, 314, 318, ++ 321, 325, 327, 334, 341, 343, 345, 347, 350, 352, 355, 360, 361, ++ 365, 370, 372, 379, 381, 383, 385, 387, 389, 390, 395, 397, 401, ++ 402, 404, 407, 408, 413, 414, 415, 416, 422, 425, 427, 428, 437, ++ 438, 441, 442, 444, 445, 447, 448, 449, 452, 453, 457, 458, 459, ++ 460, 463, 464, 465, 466, 468, 470, 473, 474, 478, 482, 484, 487, ++ 488, 491, 492, 494, 499, 501, 502, 504, 508, 513, 514, 521, 522, ++ 523, 524, 527, 529, 533, 535, 540, 543, 544, 545, 546, 548, 549, ++ 551, 556, 561, 564, 565, 567, 568, 573, 575, 576, 577, 579, 581, ++ 582, 584, 586, 590, 592, 597, 602, 603, 607, 609, 610, 611, 615, ++ 616, 618, 619, 620, 621, 622, 627, 631, 634, 640, 655, 657, 661, ++ 666, 671, 675, 676, 677, 680, 682, 683, 684, 686, 687, 688, 690, ++ 691, 694, 695, 698, 704, 710, 715, 716, 719, 721, 722, 723, 724, ++ 728, 732, 733, 736, 738, 741, 743, 745, 750, 752, 755, 756, 758, ++ 760, 763, 769, 770, 775, 776, 778, 780, 781, 783, 786, 789, 791, ++ 792, 795, 796, 799, 800, 803, 805, 810, 811, 812, 813, 814, 819, ++ 821, 828, 833, 834, 838, 841, 843, 844, 850, 853, 854, 855, 864, ++ 866, 870, 872, 882, 883, 884, 886, 887, 888, 892, 897, 898, 899, ++ 900, 901, 902 ++ ], ++ "peaks": [ ++ { ++ "center": 0, ++ "spread": 183, ++ "sites": 344.5, ++ "log_adj_pvalue": -98.2624 ++ } ++ ] ++ }, { ++ "db": 1, + "id": "GGGYGK", + "alt": "DREME", + "len": 6, +@@ -603,7 +777,7 @@ + } + ] + }, { +- "db": 0, ++ "db": 1, + "id": "TTATCW", + "alt": "DREME", + "len": 6, +@@ -691,7 +865,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0002.2", + "alt": "RUNX1", + "len": 11, +@@ -772,7 +946,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0006.1", + "alt": "Arnt::Ahr", + "len": 6, +@@ -863,7 +1037,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0027.1", + "alt": "En1", + "len": 11, +@@ -945,7 +1119,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0029.1", + "alt": "Evi1", + "len": 14, +@@ -1015,7 +1189,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0035.2", + "alt": "Gata1", + "len": 11, +@@ -1111,7 +1285,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0036.1", + "alt": "GATA2", + "len": 5, +@@ -1220,7 +1394,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0037.1", + "alt": "GATA3", + "len": 6, +@@ -1318,7 +1492,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0039.2", + "alt": "Klf4", + "len": 10, +@@ -1406,7 +1580,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0048.1", + "alt": "NHLH1", + "len": 12, +@@ -1476,7 +1650,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0079.1", + "alt": "SP1", + "len": 10, +@@ -1554,7 +1728,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0079.2", + "alt": "SP1", + "len": 10, +@@ -1622,7 +1796,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0121.1", + "alt": "ARR10", + "len": 8, +@@ -1698,7 +1872,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0140.1", + "alt": "Tal1::Gata1", + "len": 18, +@@ -1798,7 +1972,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0145.1", + "alt": "Tcfcp2l1", + "len": 14, +@@ -1875,7 +2049,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0199.1", + "alt": "Optix", + "len": 5, +@@ -1971,7 +2145,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0204.1", + "alt": "Six4", + "len": 6, +@@ -2053,7 +2227,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0207.1", + "alt": "achi", + "len": 6, +@@ -2131,7 +2305,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0227.1", + "alt": "hth", + "len": 6, +@@ -2201,7 +2375,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0259.1", + "alt": "HIF1A::ARNT", + "len": 8, +@@ -2268,7 +2442,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0270.1", + "alt": "AFT2", + "len": 8, +@@ -2345,7 +2519,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0289.1", + "alt": "DAL80", + "len": 7, +@@ -2427,7 +2601,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0298.1", + "alt": "FZF1", + "len": 6, +@@ -2560,7 +2734,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0300.1", + "alt": "GAT1", + "len": 8, +@@ -2644,7 +2818,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0307.1", + "alt": "GLN3", + "len": 5, +@@ -2763,7 +2937,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0309.1", + "alt": "GZF3", + "len": 8, +@@ -2845,7 +3019,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0333.1", + "alt": "MET31", + "len": 9, +@@ -2909,7 +3083,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0334.1", + "alt": "MET32", + "len": 7, +@@ -2989,7 +3163,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0403.1", + "alt": "TBF1", + "len": 8, +@@ -3073,7 +3247,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0425.1", + "alt": "YGR067C", + "len": 14, +@@ -3149,7 +3323,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0431.1", + "alt": "YML081W", + "len": 9, +@@ -3216,7 +3390,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0443.1", + "alt": "btd", + "len": 10, +@@ -3286,7 +3460,7 @@ + } + ] + }, { +- "db": 1, ++ "db": 2, + "id": "MA0450.1", + "alt": "hkb", + "len": 9, +@@ -3358,7 +3532,7 @@ + }; + + + + + +- ++ + + + +@@ -3500,7 +3537,7 @@ +
    +
    + +

    +@@ -3608,7 +3645,7 @@ + Previous Top +

    +
    +-
    DREME version
    4.10.0 (Release date: Tue May 06 16:46:04 2014 +1000) ++
    DREME version
    4.10.0 (Release date: Wed May 21 10:35:36 2014 +1000) +
    +
    +
    Reference
    +@@ -3618,21 +3655,21 @@ +
    +
    +
    Command line summary
    +-
    Result calculation took 18.94 seconds
    ++
    Result calculation took 17.02 seconds
    +
    + show model parameters... + +diff -ruN a/doc/examples/memechip_example_output_files/dreme_out/dreme.txt b/doc/examples/memechip_example_output_files/dreme_out/dreme.txt +--- a/doc/examples/memechip_example_output_files/dreme_out/dreme.txt 2014-05-13 08:34:15.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/dreme_out/dreme.txt 2014-10-07 17:17:48.000000000 +1000 +@@ -1,11 +1,11 @@ + # DREME 4.10.0 + # command: dreme -v 1 -oc memechip_example_output_files/dreme_out -p memechip_example_output_files/seqs-centered -n memechip_example_output_files/seqs-shuffled -png +-# host: d-108-179-169-207.dhcp4.washington.edu +-# when: Mon May 12 15:33:56 PDT 2014 ++# host: IMB12-010665 ++# when: Tue Oct 07 17:17:31 EST 2014 + # positives: 812 +-# from: memechip_example_output_files/seqs-centered (Mon May 12 15:33:53 PDT 2014) ++# from: memechip_example_output_files/seqs-centered (Tue Oct 07 17:09:05 EST 2014) + # negatives: 812 +-# from: memechip_example_output_files/seqs-shuffled (Mon May 12 15:33:56 PDT 2014) ++# from: memechip_example_output_files/seqs-shuffled (Tue Oct 07 17:09:06 EST 2014) + + + MEME version 4.10.0 +@@ -67,4 +67,4 @@ + + + +-Time 18.94 secs. ++Time 17.02 secs. +diff -ruN a/doc/examples/memechip_example_output_files/dreme_out/dreme.xml b/doc/examples/memechip_example_output_files/dreme_out/dreme.xml +--- a/doc/examples/memechip_example_output_files/dreme_out/dreme.xml 2014-05-13 08:34:15.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/dreme_out/dreme.xml 2014-10-07 17:17:48.000000000 +1000 +@@ -65,19 +65,19 @@ + + ]> +- ++ + + dreme -v 1 -oc memechip_example_output_files/dreme_out -p memechip_example_output_files/seqs-centered -n memechip_example_output_files/seqs-shuffled -png +- +- ++ ++ + + + FALSE + 100 + 0.01 + 1 +- d-108-179-169-207.dhcp4.washington.edu +- Mon May 12 15:33:56 PDT 2014 ++ IMB12-010665 ++ Tue Oct 07 17:17:31 EST 2014 + + + +@@ -112,5 +112,5 @@ + + + +- ++ + +Binary files a/doc/examples/memechip_example_output_files/dreme_out/m01nc_GGGYGK.png and b/doc/examples/memechip_example_output_files/dreme_out/m01nc_GGGYGK.png differ +Binary files a/doc/examples/memechip_example_output_files/dreme_out/m01rc_MCRCCC.png and b/doc/examples/memechip_example_output_files/dreme_out/m01rc_MCRCCC.png differ +Binary files a/doc/examples/memechip_example_output_files/dreme_out/m02nc_TTATCW.png and b/doc/examples/memechip_example_output_files/dreme_out/m02nc_TTATCW.png differ +Binary files a/doc/examples/memechip_example_output_files/dreme_out/m02rc_WGATAA.png and b/doc/examples/memechip_example_output_files/dreme_out/m02rc_WGATAA.png differ +Binary files a/doc/examples/memechip_example_output_files/dreme_out/m03nc_AGAWA.png and b/doc/examples/memechip_example_output_files/dreme_out/m03nc_AGAWA.png differ +Binary files a/doc/examples/memechip_example_output_files/dreme_out/m03rc_TWTCT.png and b/doc/examples/memechip_example_output_files/dreme_out/m03rc_TWTCT.png differ +diff -ruN a/doc/examples/memechip_example_output_files/dreme_tomtom_out/tomtom.html b/doc/examples/memechip_example_output_files/dreme_tomtom_out/tomtom.html +--- a/doc/examples/memechip_example_output_files/dreme_tomtom_out/tomtom.html 2014-05-13 08:34:32.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/dreme_tomtom_out/tomtom.html 2014-10-07 17:18:22.000000000 +1000 +@@ -250,7 +250,7 @@ + + + + + ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    ++

    Help poup.

    ++
    [ ++ close ]
    ++
    ++
    ++

    The statistical significance of the motif. MEME usually finds the most ++ statistically significant (low E-value) motifs first. It is unusual to ++ consider a motif with an E-value larger than 0.05 significant so, as an ++ additional indicator, MEME displays these partially transparent.

    ++

    The E-value of a motif is based on its log likelihood ratio, width, ++ sites, the background letter frequencies (given in the command line ++ summary), and the size of the training set.

    ++

    The E-value is an estimate of the expected number of motifs with the ++ given log likelihood ratio (or higher), and with the same width and site ++ count, that one would find in a similarly sized set of random ++ sequences (sequences where each position is independent and letters are ++ chosen according to the background letter frequencies).

    ++
    [ ++ close ]
    ++
    ++
    ++

    The number of sites contributing to the construction of the motif.

    ++
    [ ++ close ]
    ++
    ++
    ++

    The width of the motif. Each motif describes a pattern of a fixed ++ width, as no gaps are allowed in MEME motifs.

    ++
    [ ++ close ]
    ++
    ++
    ++

    Show more information on the motif.

    ++
    [ ++ close ]
    ++
    ++
    ++

    Submit your motif to another MEME Suite program or download in various ++ text formats or as a logo.

    ++
    Supported Programs
    ++
    ++
    Tomtom
    ++
    Tomtom is a tool for searching for similar known motifs. ++ [manual]
    ++
    MAST
    ++
    MAST is a tool for searching biological sequence databases for ++ sequences that contain one or more of a group of known motifs. ++ [manual]
    ++
    FIMO
    ++
    FIMO is a tool for searching biological sequence databases for ++ sequences that contain one or more known motifs. ++ [manual]
    ++
    GOMO
    ++
    GOMO is a tool for identifying possible roles (Gene Ontology ++ terms) for DNA binding motifs. ++ [manual]
    ++
    SpaMo
    ++
    SpaMo is a tool for inferring possible transcription factor ++ complexes by finding motifs with enriched spacings. ++ [manual]
    ++
    ++
    [ ++ close ]
    ++
    ++
    ++

    The log likelihood ratio of the motif.The log likelihood ratio is the ++ logarithm of the ratio of the probability of the occurrences of the motif ++ given the motif model (likelihood given the motif) versus their ++ probability given the background model (likelihood given the null model). ++ (Normally the background model is a 0-order Markov model using the ++ background letter frequencies, but higher order Markov models may be ++ specified via the -bfile option to MEME.).

    ++
    [ ++ close ]
    ++
    ++
    ++

    The information content of the motif in bits. It is equal to the sum ++ of the uncorrected information content, R(), in the columns of the pwm. ++ This is equal relative entropy of the motif relative to a uniform ++ background frequency model.

    ++
    [ ++ close ]
    ++
    ++
    ++

    The relative entropy of the motif.

    ++ ++

    re = llr / (sites * ln(2))

    ++
    [ ++ close ]
    ++
    ++
    ++

    The Bayes Threshold.

    ++
    [ ++ close ]
    ++
    ++
    ++

    The strand used for the motif site.

    ++
    ++
    +
    ++
    The motif site was found in the sequence as it was supplied.
    ++
    -
    ++
    The motif site was found in the reverse complement of the supplied sequence.
    ++
    ++
    [ ++ close ]
    ++
    ++
    ++

    The position in the sequence where the motif site starts. If a motif ++ started right at the begining of a sequence it would be described as ++ starting at position 1.

    ++
    [ ++ close ]
    ++
    ++
    ++

    The probability that an equal or better site would be found in a ++ random sequence of the same length conforming to the background letter ++ frequencies.

    ++
    [ ++ close ]
    ++
    ++
    ++

    A motif site with the 10 flanking letters on either side.

    ++

    When the site is not on the given strand then the site ++ and both flanks are reverse complemented so they align.

    ++
    [ ++ close ]
    ++
    ++ ++
    ++

    The name of the sequences as given in the FASTA file.

    ++

    The number to the left of the sequence name is the ordinal ++ of the sequence.

    ++
    [ ++ close ]
    ++
    ++
    ++

    This is the combined match p-value.

    ++

    The combined match p-value is defined as the probability that a ++ random sequence (with the same length and conforming to the background) ++ would have motif-sequence match p-values such that the product is smaller ++ or equal to the value calulated for the sequence under test.

    ++

    The motif-sequence match p-value is defined as the probability that a ++ random sequence (with the same length and conforming to the background) ++ would have a match to the motif under test with a score greater or equal ++ to the largest found in the sequence under test.

    ++
    [ ++ close ]
    ++
    ++
    ++

    This diagram shows the location of motif sites.

    ++
    [ ++ close ]
    ++
    ++ ++
    ++
    ++ ++ ++
    ++
    ++ ++ ++ ++
    ++
    ++ ++ ++ ++ ++
    Motif1
    p-value8.23e-7
    Start23
    End33
    ++
    ++ ++
    ++
    Scanned Site
    ++
    ++ ++ ++ ++ ++ ++
    Motif1
    p-value8.23e-7
    Start23
    End33
    ++
    ++ ++
    ++
    ++
    ++ . ++
    ++
    ++
    ++
    ++
    ++
    ++ E-value: ++ ++
    ++
    ++
    ++ Site Count: ++ ++
    ++
    ++
    ++ Width: ++ ++
    ++
    ++
    ++
    ++ ++
    ++
    ++ StandardReverse ++ Complement ++
    ++
    ++
    ++ Log Likelihood Ratio: ++ ++
    ++
    ++
    ++ Information Content: ++ ++
    ++
    ++
    ++ Relative Entropy: ++ ++
    ++
    ++
    ++ Bayes Threshold: ++ ++
    ++
    ++
    ++
    ++
    ++ ++ ++ ++ ++ ++
    ++ ++

    ++ For further information on how to interpret these results or to get a ++ copy of the MEME software please access ++ http://meme.nbcr.net. ++

    ++

    If you use MEME in your research, please cite the following paper:
    ++ ++ Timothy L. Bailey and Charles Elkan, ++ "Fitting a mixture model by expectation maximization to discover motifs in biopolymers", ++ Proceedings of the Second International Conference on Intelligent Systems ++ for Molecular Biology, pp. 28-36, AAAI Press, Menlo Park, California, 1994. ++ [pdf] ++ ++

    ++
    ++ ++
    ++ Discovered Motifs ++   |   ++ Motif Locations ++   |   ++ Program information ++
    ++ ++ ++

    Your browser does not support canvas!

    ++ ++

    Discovered Motifs

    ++
    ++

    No motifs were discovered!

    ++
    ++

    Motif Locations

    ++
    ++

    No motifs were discovered!

    ++
    ++ ++
    ++
    ++
    MEME version
    ++ ++ (Release date: )
    ++
    ++ ++
    ++
    Reference
    ++ ++ Timothy L. Bailey and Charles Elkan, ++ "Fitting a mixture model by expectation maximization to discover motifs in biopolymers", ++ Proceedings of the Second International Conference on Intelligent Systems ++ for Molecular Biology, pp. 28-36, AAAI Press, Menlo Park, California, 1994. ++ ++
    ++
    Command line summary
    ++ ++ ++
    ++
    ++
    ++ ++ ++ +diff -ruN a/doc/examples/memechip_example_output_files/meme_out/meme.txt b/doc/examples/memechip_example_output_files/meme_out/meme.txt +--- a/doc/examples/memechip_example_output_files/meme_out/meme.txt 1970-01-01 10:00:00.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/meme_out/meme.txt 2014-10-07 17:17:30.000000000 +1000 +@@ -0,0 +1,2589 @@ ++******************************************************************************** ++MEME - Motif discovery tool ++******************************************************************************** ++MEME version 4.10.0 (Release date: Wed May 21 10:35:36 2014 +1000) ++ ++For further information on how to interpret these results or to get ++a copy of the MEME software please access http://meme.nbcr.net. ++ ++This file may be used as input to the MAST algorithm for searching ++sequence databases for matches to groups of motifs. MAST is available ++for interactive use and downloading at http://meme.nbcr.net. ++******************************************************************************** ++ ++ ++******************************************************************************** ++REFERENCE ++******************************************************************************** ++If you use this program in your research, please cite: ++ ++Timothy L. Bailey and Charles Elkan, ++"Fitting a mixture model by expectation maximization to discover ++motifs in biopolymers", Proceedings of the Second International ++Conference on Intelligent Systems for Molecular Biology, pp. 28-36, ++AAAI Press, Menlo Park, California, 1994. ++******************************************************************************** ++ ++ ++******************************************************************************** ++TRAINING SET ++******************************************************************************** ++DATAFILE= memechip_example_output_files/seqs-sampled ++ALPHABET= ACGT ++Sequence name Weight Length Sequence name Weight Length ++------------- ------ ------ ------------- ------ ------ ++chr1:157319655-157319755 1.0000 100 chr8:24254795-24254895 1.0000 100 ++chr15:76778490-76778590 1.0000 100 chr6:57695286-57695386 1.0000 100 ++chr10:59336304-59336404 1.0000 100 chr1:43307689-43307789 1.0000 100 ++chr4:111175598-111175698 1.0000 100 chr19:47458493-47458593 1.0000 100 ++chr13:73612724-73612824 1.0000 100 chr7:16507688-16507788 1.0000 100 ++chr6:132413557-132413657 1.0000 100 chr10:110604368-11060446 1.0000 100 ++chr3:100351339-100351439 1.0000 100 chr2:78556315-78556415 1.0000 100 ++chr18:65586914-65587014 1.0000 100 chr4:8631654-8631754 1.0000 100 ++chr11:4232025-4232125 1.0000 100 chr4:143002327-143002427 1.0000 100 ++chr14:79702843-79702943 1.0000 100 chr3:145253491-145253591 1.0000 100 ++chr11:69793284-69793384 1.0000 100 chr4:135745625-135745725 1.0000 100 ++chr1:136638481-136638581 1.0000 100 chr10:126642276-12664237 1.0000 100 ++chr18:23868476-23868576 1.0000 100 chr6:134934722-134934822 1.0000 100 ++chr17:12397642-12397742 1.0000 100 chr11:44322388-44322488 1.0000 100 ++chr7:106679807-106679907 1.0000 100 chr17:26651346-26651446 1.0000 100 ++chr12:78031164-78031264 1.0000 100 chr5:37127174-37127274 1.0000 100 ++chr19:5845898-5845998 1.0000 100 chr1:183078714-183078814 1.0000 100 ++chr3:102933243-102933343 1.0000 100 chr16:91804488-91804588 1.0000 100 ++chr3:116562120-116562220 1.0000 100 chr13:96735032-96735132 1.0000 100 ++chr6:38860750-38860850 1.0000 100 chr11:102226516-10222661 1.0000 100 ++chr1:9763391-9763491 1.0000 100 chr9:107275713-107275813 1.0000 100 ++chr6:86610038-86610138 1.0000 100 chr8:87362362-87362462 1.0000 100 ++chr11:115626399-11562649 1.0000 100 chr12:112796793-11279689 1.0000 100 ++chr14:32981987-32982087 1.0000 100 chr15:57638556-57638656 1.0000 100 ++chr1:135696218-135696318 1.0000 100 chr19:32372781-32372881 1.0000 100 ++chr12:70394725-70394825 1.0000 100 chr4:118862380-118862480 1.0000 100 ++chr16:76323701-76323801 1.0000 100 chr12:112063120-11206322 1.0000 100 ++chr7:107640799-107640899 1.0000 100 chr11:4577309-4577409 1.0000 100 ++chr9:66197481-66197581 1.0000 100 chr6:31150321-31150421 1.0000 100 ++chr18:57137387-57137487 1.0000 100 chr5:144386182-144386282 1.0000 100 ++chr10:69792642-69792742 1.0000 100 chr11:115372412-11537251 1.0000 100 ++chr11:32150817-32150917 1.0000 100 chrX:146984103-146984203 1.0000 100 ++chr5:65255864-65255964 1.0000 100 chr3:145353763-145353863 1.0000 100 ++chr6:70740090-70740190 1.0000 100 chr13:3345624-3345724 1.0000 100 ++chr13:114649130-11464923 1.0000 100 chr2:25148315-25148415 1.0000 100 ++chr11:87539593-87539693 1.0000 100 chr7:134369101-134369201 1.0000 100 ++chr10:40726423-40726523 1.0000 100 chr1:90207103-90207203 1.0000 100 ++chr12:27135943-27136043 1.0000 100 chr2:34638537-34638637 1.0000 100 ++chr5:73746597-73746697 1.0000 100 chr11:74652046-74652146 1.0000 100 ++chr4:9588077-9588177 1.0000 100 chr11:53839887-53839987 1.0000 100 ++chr2:84681995-84682095 1.0000 100 chr18:82836059-82836159 1.0000 100 ++chr5:140280104-140280204 1.0000 100 chr15:41338513-41338613 1.0000 100 ++chr7:99891352-99891452 1.0000 100 chr11:69714223-69714323 1.0000 100 ++chr1:88057040-88057140 1.0000 100 chr11:117642059-11764215 1.0000 100 ++chr17:37006053-37006153 1.0000 100 chr7:139969683-139969783 1.0000 100 ++chr6:34428673-34428773 1.0000 100 chrX:119944785-119944885 1.0000 100 ++chr17:84135991-84136091 1.0000 100 chr7:91033421-91033521 1.0000 100 ++chr15:83139084-83139184 1.0000 100 chr7:38963791-38963891 1.0000 100 ++chr18:54151150-54151250 1.0000 100 chr11:87563494-87563594 1.0000 100 ++chr19:45121627-45121727 1.0000 100 chr8:83025149-83025249 1.0000 100 ++chr5:121847518-121847618 1.0000 100 chr11:32145484-32145584 1.0000 100 ++chr19:5922115-5922215 1.0000 100 chr12:41846175-41846275 1.0000 100 ++chr11:61770985-61771085 1.0000 100 chr2:24832340-24832440 1.0000 100 ++chr7:139915432-139915532 1.0000 100 chr19:56465962-56466062 1.0000 100 ++chr12:58298569-58298669 1.0000 100 chr15:79757890-79757990 1.0000 100 ++chr12:71933518-71933618 1.0000 100 chr4:118863135-118863235 1.0000 100 ++chr5:121049617-121049717 1.0000 100 chr5:144737551-144737651 1.0000 100 ++chr4:153400587-153400687 1.0000 100 chr19:60889898-60889998 1.0000 100 ++chr16:49776999-49777099 1.0000 100 chr11:121295412-12129551 1.0000 100 ++chr4:118293096-118293196 1.0000 100 chr16:32508974-32509074 1.0000 100 ++chr2:167454294-167454394 1.0000 100 chr13:59915598-59915698 1.0000 100 ++chr8:3522195-3522295 1.0000 100 chr3:79383669-79383769 1.0000 100 ++chr5:87232755-87232855 1.0000 100 chr6:146196316-146196416 1.0000 100 ++chr17:47754579-47754679 1.0000 100 chr13:94158460-94158560 1.0000 100 ++chr17:28946039-28946139 1.0000 100 chr9:102674394-102674494 1.0000 100 ++chr7:25940385-25940485 1.0000 100 chr9:65063484-65063584 1.0000 100 ++chr11:90547829-90547929 1.0000 100 chr11:57315370-57315470 1.0000 100 ++chr3:60623495-60623595 1.0000 100 chr13:63465095-63465195 1.0000 100 ++chr14:63796626-63796726 1.0000 100 chr4:32949806-32949906 1.0000 100 ++chr6:149136526-149136626 1.0000 100 chr10:112467641-11246774 1.0000 100 ++chr10:59711555-59711655 1.0000 100 chr5:37112215-37112315 1.0000 100 ++chr10:128184603-12818470 1.0000 100 chr16:92715757-92715857 1.0000 100 ++chr9:64640065-64640165 1.0000 100 chr3:103708584-103708684 1.0000 100 ++chr6:136416750-136416850 1.0000 100 chr9:104996245-104996345 1.0000 100 ++chr2:157978336-157978436 1.0000 100 chr7:128009272-128009372 1.0000 100 ++chr13:112511938-11251203 1.0000 100 chr2:28928359-28928459 1.0000 100 ++chr13:34169860-34169960 1.0000 100 chr12:35474089-35474189 1.0000 100 ++chr3:104477494-104477594 1.0000 100 chr5:34915766-34915866 1.0000 100 ++chr1:60399689-60399789 1.0000 100 chr8:107823857-107823957 1.0000 100 ++chr2:153321069-153321169 1.0000 100 chr1:133343882-133343982 1.0000 100 ++chr7:128850882-128850982 1.0000 100 chr12:112505814-11250591 1.0000 100 ++chr3:30811842-30811942 1.0000 100 chr6:57653288-57653388 1.0000 100 ++chr4:106351519-106351619 1.0000 100 chr11:61773535-61773635 1.0000 100 ++chr12:16754497-16754597 1.0000 100 chr3:68858679-68858779 1.0000 100 ++chr9:70774507-70774607 1.0000 100 chr15:78888126-78888226 1.0000 100 ++chr8:125244308-125244408 1.0000 100 chr15:81700366-81700466 1.0000 100 ++chr10:60585890-60585990 1.0000 100 chr2:91483171-91483271 1.0000 100 ++chr7:135432388-135432488 1.0000 100 chr1:122155871-122155971 1.0000 100 ++chr9:57147432-57147532 1.0000 100 chr14:63729028-63729128 1.0000 100 ++chr9:42909937-42910037 1.0000 100 chr5:118933400-118933500 1.0000 100 ++chr11:115374473-11537457 1.0000 100 chr19:53259936-53260036 1.0000 100 ++chr3:107899565-107899665 1.0000 100 chr4:119486254-119486354 1.0000 100 ++chr19:45865026-45865126 1.0000 100 chr16:91352913-91353013 1.0000 100 ++chr9:121335572-121335672 1.0000 100 chr15:78243389-78243489 1.0000 100 ++chr9:40980320-40980420 1.0000 100 chr2:103324307-103324407 1.0000 100 ++chr4:116666092-116666192 1.0000 100 chr2:167169232-167169332 1.0000 100 ++chr11:102236404-10223650 1.0000 100 chr10:128286731-12828683 1.0000 100 ++chr17:87913077-87913177 1.0000 100 chr7:111019147-111019247 1.0000 100 ++chr15:73181611-73181711 1.0000 100 chr9:66763905-66764005 1.0000 100 ++chr7:139930394-139930494 1.0000 100 chr9:31059931-31060031 1.0000 100 ++chr15:76083899-76083999 1.0000 100 chr13:98513311-98513411 1.0000 100 ++chr2:93306456-93306556 1.0000 100 chr14:69939826-69939926 1.0000 100 ++chr1:70948720-70948820 1.0000 100 chr10:127624309-12762440 1.0000 100 ++chr5:104188914-104189014 1.0000 100 chr4:126645608-126645708 1.0000 100 ++chr6:86027771-86027871 1.0000 100 chr14:71023665-71023765 1.0000 100 ++chr2:130961395-130961495 1.0000 100 chr11:115367839-11536793 1.0000 100 ++chr4:111203043-111203143 1.0000 100 chr11:57590459-57590559 1.0000 100 ++chr15:96173311-96173411 1.0000 100 chr11:115373882-11537398 1.0000 100 ++chr11:115139145-11513924 1.0000 100 chr18:61379740-61379840 1.0000 100 ++chr10:126640071-12664017 1.0000 100 chr15:95715579-95715679 1.0000 100 ++chr13:47204525-47204625 1.0000 100 chr9:112905110-112905210 1.0000 100 ++chr3:51034100-51034200 1.0000 100 chr17:48438406-48438506 1.0000 100 ++chr8:122302552-122302652 1.0000 100 chr13:94151185-94151285 1.0000 100 ++chr4:132847120-132847220 1.0000 100 chr11:95661714-95661814 1.0000 100 ++chr5:144685596-144685696 1.0000 100 chr11:121294774-12129487 1.0000 100 ++chr6:82964292-82964392 1.0000 100 chr17:29067182-29067282 1.0000 100 ++chr6:121187424-121187524 1.0000 100 chr17:24289204-24289304 1.0000 100 ++chr2:72858950-72859050 1.0000 100 chr5:117587453-117587553 1.0000 100 ++chr12:80012616-80012716 1.0000 100 chr6:56860899-56860999 1.0000 100 ++chr2:84852385-84852485 1.0000 100 chr13:112833729-11283382 1.0000 100 ++chr10:57527584-57527684 1.0000 100 chr10:76673548-76673648 1.0000 100 ++chr5:17334951-17335051 1.0000 100 chr5:139858101-139858201 1.0000 100 ++chr16:14166505-14166605 1.0000 100 chr2:35181511-35181611 1.0000 100 ++chr19:24354046-24354146 1.0000 100 chr7:111009339-111009439 1.0000 100 ++chr16:34319202-34319302 1.0000 100 chr4:41334758-41334858 1.0000 100 ++chr4:44084688-44084788 1.0000 100 chr10:60612189-60612289 1.0000 100 ++chr11:61433607-61433707 1.0000 100 chr11:117187371-11718747 1.0000 100 ++chr11:104842982-10484308 1.0000 100 chr7:148956812-148956912 1.0000 100 ++chr19:11699766-11699866 1.0000 100 chr2:118499054-118499154 1.0000 100 ++chr10:30482937-30483037 1.0000 100 chr3:88305499-88305599 1.0000 100 ++chr3:101355777-101355877 1.0000 100 chr4:135407872-135407972 1.0000 100 ++chr1:170140426-170140526 1.0000 100 chr2:164599350-164599450 1.0000 100 ++chr12:17246026-17246126 1.0000 100 chr4:43977110-43977210 1.0000 100 ++chr19:5896487-5896587 1.0000 100 chr13:39515524-39515624 1.0000 100 ++chr14:61272712-61272812 1.0000 100 chr19:6236069-6236169 1.0000 100 ++chr4:128532892-128532992 1.0000 100 chr11:96809236-96809336 1.0000 100 ++chr12:102194282-10219438 1.0000 100 chr4:155335984-155336084 1.0000 100 ++chr17:85277578-85277678 1.0000 100 chr6:81915768-81915868 1.0000 100 ++chr5:115468249-115468349 1.0000 100 chr13:100518007-10051810 1.0000 100 ++chr2:28462971-28463071 1.0000 100 chr10:57252235-57252335 1.0000 100 ++chr14:20884080-20884180 1.0000 100 chr2:5220410-5220510 1.0000 100 ++chr2:25742740-25742840 1.0000 100 chr7:104332487-104332587 1.0000 100 ++chr2:120881647-120881747 1.0000 100 chr6:83115545-83115645 1.0000 100 ++chr1:175901566-175901666 1.0000 100 chr9:114375901-114376001 1.0000 100 ++chr6:125826720-125826820 1.0000 100 chr11:51213800-51213900 1.0000 100 ++chr4:32996228-32996328 1.0000 100 chr4:132785398-132785498 1.0000 100 ++chr9:75406568-75406668 1.0000 100 chr5:105994746-105994846 1.0000 100 ++chr1:169314207-169314307 1.0000 100 chr11:104890314-10489041 1.0000 100 ++chr1:92185725-92185825 1.0000 100 chr2:25869095-25869195 1.0000 100 ++chr16:32449730-32449830 1.0000 100 chr15:66969076-66969176 1.0000 100 ++chr17:47672782-47672882 1.0000 100 chr9:118957546-118957646 1.0000 100 ++chr1:183187346-183187446 1.0000 100 chr8:24164439-24164539 1.0000 100 ++chr11:75460436-75460536 1.0000 100 chr4:44016939-44017039 1.0000 100 ++chr11:32193433-32193533 1.0000 100 chr2:31940724-31940824 1.0000 100 ++chr12:113882351-11388245 1.0000 100 chr9:21940048-21940148 1.0000 100 ++chr12:70884546-70884646 1.0000 100 chr7:28266695-28266795 1.0000 100 ++chr17:91618497-91618597 1.0000 100 chr3:51492457-51492557 1.0000 100 ++chr5:30289968-30290068 1.0000 100 chr1:59010622-59010722 1.0000 100 ++chr2:125973397-125973497 1.0000 100 chr9:34860986-34861086 1.0000 100 ++chr10:25018819-25018919 1.0000 100 chr14:21479094-21479194 1.0000 100 ++chr3:84162552-84162652 1.0000 100 chr11:32168936-32169036 1.0000 100 ++chr5:143681949-143682049 1.0000 100 chr5:97380647-97380747 1.0000 100 ++chr18:32719456-32719556 1.0000 100 chr5:144438246-144438346 1.0000 100 ++chr9:108243079-108243179 1.0000 100 chr17:34266308-34266408 1.0000 100 ++chr3:84607841-84607941 1.0000 100 chr14:56154882-56154982 1.0000 100 ++chr15:34829704-34829804 1.0000 100 chr13:112837037-11283713 1.0000 100 ++chr10:40924607-40924707 1.0000 100 chr8:113026623-113026723 1.0000 100 ++chr5:130455804-130455904 1.0000 100 chr9:7790420-7790520 1.0000 100 ++chr13:35887680-35887780 1.0000 100 chr17:25039618-25039718 1.0000 100 ++chr2:103962051-103962151 1.0000 100 chr7:25993968-25994068 1.0000 100 ++chr12:117249634-11724973 1.0000 100 chr1:82633923-82634023 1.0000 100 ++chr4:76585119-76585219 1.0000 100 chr12:77866194-77866294 1.0000 100 ++chr11:50038237-50038337 1.0000 100 chr16:8655670-8655770 1.0000 100 ++chr19:6300360-6300460 1.0000 100 chr4:132806563-132806663 1.0000 100 ++chr7:106951864-106951964 1.0000 100 chr1:196501890-196501990 1.0000 100 ++chr17:25716183-25716283 1.0000 100 chr7:148354573-148354673 1.0000 100 ++chr7:19832206-19832306 1.0000 100 chr4:129140944-129141044 1.0000 100 ++chr16:49839620-49839720 1.0000 100 chr3:95468978-95469078 1.0000 100 ++chr15:91082415-91082515 1.0000 100 chr7:128112656-128112756 1.0000 100 ++chr19:17397730-17397830 1.0000 100 chr5:22924216-22924316 1.0000 100 ++chr11:94195589-94195689 1.0000 100 chr7:106742880-106742980 1.0000 100 ++chr2:167256470-167256570 1.0000 100 chr5:138127196-138127296 1.0000 100 ++chr6:124614275-124614375 1.0000 100 chr5:45951564-45951664 1.0000 100 ++chr19:44460304-44460404 1.0000 100 chr7:26004856-26004956 1.0000 100 ++chr4:129974284-129974384 1.0000 100 chr5:89197188-89197288 1.0000 100 ++chr16:10384211-10384311 1.0000 100 chr9:48582636-48582736 1.0000 100 ++chr9:59598185-59598285 1.0000 100 chr9:21362670-21362770 1.0000 100 ++chr5:137730859-137730959 1.0000 100 chr15:38473209-38473309 1.0000 100 ++chr9:98389942-98390042 1.0000 100 chr2:132521380-132521480 1.0000 100 ++chr3:19550494-19550594 1.0000 100 chr10:93585403-93585503 1.0000 100 ++chr7:110976194-110976294 1.0000 100 chr9:113850420-113850520 1.0000 100 ++chr2:150491522-150491622 1.0000 100 chr9:107198662-107198762 1.0000 100 ++chr17:29575283-29575383 1.0000 100 chr12:33905457-33905557 1.0000 100 ++chr17:45884715-45884815 1.0000 100 chr11:31712261-31712361 1.0000 100 ++chr2:155437821-155437921 1.0000 100 chr8:122895508-122895608 1.0000 100 ++chr7:103853791-103853891 1.0000 100 chr12:70860460-70860560 1.0000 100 ++chr2:84652032-84652132 1.0000 100 chr19:24609086-24609186 1.0000 100 ++chr8:109948099-109948199 1.0000 100 chr11:24999930-25000030 1.0000 100 ++chr5:144579743-144579843 1.0000 100 chr14:70506761-70506861 1.0000 100 ++chr8:74937709-74937809 1.0000 100 chr5:65203206-65203306 1.0000 100 ++chr6:72229420-72229520 1.0000 100 chr19:5726888-5726988 1.0000 100 ++chr16:44265653-44265753 1.0000 100 chr15:103088528-10308862 1.0000 100 ++chr3:121365444-121365544 1.0000 100 chr15:56455063-56455163 1.0000 100 ++chr17:47735005-47735105 1.0000 100 chr5:104483855-104483955 1.0000 100 ++chr4:151334551-151334651 1.0000 100 chr6:135115627-135115727 1.0000 100 ++chr7:20250334-20250434 1.0000 100 chr4:128287321-128287421 1.0000 100 ++chr4:117504523-117504623 1.0000 100 chr1:181078665-181078765 1.0000 100 ++chr9:122282102-122282202 1.0000 100 chr7:28320390-28320490 1.0000 100 ++chr6:41654152-41654252 1.0000 100 chr5:108943417-108943517 1.0000 100 ++chr1:75175759-75175859 1.0000 100 chr13:112863644-11286374 1.0000 100 ++chr6:145703214-145703314 1.0000 100 chr19:43786023-43786123 1.0000 100 ++chr5:28369134-28369234 1.0000 100 chr3:108248003-108248103 1.0000 100 ++chr8:126512499-126512599 1.0000 100 chr13:3866265-3866365 1.0000 100 ++chrX:39372438-39372538 1.0000 100 chr12:116305851-11630595 1.0000 100 ++chr4:33073879-33073979 1.0000 100 chr8:92969520-92969620 1.0000 100 ++chr4:31985597-31985697 1.0000 100 chr7:111007529-111007629 1.0000 100 ++chr1:36976472-36976572 1.0000 100 chr18:23982469-23982569 1.0000 100 ++chr13:35769193-35769293 1.0000 100 chr11:69759802-69759902 1.0000 100 ++chr11:97307229-97307329 1.0000 100 chr7:53193728-53193828 1.0000 100 ++chr1:173470675-173470775 1.0000 100 chr19:55940203-55940303 1.0000 100 ++chr13:3862102-3862202 1.0000 100 chr2:118962055-118962155 1.0000 100 ++chr4:154303236-154303336 1.0000 100 chr16:33115730-33115830 1.0000 100 ++chr3:89612430-89612530 1.0000 100 chr8:113905789-113905889 1.0000 100 ++chr9:44773666-44773766 1.0000 100 chr1:122244436-122244536 1.0000 100 ++chr4:34497471-34497571 1.0000 100 chr13:74873193-74873293 1.0000 100 ++chr7:106959478-106959578 1.0000 100 chr15:76883556-76883656 1.0000 100 ++chr1:9738233-9738333 1.0000 100 chr11:68709694-68709794 1.0000 100 ++chr1:36977018-36977118 1.0000 100 chr15:82060182-82060282 1.0000 100 ++chr1:77295121-77295221 1.0000 100 chr4:141307993-141308093 1.0000 100 ++chr14:21299129-21299229 1.0000 100 chr3:153454529-153454629 1.0000 100 ++chr3:138480015-138480115 1.0000 100 chr2:103728070-103728170 1.0000 100 ++chr9:107982358-107982458 1.0000 100 chr8:87494749-87494849 1.0000 100 ++chr1:135846956-135847056 1.0000 100 chr13:76003198-76003298 1.0000 100 ++chr4:154285744-154285844 1.0000 100 chr10:111261810-11126191 1.0000 100 ++chr11:101309432-10130953 1.0000 100 chr4:154862419-154862519 1.0000 100 ++chr7:56247541-56247641 1.0000 100 chr11:86476947-86477047 1.0000 100 ++chr3:151777795-151777895 1.0000 100 chr12:116856336-11685643 1.0000 100 ++chr7:134716501-134716601 1.0000 100 chr13:56459265-56459365 1.0000 100 ++chr13:23643344-23643444 1.0000 100 chr2:37405046-37405146 1.0000 100 ++chr7:16987194-16987294 1.0000 100 chr11:101176807-10117690 1.0000 100 ++chr6:38874025-38874125 1.0000 100 chr1:134264177-134264277 1.0000 100 ++chr13:113639369-11363946 1.0000 100 chr11:84636992-84637092 1.0000 100 ++chr10:20961509-20961609 1.0000 100 chr3:19087306-19087406 1.0000 100 ++chr4:122963964-122964064 1.0000 100 chr11:94858858-94858958 1.0000 100 ++chr7:106135437-106135537 1.0000 100 chr18:74156785-74156885 1.0000 100 ++chr16:3349854-3349954 1.0000 100 chr11:6313293-6313393 1.0000 100 ++chr12:110018191-11001829 1.0000 100 chr18:62325791-62325891 1.0000 100 ++chr8:107486056-107486156 1.0000 100 chr9:57618593-57618693 1.0000 100 ++chr7:6315631-6315731 1.0000 100 chr7:151917813-151917913 1.0000 100 ++chr9:70682446-70682546 1.0000 100 chr5:64826641-64826741 1.0000 100 ++chr6:35303480-35303580 1.0000 100 chr5:38900629-38900729 1.0000 100 ++chr2:131039491-131039591 1.0000 100 chr9:107206717-107206817 1.0000 100 ++chr12:85791924-85792024 1.0000 100 chr7:101244828-101244928 1.0000 100 ++chr11:80597917-80598017 1.0000 100 chr12:90222446-90222546 1.0000 100 ++chr9:42938267-42938367 1.0000 100 chr17:28960251-28960351 1.0000 100 ++chr8:73222227-73222327 1.0000 100 chr6:120124363-120124463 1.0000 100 ++chr5:27985059-27985159 1.0000 100 chr13:20241987-20242087 1.0000 100 ++chr17:84209564-84209664 1.0000 100 chr14:55690870-55690970 1.0000 100 ++chr1:135693775-135693875 1.0000 100 chr7:20321985-20322085 1.0000 100 ++chr7:86884670-86884770 1.0000 100 chr11:86427475-86427575 1.0000 100 ++chr1:173447613-173447713 1.0000 100 chr19:24348712-24348812 1.0000 100 ++chr8:19899370-19899470 1.0000 100 chr1:155596605-155596705 1.0000 100 ++chr14:70865966-70866066 1.0000 100 chr17:24339801-24339901 1.0000 100 ++chr7:82905683-82905783 1.0000 100 chr7:38977098-38977198 1.0000 100 ++chr7:149571621-149571721 1.0000 100 chr11:107308643-10730874 1.0000 100 ++chr14:79987351-79987451 1.0000 100 chr1:88208802-88208902 1.0000 100 ++chr11:107258863-10725896 1.0000 100 chr2:52304247-52304347 1.0000 100 ++chr5:77087236-77087336 1.0000 100 chr14:55043397-55043497 1.0000 100 ++chr14:41760573-41760673 1.0000 100 chr8:73367285-73367385 1.0000 100 ++chr7:148976465-148976565 1.0000 100 chr5:143814328-143814428 1.0000 100 ++chr9:44096485-44096585 1.0000 100 chr14:69922787-69922887 1.0000 100 ++chr18:75107912-75108012 1.0000 100 chr11:96817329-96817429 1.0000 100 ++chr15:62052573-62052673 1.0000 100 chr13:45622655-45622755 1.0000 100 ++chr17:45710229-45710329 1.0000 100 chr3:144332974-144333074 1.0000 100 ++chr2:152650540-152650640 1.0000 100 chr17:84179514-84179614 1.0000 100 ++chr11:69186640-69186740 1.0000 100 chr9:108709856-108709956 1.0000 100 ++chr7:28233710-28233810 1.0000 100 chr1:22562530-22562630 1.0000 100 ++chr6:38866492-38866592 1.0000 100 chr17:26079524-26079624 1.0000 100 ++chr19:4558364-4558464 1.0000 100 chr17:43466517-43466617 1.0000 100 ++chr3:151860092-151860192 1.0000 100 chr13:45499433-45499533 1.0000 100 ++chr3:104843904-104844004 1.0000 100 chr13:57679177-57679277 1.0000 100 ++chr15:98860005-98860105 1.0000 100 chr19:8797699-8797799 1.0000 100 ++chr11:89087922-89088022 1.0000 100 chr7:38970374-38970474 1.0000 100 ++chr11:97793525-97793625 1.0000 100 chr6:28617038-28617138 1.0000 100 ++chr13:107890788-10789088 1.0000 100 chr3:60589029-60589129 1.0000 100 ++chr7:148318027-148318127 1.0000 100 chr15:80573349-80573449 1.0000 100 ++chr5:129513005-129513105 1.0000 100 chr6:56190306-56190406 1.0000 100 ++chr6:72324693-72324793 1.0000 100 chr16:8686808-8686908 1.0000 100 ++chr4:111173962-111174062 1.0000 100 chr13:113537910-11353801 1.0000 100 ++chr6:34857295-34857395 1.0000 100 chr8:98213264-98213364 1.0000 100 ++chr15:27299346-27299446 1.0000 100 chr2:31917151-31917251 1.0000 100 ++chr10:59465794-59465894 1.0000 100 chr18:32716208-32716308 1.0000 100 ++chr3:96232775-96232875 1.0000 100 chr6:131327331-131327431 1.0000 100 ++chr18:34136393-34136493 1.0000 100 chr13:104969484-10496958 1.0000 100 ++chr4:154282317-154282417 1.0000 100 chr4:134960761-134960861 1.0000 100 ++chr8:51109538-51109638 1.0000 100 chr15:83253023-83253123 1.0000 100 ++chr5:118929926-118930026 1.0000 100 chr15:58828419-58828519 1.0000 100 ++chr11:105013713-10501381 1.0000 100 chr7:87847380-87847480 1.0000 100 ++chr13:114606035-11460613 1.0000 100 chr4:46419778-46419878 1.0000 100 ++chr5:33616213-33616313 1.0000 100 chr11:90524331-90524431 1.0000 100 ++******************************************************************************** ++ ++******************************************************************************** ++COMMAND LINE SUMMARY ++******************************************************************************** ++This information can also be useful in the event you wish to report a ++problem with the MEME software. ++ ++command: meme memechip_example_output_files/seqs-sampled -oc memechip_example_output_files/meme_out -dna -mod zoops -nmotifs 3 -minw 6 -maxw 30 -bfile memechip_example_output_files/background -revcomp -nostatus ++ ++model: mod= zoops nmotifs= 3 evt= inf ++object function= E-value of product of p-values ++width: minw= 6 maxw= 30 minic= 0.00 ++width: wg= 11 ws= 1 endgaps= yes ++nsites: minsites= 2 maxsites= 600 wnsites= 0.8 ++theta: prob= 1 spmap= uni spfuzz= 0.5 ++global: substring= yes branching= no wbranch= no ++em: prior= dirichlet b= 0.01 maxiter= 50 ++ distance= 1e-05 ++data: n= 60000 N= 600 ++strands: + - ++sample: seed= 0 seqfrac= 1 ++Letter frequencies in dataset: ++A 0.249 C 0.251 G 0.251 T 0.249 ++Background letter frequencies (from memechip_example_output_files/background): ++A 0.256 C 0.244 G 0.244 T 0.256 ++******************************************************************************** ++ ++ ++******************************************************************************** ++MOTIF 1 MEME width = 12 sites = 225 llr = 2169 E-value = 3.0e-225 ++******************************************************************************** ++-------------------------------------------------------------------------------- ++ Motif 1 Description ++-------------------------------------------------------------------------------- ++Simplified A 2431:7:8:::5 ++pos.-specific C 42:893a:aaa1 ++probability G 3361:::2:::: ++matrix T 12:11::::::4 ++ ++ bits 2.0 * * ++ 1.8 * *** ++ 1.6 * *** ++ 1.4 * * *** ++Relative 1.2 * ***** ++Entropy 1.0 ** ***** ++(13.9 bits) 0.8 ********* ++ 0.6 ********** ++ 0.4 ********** ++ 0.2 * ********** ++ 0.0 ------------ ++ ++Multilevel CAGCCACACCCA ++consensus GGA C T ++sequence ++ ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 1 sites sorted by position p-value ++-------------------------------------------------------------------------------- ++Sequence name Strand Start P-value Site ++------------- ------ ----- --------- ------------ ++chr17:28960251-28960351 - 25 1.05e-07 GGCCTAGGGT CAGCCACACCCA GAGCTACCTC ++chr5:65255864-65255964 + 6 1.05e-07 CTGGG CAGCCACACCCA ACATTCTCAC ++chr6:38866492-38866592 - 73 2.11e-07 XXXXXXXXGA CAGCCACACCCT TTCTCTATCT ++chr13:3866265-3866365 + 69 2.11e-07 CCTAGCCGTT CAGCCACACCCT TCTGGGTTGG ++chr13:112833729-11283382 - 36 2.11e-07 GATGATGAAG CAGCCACACCCT GCCATGAACT ++chr6:86027771-86027871 - 27 2.11e-07 ACAAGAGACT CGGCCACACCCT GTCTGCCATG ++chr15:76083899-76083999 + 51 2.11e-07 TGCGCTTGCT CAGCCACACCCT TTACCTTGGC ++chr16:91352913-91353013 + 61 2.11e-07 CCATGCTCAG CAGCCACACCCT GAGTCACTGG ++chr17:43466517-43466617 + 24 3.16e-07 AACCCTGGGA GGGCCACACCCA GCTTGCCTTG ++chr7:151917813-151917913 - 23 3.16e-07 CTGCTGCAGG GAGCCACACCCA GAAGGCAGGG ++chr5:45951564-45951664 + 67 3.16e-07 ACACGCCCCA GAGCCACACCCA GGTCTGGCAA ++chr3:51492457-51492557 - 28 3.16e-07 CGGTTTATAA GAGCCACACCCA TACTCCTGCT ++chr9:21940048-21940148 + 9 3.16e-07 CTACCACT GAGCCACACCCA AGTGTCCAGG ++chr9:112905110-112905210 - 85 3.16e-07 XTAG GGGCCACACCCA CXXXXXXXXX ++chr18:61379740-61379840 + 58 3.16e-07 GGGTGAAAAG GAGCCACACCCA TTCTCTCTTC ++chr19:53259936-53260036 - 12 3.16e-07 CGAATGTGGT GGGCCACACCCA CAGGAGCTGG ++chr15:58828419-58828519 + 74 4.22e-07 GCCATGTGAT GGGCCACACCCT GCCAGAGGCA ++chr7:28233710-28233810 + 41 4.22e-07 TCCAGATAAA GAGCCACACCCT TGCTAGCCTT ++chr1:136638481-136638581 + 12 4.22e-07 CTCTAAGCAG GGGCCACACCCT CTACATGGGC ++chr11:90524331-90524431 - 26 6.38e-07 AGCCTATCAC CTGCCACACCCA CTTCGGGCCT ++chr5:64826641-64826741 + 84 6.38e-07 GCCCCACCCA CTGCCACACCCA GTGCA ++chr13:3862102-3862202 - 20 6.38e-07 CTTGGCTGAG CAACCACACCCA GGCGTCTCCC ++chr4:43977110-43977210 - 32 6.38e-07 TTATCACTGG CGACCACACCCA GCCAGGGGAA ++chr5:33616213-33616313 + 53 9.54e-07 GGGCCTTACC CCGCCACACCCT GAAACAAACT ++chr6:72324693-72324793 - 84 9.54e-07 AAGCA CGACCACACCCT ACTTCTTGAT ++chr9:44096485-44096585 + 61 9.54e-07 CTTTGGAGCG CAGCCCCACCCA ACCCTAAAGT ++chr11:86427475-86427575 + 27 9.54e-07 TTCCATTTCC CAGCCCCACCCA CAGTGACTAG ++chr7:25993968-25994068 + 47 9.54e-07 GAACCTAAGC CAACCACACCCT GCCAGGTGAC ++chr1:169314207-169314307 + 18 9.54e-07 CAGGCAGCCT CTGCCACACCCT GGGTTGTTCC ++chr11:69186640-69186740 - 67 1.38e-06 GAGGAGATAA GAACCACACCCA CTGAGAAGGG ++chr17:84179514-84179614 - 44 1.38e-06 AGGTCCATAC AGGCCACACCCA GCACCAGATC ++chr14:41760573-41760673 + 66 1.38e-06 TTTGTTGTTT GTGCCACACCCA AAGGAGTCAA ++chr9:107206717-107206817 - 23 1.38e-06 TATTGGGAGT GAACCACACCCA AAGTTATCAC ++chr11:101309432-10130953 - 72 1.38e-06 TCTGAGCATA CAGCCCCACCCT TGGGCGGAGC ++chr15:82060182-82060282 + 11 1.38e-06 TGCATCCTTC CAGCCCCACCCT GTTTATCAGT ++chr7:19832206-19832306 + 35 1.38e-06 GAAAAGCCCC AGGCCACACCCA AGATGTCTGA ++chr9:7790420-7790520 - 74 1.38e-06 TAACATTGCT GTGCCACACCCA AACTACCAGC ++chr2:25742740-25742840 - 37 1.38e-06 TGATGCCCCA GTGCCACACCCA GGAAGAGCCA ++chr5:139858101-139858201 + 38 1.38e-06 CCTGCAGGTG AAGCCACACCCA GGTTTTTTTA ++chr12:80012616-80012716 + 17 1.38e-06 TTTACACACC CAGCCCCACCCT CGGGAGAGGC ++chr7:139969683-139969783 + 24 1.38e-06 TCAGCCTCAG AGGCCACACCCA GCACCCCAGT ++chr17:26079524-26079624 + 88 1.81e-06 GAACACTAAG GGACCACACCCT T ++chr11:96817329-96817429 - 79 1.81e-06 TTCCTTTCCT GAACCACACCCT TTTCTCTCCC ++chr11:107308643-10730874 + 81 1.81e-06 TCAAACTTAG GGACCACACCCT GTACCCCA ++chr5:27985059-27985159 + 77 1.81e-06 GATAACACTG AGGCCACACCCT ACTGCCCATC ++chr4:128532892-128532992 + 65 1.81e-06 AAGATTCTGA AAGCCACACCCT CTGCCCACTA ++chr1:133343882-133343982 - 39 1.81e-06 ATGATCAATC AGGCCACACCCT ACAACTACCC ++chr11:90547829-90547929 + 72 1.81e-06 ATACACCCTG GTGCCACACCCT GTCCCCAAGG ++chr9:108243079-108243179 + 30 1.91e-06 GCTACTGCTT GGGCCCCACCCT TTAAATATCT ++chr17:85277578-85277678 + 84 2.02e-06 AGGCCCTTGC TGGCCACACCCA GGAGC ++chr10:57527584-57527684 + 33 2.02e-06 GACAGTTCTA TGGCCACACCCA TAGAGACAGC ++chr6:34857295-34857395 + 17 2.34e-06 GGCTGGGCCT CCACCACACCCA AATTTATCAG ++chr17:45884715-45884815 + 47 2.34e-06 GATCTCCAAG CTACCACACCCA TGAGGTAGGA ++chr5:30289968-30290068 + 53 2.34e-06 TGGAGTCTGG CCACCACACCCA CCTAGAGCAC ++chr2:28462971-28463071 + 12 2.34e-06 TGGGCGGGGC CCACCACACCCA CTGACTCCAC ++chr11:115367839-11536793 + 80 2.34e-06 ACGTCTGTCA CCACCACACCCA CTGCTGACA ++chr14:79702843-79702943 + 53 2.34e-06 ACTTTGAAGT TAGCCACACCCT GCCTCCCTAG ++chr13:113537910-11353801 + 63 2.86e-06 AGATGTCTGG CTGCCCCACCCA GGTCTGCCAG ++chr1:155596605-155596705 - 14 2.86e-06 CACTGGCTCT CCGCCCCACCCA GAGCAGCTAG ++chr8:74937709-74937809 + 66 2.86e-06 TGTGAACATG CAGCCACGCCCT GGGATGCAGA ++chr19:6300360-6300460 - 2 2.86e-06 TGGCTCTAAC CAACCCCACCCA G ++chr6:81915768-81915868 - 1 2.86e-06 AGCCACCGTC CGGCCACACCCC ++chr12:102194282-10219438 + 21 2.86e-06 TTATCAAGCC CAACCCCACCCA GTCAACAGCT ++chr16:49776999-49777099 + 88 2.86e-06 TTAATAGTTG CCACCACACCCT C ++chr15:83139084-83139184 + 22 2.86e-06 TGGGTTTTAT CCACCACACCCT CTGGCCTCCA ++chr12:70394725-70394825 + 54 2.86e-06 TAACTTTCCT CTGCCCCACCCA CTCCTATCTG ++chr3:145253491-145253591 + 61 2.86e-06 AGATAAACTG CCACCACACCCT TGCTGACTGT ++chr1:135693775-135693875 + 4 3.50e-06 TAC CTGCCCCACCCT ATCCTCTTCA ++chr13:35887680-35887780 + 46 3.50e-06 AGCCTTCTCC CTGCCCCACCCT CCCTCCCTTG ++chr15:81700366-81700466 + 34 3.50e-06 GCTCTTTATT AGACCACACCCA GTTTGGCTCA ++chr8:107823857-107823957 - 31 3.50e-06 CCTCCCCTAC CTGCCCCACCCT GAACTTATCA ++chr10:110604368-11060446 - 36 3.50e-06 TCACCAGCAA ATGCCACACCCA GCGTCTCAGA ++chr10:111261810-11126191 - 46 4.35e-06 TGACTTTGGC AGACCACACCCT TCCTGCTCCC ++chr5:138127196-138127296 - 42 4.35e-06 TTGCTCTTGC AGACCACACCCT GTAGCAAAAG ++chr15:91082415-91082515 + 45 4.35e-06 GAGATAAAAG GCACCACACCCT CCCAGCAGAG ++chr3:84162552-84162652 - 66 4.35e-06 CATTTTGCAT GAGCCACACCCC TTCCCTCACC ++chr10:40726423-40726523 - 57 4.35e-06 CTGCCAGATG GTGCCCCACCCA GAGTATGCAA ++chr18:23868476-23868576 - 66 4.35e-06 AGCAGGCAGG GCACCACACCCT TTCTACCTAC ++chr12:27135943-27136043 + 81 4.66e-06 CCATTCAGCC AGGCCCCACCCT GCTAGCTC ++chr13:112863644-11286374 + 74 4.89e-06 GCTCACACTC TGACCACACCCA AATCTGCATA ++chr9:113850420-113850520 - 36 4.89e-06 CTCCCTAGCA TGACCACACCCA AAGCTGTTTC ++chr17:25039618-25039718 - 42 5.43e-06 TGCAGTTAAG TGACCACACCCT GGTGACAGTG ++chr10:60612189-60612289 - 19 5.43e-06 ATGCCATTGC TAACCACACCCT CATTTGAGTA ++chr14:63796626-63796726 + 49 5.43e-06 CCTGGCGCGA TGACCACACCCT AGAATTTGAT ++chr7:149571621-149571721 + 37 6.14e-06 TTTCCCTCAC CAACCACACCCC AGTCAGGTGG ++chr8:87494749-87494849 - 80 6.14e-06 GTGCTCCAC CCACCCCACCCA GTGGGATGGC ++chr4:44084688-44084788 + 65 6.14e-06 CCATTCCCCG CCGCCACACCCC TCCTATCGAG ++chr2:24832340-24832440 - 44 6.14e-06 AAGAGCACAG CAACCACGCCCT CTATGTTCTT ++chr7:99891352-99891452 + 20 6.14e-06 GACTTTGGGT CAACCACACCCC CTTTAGGAAT ++chr8:87362362-87362462 + 56 6.14e-06 TGCCCCATCA TGGCCCCACCCT GCCTAAGGCT ++chr4:122963964-122964064 - 28 6.97e-06 AGCCAAGAGA ACACCACACCCA GGTACAACAT ++chr4:154285744-154285844 - 29 6.97e-06 CAGTCCCACC CAGCCCCACCCC AACTCCATCT ++chr9:98389942-98390042 + 58 6.97e-06 TTCTTATCTT CAGCCCCACCCC ACCAGGCCAG ++chr4:129140944-129141044 + 67 6.97e-06 ACCATGCTCC CCACCCCACCCT ACCCCACCTT ++chr2:103962051-103962151 - 34 6.97e-06 CCCACCTCAA ACACCACACCCA TCCCTGAGAA ++chr15:34829704-34829804 - 33 6.97e-06 GTCTTATCTT CAGCCCCACCCC AACCCCAGTT ++chr5:115468249-115468349 + 22 6.97e-06 GTGAGTCTGA CAGGCACACCCA CTTCCCTCCA ++chr11:61433607-61433707 + 5 6.97e-06 CACC CTACCCCACCCT GCCTGCAGCT ++chr7:139915432-139915532 - 48 6.97e-06 TGTTACAAAA CAGCCCCGCCCT GACAGCGCTC ++chr5:77087236-77087336 - 71 8.35e-06 XAAAGCCATA GTACCCCACCCA CTGCATCCAA ++chr7:128112656-128112756 - 44 8.35e-06 CCAGTAACCA GCACCCCACCCA GACACCCTGG ++chr19:6236069-6236169 - 42 8.35e-06 AGCCTCTAGT GAACCACACCCC TCCCAGCAGG ++chr11:117187371-11718747 - 46 8.35e-06 GGGTTCTCTG AGGCCACACCCC TCCTCCCTCT ++chr9:31059931-31060031 - 18 8.35e-06 TCTGCTCCGA GGACCACACCCC TCTGGTTATC ++chr7:128850882-128850982 - 3 8.35e-06 TCAACACGCA GAACCACGCCCT AA ++chr2:167454294-167454394 + 48 8.35e-06 TGTGTGCATG AGGCCACACCCC TGCGTGTATA ++chr4:111173962-111174062 + 72 9.18e-06 CATGCTTGTA AGACCCCACCCT ATATCAGAGC ++chr19:44460304-44460404 - 57 9.18e-06 GGGACTTTTA GAGGCACACCCA AACTGCATCT ++chr7:148354573-148354673 - 44 9.18e-06 GCTCTCATCA CAGTCACACCCA TTTCGTGGCA ++chr4:44016939-44017039 - 84 9.18e-06 CTGTA GAGGCACACCCA AACTGCATCT ++chr2:72858950-72859050 - 73 9.18e-06 AAGGCCTTTA GAGGCACACCCA ATCTGCATCT ++chr3:60623495-60623595 - 32 9.18e-06 ACGTGGGAGA GGGGCACACCCA TTGGTCTGAG ++chr13:114649130-11464923 - 47 9.18e-06 GCATTACAGA GAGGCACACCCA AACCCAACAG ++chr12:112796793-11279689 - 36 9.18e-06 CAGATGTACC CAGTCACACCCA GGCCCTTTAG ++chr1:183078714-183078814 + 47 9.18e-06 GGAGCTTTTA GAGGCACACCCA AGCCGCACCT ++chr14:55043397-55043497 + 11 9.84e-06 GAAACTTTTA GAGGCACACCCT AACTGCTTCC ++chr9:70682446-70682546 + 19 9.84e-06 ACAGGGAAGT CAGACACACCCA GCCAGCGTGC ++chr2:31940724-31940824 - 63 9.84e-06 GGGCCGTGGT GGGGCACACCCT TAGTGTGACT ++chr2:157978336-157978436 + 46 9.84e-06 TTTGATAAAC TAGCCACGCCCA AGATAATATA ++chr7:111007529-111007629 - 21 1.08e-05 CCACAGTCTG TGACCCCACCCA GCTGACACTA ++chr7:20321985-20322085 - 52 1.18e-05 AGAACCACAA GGGACACACCCA CCCATGGGGC ++chr11:94858858-94858958 + 49 1.18e-05 GCACAATAGC CTACCACACCCC AGCCACCCCT ++chr11:69759802-69759902 + 35 1.18e-05 TATACCCCGC CCACCACACCCC AACAGCTGGT ++chr3:108248003-108248103 - 29 1.18e-05 CCGCATAAGG CTACCACGCCCT TTTCACTTCT ++chr16:44265653-44265753 - 3 1.18e-05 ACAGTAAGTG CTGCCCCGCCCA GA ++chr17:29067182-29067282 + 10 1.18e-05 GACACGTCT GGGACACACCCA TATCCCAATT ++chr4:132847120-132847220 - 33 1.18e-05 ACTTTCCACT GAGTCACACCCT TGCCCTATCT ++chr10:126642276-12664237 + 58 1.18e-05 CCAGTGGGAA GAGACACACCCA GTTTCTGTTA ++chr16:10384211-10384311 - 14 1.29e-05 AACTAGAGTC CTGCCCCACCCC TCCTCTCCTC ++chr9:75406568-75406668 - 54 1.29e-05 CACAAAACTT GGGACACACCCT TTTTGTGATT ++chr11:115373882-11537398 + 76 1.29e-05 ATCTCCAGTT CTGCCCCGCCCT GTAAGCGCTG ++chr13:74873193-74873293 - 26 1.47e-05 AGTGTAGGGA GCACCACGCCCT GAGAGTGGGA ++chr5:89197188-89197288 - 42 1.47e-05 CTTCTAAAGA GCACCACGCCCT ATCTATCAGA ++chr14:21299129-21299229 - 10 1.65e-05 CCCACTTGCG CGGCTCCACCCA AAGCTGCAG ++chr2:93306456-93306556 - 31 1.65e-05 ATATCTACCC AGGCCCCGCCCT TACAGTCCCA ++chr3:79383669-79383769 + 49 1.65e-05 GCGTGCTGAA GGCCCACACCCA AATAAATGTG ++chr11:53839887-53839987 + 59 1.83e-05 CTGCAGGTGG GACCCACACCCT AGCTGTCTAC ++chr12:78031164-78031264 + 20 1.83e-05 TTTATCTCCC TGACCACGCCCA CCCATCATGC ++chr4:151334551-151334651 - 9 2.02e-05 CTAGCCTATG GGGCTCCACCCA GGTTTCTG ++chr17:47735005-47735105 - 52 2.02e-05 CAAGTGTCCT TCACCCCACCCA CTCCTCTCCA ++chr9:21362670-21362770 - 60 2.02e-05 GAAGATAGGT CTGACACACCCT CCTGAGTTGG ++chr11:32168936-32169036 - 31 2.02e-05 TAGCGTCTGT GAGCTCCACCCA GCCCTTGGCC ++chr15:78243389-78243489 - 38 2.02e-05 GCCTAAGGCG AAGTCACACCCA AAGTCACTGT ++chr11:115374473-11537457 + 32 2.02e-05 GATGGCTCCC TAGCCCCGCCCA AGCACAGACA ++chr11:44322388-44322488 + 6 2.02e-05 CTGCT GGGCTCCACCCA GCAGCCGGCC ++chr16:8686808-8686908 + 50 2.21e-05 CTGATTACGG TCACCCCACCCT CTGTGACAGC ++chr1:77295121-77295221 + 18 2.21e-05 CCCGTCTGAT AGGTCACACCCT GTCTGTTCAG ++chr19:55940203-55940303 - 60 2.21e-05 CAGTTATGCC GTGTCACACCCT ATTACTGTCA ++chr14:56154882-56154982 + 40 2.21e-05 AGGACATTGC AGGTCACACCCT GCCCCCTGGT ++chr15:95715579-95715679 - 80 2.21e-05 CAGTGTTAC TAGCCCCGCCCT GGGTCCCACC ++chr5:118929926-118930026 - 29 2.38e-05 GTCTGGCCGT CAGCCTCACCCA GTGAACAGAG ++chr1:9738233-9738333 + 16 2.38e-05 GTAACGGCCA CCACCCCACCCC GCACTCACAC ++chr16:49839620-49839720 + 75 2.38e-05 ACACTTGAAT GAAACACACCCT GCCCTCGGTT ++chr1:82633923-82634023 + 27 2.38e-05 AGACACAGGC AGGACACACCCT AACTGTGTGG ++chr4:118293096-118293196 + 60 2.38e-05 CGAAGCAATC CGGGCACGCCCA AACGCTAGAG ++chr11:117642059-11764215 - 69 2.38e-05 TTAGAAACAG ACACCACGCCCA GGGCGGAGCG ++chr4:9588077-9588177 + 62 2.38e-05 TGGCCCCTCC CCACCCCGCCCT TGAACAGTGC ++chr9:108709856-108709956 - 75 2.61e-05 ACTCCCTTCT GGACCACGCCCC AACTTGTCAA ++chr11:68709694-68709794 + 49 2.61e-05 TGTAGACCTA GGTCCACACCCA ACAGACACTG ++chr5:143681949-143682049 + 36 2.61e-05 GCTGCTAAGG TGGTCACACCCA GCCTTGCCAA ++chr8:24164439-24164539 + 26 2.61e-05 TGGAGTACCT CAGGCACGCCCT TATCAATGGT ++chr14:70865966-70866066 - 48 2.91e-05 CAAGTGGGGA ACGCCCCACCCC AGCTGCCAGT ++chr11:84636992-84637092 + 33 2.91e-05 TGTCTTCGGT CTGCTCCACCCA TCAGCCTTGC ++chr13:56459265-56459365 - 54 2.91e-05 CTCTCAGCAT CAGCTACGCCCT TAGAAGACTG ++chr10:40924607-40924707 + 80 2.91e-05 GCGAGATGAT AAAGCACACCCA GCCACACCC ++chr7:148956812-148956912 - 38 2.91e-05 TACCACAACG CAGCCGCACCCA AGAGGAGACA ++chr5:73746597-73746697 - 72 2.91e-05 TACTTTGCAC CTGCTCCACCCA GCCTCTCTAC ++chr16:76323701-76323801 + 66 2.91e-05 GCAAGTGCCC TGGACACACCCA AGTAGGGATG ++chr2:25869095-25869195 - 40 3.21e-05 GACAGATCCT GGGCCTCACCCT GCTTTCCTCG ++chr9:114375901-114376001 + 36 3.21e-05 ACCCCTTCCT GGGCCTCACCCT GTGCTGAGCA ++chr19:45865026-45865126 + 58 3.21e-05 TTCCTACCAT TCACCACGCCCA GTGAACAAGC ++chr11:32150817-32150917 - 21 3.21e-05 CCACAGTGGT CTGCTCCACCCT TGGCCTGGGT ++chr1:75175759-75175859 + 26 3.54e-05 TGACTCAGCA CAGACACACCCC ATCCAATGCT ++chr12:70860460-70860560 + 55 3.54e-05 TTGGCGCCTA GGACTCCACCCA TTGTAACTGC ++chr9:70774507-70774607 + 28 3.54e-05 GTTGAGTTCA GGACTCCACCCA TGCCCTTTCC ++chr13:57679177-57679277 + 23 3.85e-05 GCATCTGCAA GAGTCACGCCCT TCTTAGAACT ++chr5:65203206-65203306 - 42 3.85e-05 GATAAGATTC TGCCCACACCCA GTACTTCGGA ++chr11:121295412-12129551 + 84 3.85e-05 CCCATGGCTA GGACTCCACCCT TATCT ++chr4:118863135-118863235 + 50 3.85e-05 CCCTCCTCTC ACGTCACACCCT CCCCAACTGA ++chr13:73612724-73612824 - 47 3.85e-05 AGAAACACCC TAAGCACACCCA GGTGTGGCCT ++chr1:36976472-36976572 + 38 4.16e-05 TCTGAGAGTT AAGTCCCACCCT CAGAGGAGCT ++chr6:135115627-135115727 + 37 4.16e-05 AAGCATTCTC AAGACCCACCCA ACTAAGCACA ++chr4:41334758-41334858 - 8 4.49e-05 GGTAAACAAA CCGGCACGCCCT TCTAGAA ++chr17:24289204-24289304 + 68 4.49e-05 GCTGTCCCCC AATCCACACCCA TACCACAGGC ++chr9:66763905-66764005 - 27 4.49e-05 AATTTGATAA GCACCACGCCCC AGGAAAGAGC ++chr6:34428673-34428773 - 45 4.49e-05 GCCGAGGTAC TTGCTACACCCT GCTAGCAATC ++chr13:100518007-10051810 + 80 4.91e-05 TCTGCAGAAA CAGCTCCGCCCA GTTCCGCCC ++chr5:143814328-143814428 + 10 5.87e-05 TCCGTTTCT CTAACCCACCCA TGCCCAAAGT ++chr14:55690870-55690970 - 43 5.87e-05 AAGCAACTCC CAGCCACACACT GGGGGACCCA ++chr4:117504523-117504623 - 24 5.87e-05 AGGCAGTACT GGACCGCACCCA TTGCTTGCTG ++chr2:164599350-164599450 - 77 5.87e-05 GCTGCTTCAA GGACTACGCCCT TTTCCTTTGC ++chr17:48438406-48438506 - 54 5.87e-05 ATTTGGCCCA AGACTCCACCCA TCCCTCTGTC ++chr16:32508974-32509074 + 78 5.87e-05 CTTCTCAGAC TTACCCCGCCCA GTCTTTGGCT ++chr11:104842982-10484308 - 83 6.36e-05 ACTAAA TGTCCACACCCT GAGAGCAXXX ++chr6:57653288-57653388 + 71 6.36e-05 AGAAACGCTA AAGTCACGCCCT CTTAATTTTT ++chr12:112505814-11250591 - 57 6.36e-05 CCTACTCCAG AGGTCACGCCCT GTCAGTTTCT ++chr3:88305499-88305599 - 33 6.86e-05 AGGGAGCCTC AGGCCACTCCCA TTGCAXXXXX ++chr2:152650540-152650640 + 31 7.31e-05 TCATCAGTGA CTACTACGCCCA AGACCTGTGC ++chr11:50038237-50038337 + 78 7.31e-05 CGGCTACAGC GGGCCCCTCCCA TGCCAGATCC ++chrX:146984103-146984203 + 30 7.31e-05 TTCTTCTTCT CTCCCACGCCCT GGGCTCATCC ++chr11:87539593-87539693 - 20 7.89e-05 AAGAGAGAAG CAGCCACAACCA ACTGTCAAGT ++chr11:86476947-86477047 + 43 8.59e-05 GATTATCATA CAGCCACACTCT TACTCAGACA ++chr17:47754579-47754679 + 34 9.26e-05 CATTAGGAGT TGGTCACACCCN NNNNNNNNNN ++chr11:69793284-69793384 + 50 9.26e-05 AGCCTTCAGG AGACTACGCCCT TCCCACTCCA ++chr7:28320390-28320490 + 10 1.01e-04 AACCATCCC TTGCCCCGCCCC NNNNNNNNNN ++chr15:73181611-73181711 + 73 1.01e-04 ATATCAAGGA CTACCACTCCCT ACATCTCAGC ++chr7:135432388-135432488 + 60 1.01e-04 CCCAGAAACT GGGCGACACCCT CCTGCAGCTC ++chr17:26651346-26651446 - 82 1.01e-04 CACCCAT GTGCCACACCTA CTGTGTGTCC ++chr10:59336304-59336404 - 16 1.01e-04 AACGACGAAT GGACTCCGCCCT AAGTGGTCTG ++chr11:105013713-10501381 + 73 1.08e-04 CAAATTACTA CAACACCACCCA AGCGGGCCAG ++chr6:83115545-83115645 - 55 1.15e-04 CTCATTCCTG CTGCCTCGCCCT AGCTGACAAG ++chr8:83025149-83025249 - 23 1.15e-04 TGTCTGCCAC TGGGCCCGCCCT CTTGCCTACC ++chr4:128287321-128287421 - 43 1.32e-04 GTAGACCCCG ACCCCACGCCCT TCTAATCTAG ++chr1:92185725-92185825 + 40 1.32e-04 CTCAGAAGGG CGTCTACACCCT CTTGACTAGA ++chr1:135696218-135696318 - 5 1.32e-04 TCTGAGGGCA CCGCCCCACGCA TCTC ++chr3:60589029-60589129 + 19 1.53e-04 GAGCCTTCTT TCAGCACGCCCA CTGGCTGGGA ++chr9:42909937-42910037 + 77 1.73e-04 CTGCAAAACA GAACAACGCCCA AANNNNNNNN ++chr10:128184603-12818470 - 60 1.73e-04 CTAATTAGCC GCGCCCCACACT TCGGATTAGC ++chr4:118862380-118862480 + 57 1.83e-04 ATAAACAAAC AAGCAACGCCCT GTCTGCCCAC ++chr15:56455063-56455163 - 46 2.09e-04 TGGCATTTAC GGCCCCCGCCCC TCAACAGTTG ++chr1:88057040-88057140 + 37 2.70e-04 GGAGGATGGC GGCACACGCCCT ATCCGCAGGA ++chr17:87913077-87913177 - 20 3.05e-04 GGAGAGACGC CAAGCACACGCA GTTTAGAATT ++chr17:25716183-25716283 + 82 3.73e-04 GTGAGCTTCC GGACCCCGCCTT CTCACCT ++chr14:63729028-63729128 + 59 5.69e-04 NNNNNNNNNN NNNNCGCACCCT GGGAGGGCCC ++chr11:51213800-51213900 + 16 8.63e-03 AAATCATCCT CCGCCACANNNN NNNNNNNNNN ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 1 block diagrams ++-------------------------------------------------------------------------------- ++SEQUENCE NAME POSITION P-VALUE MOTIF DIAGRAM ++------------- ---------------- ------------- ++chr17:28960251-28960351 1.1e-07 24_[-1]_64 ++chr5:65255864-65255964 1.1e-07 5_[+1]_83 ++chr6:38866492-38866592 2.1e-07 72_[-1]_16 ++chr13:3866265-3866365 2.1e-07 68_[+1]_20 ++chr13:112833729-11283382 2.1e-07 35_[-1]_53 ++chr6:86027771-86027871 2.1e-07 26_[-1]_62 ++chr15:76083899-76083999 2.1e-07 50_[+1]_38 ++chr16:91352913-91353013 2.1e-07 60_[+1]_28 ++chr17:43466517-43466617 3.2e-07 23_[+1]_65 ++chr7:151917813-151917913 3.2e-07 22_[-1]_66 ++chr5:45951564-45951664 3.2e-07 66_[+1]_22 ++chr3:51492457-51492557 3.2e-07 27_[-1]_61 ++chr9:21940048-21940148 3.2e-07 8_[+1]_80 ++chr9:112905110-112905210 3.2e-07 84_[-1]_4 ++chr18:61379740-61379840 3.2e-07 57_[+1]_31 ++chr19:53259936-53260036 3.2e-07 11_[-1]_77 ++chr15:58828419-58828519 4.2e-07 73_[+1]_15 ++chr7:28233710-28233810 4.2e-07 40_[+1]_48 ++chr1:136638481-136638581 4.2e-07 11_[+1]_77 ++chr11:90524331-90524431 6.4e-07 25_[-1]_63 ++chr5:64826641-64826741 6.4e-07 83_[+1]_5 ++chr13:3862102-3862202 6.4e-07 19_[-1]_69 ++chr4:43977110-43977210 6.4e-07 31_[-1]_57 ++chr5:33616213-33616313 9.5e-07 52_[+1]_36 ++chr6:72324693-72324793 9.5e-07 83_[-1]_5 ++chr9:44096485-44096585 9.5e-07 60_[+1]_28 ++chr11:86427475-86427575 9.5e-07 26_[+1]_62 ++chr7:25993968-25994068 9.5e-07 46_[+1]_42 ++chr1:169314207-169314307 9.5e-07 17_[+1]_71 ++chr11:69186640-69186740 1.4e-06 66_[-1]_22 ++chr17:84179514-84179614 1.4e-06 43_[-1]_45 ++chr14:41760573-41760673 1.4e-06 65_[+1]_23 ++chr9:107206717-107206817 1.4e-06 22_[-1]_66 ++chr11:101309432-10130953 1.4e-06 71_[-1]_17 ++chr15:82060182-82060282 1.4e-06 10_[+1]_78 ++chr7:19832206-19832306 1.4e-06 34_[+1]_54 ++chr9:7790420-7790520 1.4e-06 73_[-1]_15 ++chr2:25742740-25742840 1.4e-06 36_[-1]_52 ++chr5:139858101-139858201 1.4e-06 37_[+1]_51 ++chr12:80012616-80012716 1.4e-06 16_[+1]_72 ++chr7:139969683-139969783 1.4e-06 23_[+1]_65 ++chr17:26079524-26079624 1.8e-06 87_[+1]_1 ++chr11:96817329-96817429 1.8e-06 78_[-1]_10 ++chr11:107308643-10730874 1.8e-06 80_[+1]_8 ++chr5:27985059-27985159 1.8e-06 76_[+1]_12 ++chr4:128532892-128532992 1.8e-06 64_[+1]_24 ++chr1:133343882-133343982 1.8e-06 38_[-1]_50 ++chr11:90547829-90547929 1.8e-06 71_[+1]_17 ++chr9:108243079-108243179 1.9e-06 29_[+1]_59 ++chr17:85277578-85277678 2e-06 83_[+1]_5 ++chr10:57527584-57527684 2e-06 32_[+1]_56 ++chr6:34857295-34857395 2.3e-06 16_[+1]_72 ++chr17:45884715-45884815 2.3e-06 46_[+1]_42 ++chr5:30289968-30290068 2.3e-06 52_[+1]_36 ++chr2:28462971-28463071 2.3e-06 11_[+1]_77 ++chr11:115367839-11536793 2.3e-06 79_[+1]_9 ++chr14:79702843-79702943 2.3e-06 52_[+1]_36 ++chr13:113537910-11353801 2.9e-06 62_[+1]_26 ++chr1:155596605-155596705 2.9e-06 13_[-1]_75 ++chr8:74937709-74937809 2.9e-06 65_[+1]_23 ++chr19:6300360-6300460 2.9e-06 1_[-1]_87 ++chr6:81915768-81915868 2.9e-06 [-1]_88 ++chr12:102194282-10219438 2.9e-06 20_[+1]_68 ++chr16:49776999-49777099 2.9e-06 87_[+1]_1 ++chr15:83139084-83139184 2.9e-06 21_[+1]_67 ++chr12:70394725-70394825 2.9e-06 53_[+1]_35 ++chr3:145253491-145253591 2.9e-06 60_[+1]_28 ++chr1:135693775-135693875 3.5e-06 3_[+1]_85 ++chr13:35887680-35887780 3.5e-06 45_[+1]_43 ++chr15:81700366-81700466 3.5e-06 33_[+1]_55 ++chr8:107823857-107823957 3.5e-06 30_[-1]_58 ++chr10:110604368-11060446 3.5e-06 35_[-1]_53 ++chr10:111261810-11126191 4.4e-06 45_[-1]_43 ++chr5:138127196-138127296 4.4e-06 41_[-1]_47 ++chr15:91082415-91082515 4.4e-06 44_[+1]_44 ++chr3:84162552-84162652 4.4e-06 65_[-1]_23 ++chr10:40726423-40726523 4.4e-06 56_[-1]_32 ++chr18:23868476-23868576 4.4e-06 65_[-1]_23 ++chr12:27135943-27136043 4.7e-06 80_[+1]_8 ++chr13:112863644-11286374 4.9e-06 73_[+1]_15 ++chr9:113850420-113850520 4.9e-06 35_[-1]_53 ++chr17:25039618-25039718 5.4e-06 41_[-1]_47 ++chr10:60612189-60612289 5.4e-06 18_[-1]_70 ++chr14:63796626-63796726 5.4e-06 48_[+1]_40 ++chr7:149571621-149571721 6.1e-06 36_[+1]_52 ++chr8:87494749-87494849 6.1e-06 79_[-1]_9 ++chr4:44084688-44084788 6.1e-06 64_[+1]_24 ++chr2:24832340-24832440 6.1e-06 43_[-1]_45 ++chr7:99891352-99891452 6.1e-06 19_[+1]_69 ++chr8:87362362-87362462 6.1e-06 55_[+1]_33 ++chr4:122963964-122964064 7e-06 27_[-1]_61 ++chr4:154285744-154285844 7e-06 28_[-1]_60 ++chr9:98389942-98390042 7e-06 57_[+1]_31 ++chr4:129140944-129141044 7e-06 66_[+1]_22 ++chr2:103962051-103962151 7e-06 33_[-1]_55 ++chr15:34829704-34829804 7e-06 32_[-1]_56 ++chr5:115468249-115468349 7e-06 21_[+1]_67 ++chr11:61433607-61433707 7e-06 4_[+1]_84 ++chr7:139915432-139915532 7e-06 47_[-1]_41 ++chr5:77087236-77087336 8.3e-06 70_[-1]_18 ++chr7:128112656-128112756 8.3e-06 43_[-1]_45 ++chr19:6236069-6236169 8.3e-06 41_[-1]_47 ++chr11:117187371-11718747 8.3e-06 45_[-1]_43 ++chr9:31059931-31060031 8.3e-06 17_[-1]_71 ++chr7:128850882-128850982 8.3e-06 2_[-1]_86 ++chr2:167454294-167454394 8.3e-06 47_[+1]_41 ++chr4:111173962-111174062 9.2e-06 71_[+1]_17 ++chr19:44460304-44460404 9.2e-06 56_[-1]_32 ++chr7:148354573-148354673 9.2e-06 43_[-1]_45 ++chr4:44016939-44017039 9.2e-06 83_[-1]_5 ++chr2:72858950-72859050 9.2e-06 72_[-1]_16 ++chr3:60623495-60623595 9.2e-06 31_[-1]_57 ++chr13:114649130-11464923 9.2e-06 46_[-1]_42 ++chr12:112796793-11279689 9.2e-06 35_[-1]_53 ++chr1:183078714-183078814 9.2e-06 46_[+1]_42 ++chr14:55043397-55043497 9.8e-06 10_[+1]_78 ++chr9:70682446-70682546 9.8e-06 18_[+1]_70 ++chr2:31940724-31940824 9.8e-06 62_[-1]_26 ++chr2:157978336-157978436 9.8e-06 45_[+1]_43 ++chr7:111007529-111007629 1.1e-05 20_[-1]_68 ++chr7:20321985-20322085 1.2e-05 51_[-1]_37 ++chr11:94858858-94858958 1.2e-05 48_[+1]_40 ++chr11:69759802-69759902 1.2e-05 34_[+1]_54 ++chr3:108248003-108248103 1.2e-05 28_[-1]_60 ++chr16:44265653-44265753 1.2e-05 2_[-1]_86 ++chr17:29067182-29067282 1.2e-05 9_[+1]_79 ++chr4:132847120-132847220 1.2e-05 32_[-1]_56 ++chr10:126642276-12664237 1.2e-05 57_[+1]_31 ++chr16:10384211-10384311 1.3e-05 13_[-1]_75 ++chr9:75406568-75406668 1.3e-05 53_[-1]_35 ++chr11:115373882-11537398 1.3e-05 75_[+1]_13 ++chr13:74873193-74873293 1.5e-05 25_[-1]_63 ++chr5:89197188-89197288 1.5e-05 41_[-1]_47 ++chr14:21299129-21299229 1.6e-05 9_[-1]_79 ++chr2:93306456-93306556 1.6e-05 30_[-1]_58 ++chr3:79383669-79383769 1.6e-05 48_[+1]_40 ++chr11:53839887-53839987 1.8e-05 58_[+1]_30 ++chr12:78031164-78031264 1.8e-05 19_[+1]_69 ++chr4:151334551-151334651 2e-05 8_[-1]_80 ++chr17:47735005-47735105 2e-05 51_[-1]_37 ++chr9:21362670-21362770 2e-05 59_[-1]_29 ++chr11:32168936-32169036 2e-05 30_[-1]_58 ++chr15:78243389-78243489 2e-05 37_[-1]_51 ++chr11:115374473-11537457 2e-05 31_[+1]_57 ++chr11:44322388-44322488 2e-05 5_[+1]_83 ++chr16:8686808-8686908 2.2e-05 49_[+1]_39 ++chr1:77295121-77295221 2.2e-05 17_[+1]_71 ++chr19:55940203-55940303 2.2e-05 59_[-1]_29 ++chr14:56154882-56154982 2.2e-05 39_[+1]_49 ++chr15:95715579-95715679 2.2e-05 79_[-1]_9 ++chr5:118929926-118930026 2.4e-05 28_[-1]_60 ++chr1:9738233-9738333 2.4e-05 15_[+1]_73 ++chr16:49839620-49839720 2.4e-05 74_[+1]_14 ++chr1:82633923-82634023 2.4e-05 26_[+1]_62 ++chr4:118293096-118293196 2.4e-05 59_[+1]_29 ++chr11:117642059-11764215 2.4e-05 68_[-1]_20 ++chr4:9588077-9588177 2.4e-05 61_[+1]_27 ++chr9:108709856-108709956 2.6e-05 74_[-1]_14 ++chr11:68709694-68709794 2.6e-05 48_[+1]_40 ++chr5:143681949-143682049 2.6e-05 35_[+1]_53 ++chr8:24164439-24164539 2.6e-05 25_[+1]_63 ++chr14:70865966-70866066 2.9e-05 47_[-1]_41 ++chr11:84636992-84637092 2.9e-05 32_[+1]_56 ++chr13:56459265-56459365 2.9e-05 53_[-1]_35 ++chr10:40924607-40924707 2.9e-05 79_[+1]_9 ++chr7:148956812-148956912 2.9e-05 37_[-1]_51 ++chr5:73746597-73746697 2.9e-05 71_[-1]_17 ++chr16:76323701-76323801 2.9e-05 65_[+1]_23 ++chr2:25869095-25869195 3.2e-05 39_[-1]_49 ++chr9:114375901-114376001 3.2e-05 35_[+1]_53 ++chr19:45865026-45865126 3.2e-05 57_[+1]_31 ++chr11:32150817-32150917 3.2e-05 20_[-1]_68 ++chr1:75175759-75175859 3.5e-05 25_[+1]_63 ++chr12:70860460-70860560 3.5e-05 54_[+1]_34 ++chr9:70774507-70774607 3.5e-05 27_[+1]_61 ++chr13:57679177-57679277 3.9e-05 22_[+1]_66 ++chr5:65203206-65203306 3.9e-05 41_[-1]_47 ++chr11:121295412-12129551 3.9e-05 83_[+1]_5 ++chr4:118863135-118863235 3.9e-05 49_[+1]_39 ++chr13:73612724-73612824 3.9e-05 46_[-1]_42 ++chr1:36976472-36976572 4.2e-05 37_[+1]_51 ++chr6:135115627-135115727 4.2e-05 36_[+1]_52 ++chr4:41334758-41334858 4.5e-05 7_[-1]_81 ++chr17:24289204-24289304 4.5e-05 67_[+1]_21 ++chr9:66763905-66764005 4.5e-05 26_[-1]_62 ++chr6:34428673-34428773 4.5e-05 44_[-1]_44 ++chr13:100518007-10051810 4.9e-05 79_[+1]_9 ++chr5:143814328-143814428 5.9e-05 9_[+1]_79 ++chr14:55690870-55690970 5.9e-05 42_[-1]_46 ++chr4:117504523-117504623 5.9e-05 23_[-1]_65 ++chr2:164599350-164599450 5.9e-05 76_[-1]_12 ++chr17:48438406-48438506 5.9e-05 53_[-1]_35 ++chr16:32508974-32509074 5.9e-05 77_[+1]_11 ++chr11:104842982-10484308 6.4e-05 82_[-1]_6 ++chr6:57653288-57653388 6.4e-05 70_[+1]_18 ++chr12:112505814-11250591 6.4e-05 56_[-1]_32 ++chr3:88305499-88305599 6.9e-05 32_[-1]_56 ++chr2:152650540-152650640 7.3e-05 30_[+1]_58 ++chr11:50038237-50038337 7.3e-05 77_[+1]_11 ++chrX:146984103-146984203 7.3e-05 29_[+1]_59 ++chr11:87539593-87539693 7.9e-05 19_[-1]_69 ++chr11:86476947-86477047 8.6e-05 42_[+1]_46 ++chr17:47754579-47754679 9.3e-05 33_[+1]_55 ++chr11:69793284-69793384 9.3e-05 49_[+1]_39 ++chr7:28320390-28320490 0.0001 9_[+1]_79 ++chr15:73181611-73181711 0.0001 72_[+1]_16 ++chr7:135432388-135432488 0.0001 59_[+1]_29 ++chr17:26651346-26651446 0.0001 81_[-1]_7 ++chr10:59336304-59336404 0.0001 15_[-1]_73 ++chr11:105013713-10501381 0.00011 72_[+1]_16 ++chr6:83115545-83115645 0.00011 54_[-1]_34 ++chr8:83025149-83025249 0.00011 22_[-1]_66 ++chr4:128287321-128287421 0.00013 42_[-1]_46 ++chr1:92185725-92185825 0.00013 39_[+1]_49 ++chr1:135696218-135696318 0.00013 4_[-1]_84 ++chr3:60589029-60589129 0.00015 18_[+1]_70 ++chr9:42909937-42910037 0.00017 76_[+1]_12 ++chr10:128184603-12818470 0.00017 59_[-1]_29 ++chr4:118862380-118862480 0.00018 56_[+1]_32 ++chr15:56455063-56455163 0.00021 45_[-1]_43 ++chr1:88057040-88057140 0.00027 36_[+1]_52 ++chr17:87913077-87913177 0.00031 19_[-1]_69 ++chr17:25716183-25716283 0.00037 81_[+1]_7 ++chr14:63729028-63729128 0.00057 58_[+1]_30 ++chr11:51213800-51213900 0.0086 15_[+1]_73 ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 1 in BLOCKS format ++-------------------------------------------------------------------------------- ++BL MOTIF 1 width=12 seqs=225 ++chr17:28960251-28960351 ( 25) CAGCCACACCCA 1 ++chr5:65255864-65255964 ( 6) CAGCCACACCCA 1 ++chr6:38866492-38866592 ( 73) CAGCCACACCCT 1 ++chr13:3866265-3866365 ( 69) CAGCCACACCCT 1 ++chr13:112833729-11283382 ( 36) CAGCCACACCCT 1 ++chr6:86027771-86027871 ( 27) CGGCCACACCCT 1 ++chr15:76083899-76083999 ( 51) CAGCCACACCCT 1 ++chr16:91352913-91353013 ( 61) CAGCCACACCCT 1 ++chr17:43466517-43466617 ( 24) GGGCCACACCCA 1 ++chr7:151917813-151917913 ( 23) GAGCCACACCCA 1 ++chr5:45951564-45951664 ( 67) GAGCCACACCCA 1 ++chr3:51492457-51492557 ( 28) GAGCCACACCCA 1 ++chr9:21940048-21940148 ( 9) GAGCCACACCCA 1 ++chr9:112905110-112905210 ( 85) GGGCCACACCCA 1 ++chr18:61379740-61379840 ( 58) GAGCCACACCCA 1 ++chr19:53259936-53260036 ( 12) GGGCCACACCCA 1 ++chr15:58828419-58828519 ( 74) GGGCCACACCCT 1 ++chr7:28233710-28233810 ( 41) GAGCCACACCCT 1 ++chr1:136638481-136638581 ( 12) GGGCCACACCCT 1 ++chr11:90524331-90524431 ( 26) CTGCCACACCCA 1 ++chr5:64826641-64826741 ( 84) CTGCCACACCCA 1 ++chr13:3862102-3862202 ( 20) CAACCACACCCA 1 ++chr4:43977110-43977210 ( 32) CGACCACACCCA 1 ++chr5:33616213-33616313 ( 53) CCGCCACACCCT 1 ++chr6:72324693-72324793 ( 84) CGACCACACCCT 1 ++chr9:44096485-44096585 ( 61) CAGCCCCACCCA 1 ++chr11:86427475-86427575 ( 27) CAGCCCCACCCA 1 ++chr7:25993968-25994068 ( 47) CAACCACACCCT 1 ++chr1:169314207-169314307 ( 18) CTGCCACACCCT 1 ++chr11:69186640-69186740 ( 67) GAACCACACCCA 1 ++chr17:84179514-84179614 ( 44) AGGCCACACCCA 1 ++chr14:41760573-41760673 ( 66) GTGCCACACCCA 1 ++chr9:107206717-107206817 ( 23) GAACCACACCCA 1 ++chr11:101309432-10130953 ( 72) CAGCCCCACCCT 1 ++chr15:82060182-82060282 ( 11) CAGCCCCACCCT 1 ++chr7:19832206-19832306 ( 35) AGGCCACACCCA 1 ++chr9:7790420-7790520 ( 74) GTGCCACACCCA 1 ++chr2:25742740-25742840 ( 37) GTGCCACACCCA 1 ++chr5:139858101-139858201 ( 38) AAGCCACACCCA 1 ++chr12:80012616-80012716 ( 17) CAGCCCCACCCT 1 ++chr7:139969683-139969783 ( 24) AGGCCACACCCA 1 ++chr17:26079524-26079624 ( 88) GGACCACACCCT 1 ++chr11:96817329-96817429 ( 79) GAACCACACCCT 1 ++chr11:107308643-10730874 ( 81) GGACCACACCCT 1 ++chr5:27985059-27985159 ( 77) AGGCCACACCCT 1 ++chr4:128532892-128532992 ( 65) AAGCCACACCCT 1 ++chr1:133343882-133343982 ( 39) AGGCCACACCCT 1 ++chr11:90547829-90547929 ( 72) GTGCCACACCCT 1 ++chr9:108243079-108243179 ( 30) GGGCCCCACCCT 1 ++chr17:85277578-85277678 ( 84) TGGCCACACCCA 1 ++chr10:57527584-57527684 ( 33) TGGCCACACCCA 1 ++chr6:34857295-34857395 ( 17) CCACCACACCCA 1 ++chr17:45884715-45884815 ( 47) CTACCACACCCA 1 ++chr5:30289968-30290068 ( 53) CCACCACACCCA 1 ++chr2:28462971-28463071 ( 12) CCACCACACCCA 1 ++chr11:115367839-11536793 ( 80) CCACCACACCCA 1 ++chr14:79702843-79702943 ( 53) TAGCCACACCCT 1 ++chr13:113537910-11353801 ( 63) CTGCCCCACCCA 1 ++chr1:155596605-155596705 ( 14) CCGCCCCACCCA 1 ++chr8:74937709-74937809 ( 66) CAGCCACGCCCT 1 ++chr19:6300360-6300460 ( 2) CAACCCCACCCA 1 ++chr6:81915768-81915868 ( 1) CGGCCACACCCC 1 ++chr12:102194282-10219438 ( 21) CAACCCCACCCA 1 ++chr16:49776999-49777099 ( 88) CCACCACACCCT 1 ++chr15:83139084-83139184 ( 22) CCACCACACCCT 1 ++chr12:70394725-70394825 ( 54) CTGCCCCACCCA 1 ++chr3:145253491-145253591 ( 61) CCACCACACCCT 1 ++chr1:135693775-135693875 ( 4) CTGCCCCACCCT 1 ++chr13:35887680-35887780 ( 46) CTGCCCCACCCT 1 ++chr15:81700366-81700466 ( 34) AGACCACACCCA 1 ++chr8:107823857-107823957 ( 31) CTGCCCCACCCT 1 ++chr10:110604368-11060446 ( 36) ATGCCACACCCA 1 ++chr10:111261810-11126191 ( 46) AGACCACACCCT 1 ++chr5:138127196-138127296 ( 42) AGACCACACCCT 1 ++chr15:91082415-91082515 ( 45) GCACCACACCCT 1 ++chr3:84162552-84162652 ( 66) GAGCCACACCCC 1 ++chr10:40726423-40726523 ( 57) GTGCCCCACCCA 1 ++chr18:23868476-23868576 ( 66) GCACCACACCCT 1 ++chr12:27135943-27136043 ( 81) AGGCCCCACCCT 1 ++chr13:112863644-11286374 ( 74) TGACCACACCCA 1 ++chr9:113850420-113850520 ( 36) TGACCACACCCA 1 ++chr17:25039618-25039718 ( 42) TGACCACACCCT 1 ++chr10:60612189-60612289 ( 19) TAACCACACCCT 1 ++chr14:63796626-63796726 ( 49) TGACCACACCCT 1 ++chr7:149571621-149571721 ( 37) CAACCACACCCC 1 ++chr8:87494749-87494849 ( 80) CCACCCCACCCA 1 ++chr4:44084688-44084788 ( 65) CCGCCACACCCC 1 ++chr2:24832340-24832440 ( 44) CAACCACGCCCT 1 ++chr7:99891352-99891452 ( 20) CAACCACACCCC 1 ++chr8:87362362-87362462 ( 56) TGGCCCCACCCT 1 ++chr4:122963964-122964064 ( 28) ACACCACACCCA 1 ++chr4:154285744-154285844 ( 29) CAGCCCCACCCC 1 ++chr9:98389942-98390042 ( 58) CAGCCCCACCCC 1 ++chr4:129140944-129141044 ( 67) CCACCCCACCCT 1 ++chr2:103962051-103962151 ( 34) ACACCACACCCA 1 ++chr15:34829704-34829804 ( 33) CAGCCCCACCCC 1 ++chr5:115468249-115468349 ( 22) CAGGCACACCCA 1 ++chr11:61433607-61433707 ( 5) CTACCCCACCCT 1 ++chr7:139915432-139915532 ( 48) CAGCCCCGCCCT 1 ++chr5:77087236-77087336 ( 71) GTACCCCACCCA 1 ++chr7:128112656-128112756 ( 44) GCACCCCACCCA 1 ++chr19:6236069-6236169 ( 42) GAACCACACCCC 1 ++chr11:117187371-11718747 ( 46) AGGCCACACCCC 1 ++chr9:31059931-31060031 ( 18) GGACCACACCCC 1 ++chr7:128850882-128850982 ( 3) GAACCACGCCCT 1 ++chr2:167454294-167454394 ( 48) AGGCCACACCCC 1 ++chr4:111173962-111174062 ( 72) AGACCCCACCCT 1 ++chr19:44460304-44460404 ( 57) GAGGCACACCCA 1 ++chr7:148354573-148354673 ( 44) CAGTCACACCCA 1 ++chr4:44016939-44017039 ( 84) GAGGCACACCCA 1 ++chr2:72858950-72859050 ( 73) GAGGCACACCCA 1 ++chr3:60623495-60623595 ( 32) GGGGCACACCCA 1 ++chr13:114649130-11464923 ( 47) GAGGCACACCCA 1 ++chr12:112796793-11279689 ( 36) CAGTCACACCCA 1 ++chr1:183078714-183078814 ( 47) GAGGCACACCCA 1 ++chr14:55043397-55043497 ( 11) GAGGCACACCCT 1 ++chr9:70682446-70682546 ( 19) CAGACACACCCA 1 ++chr2:31940724-31940824 ( 63) GGGGCACACCCT 1 ++chr2:157978336-157978436 ( 46) TAGCCACGCCCA 1 ++chr7:111007529-111007629 ( 21) TGACCCCACCCA 1 ++chr7:20321985-20322085 ( 52) GGGACACACCCA 1 ++chr11:94858858-94858958 ( 49) CTACCACACCCC 1 ++chr11:69759802-69759902 ( 35) CCACCACACCCC 1 ++chr3:108248003-108248103 ( 29) CTACCACGCCCT 1 ++chr16:44265653-44265753 ( 3) CTGCCCCGCCCA 1 ++chr17:29067182-29067282 ( 10) GGGACACACCCA 1 ++chr4:132847120-132847220 ( 33) GAGTCACACCCT 1 ++chr10:126642276-12664237 ( 58) GAGACACACCCA 1 ++chr16:10384211-10384311 ( 14) CTGCCCCACCCC 1 ++chr9:75406568-75406668 ( 54) GGGACACACCCT 1 ++chr11:115373882-11537398 ( 76) CTGCCCCGCCCT 1 ++chr13:74873193-74873293 ( 26) GCACCACGCCCT 1 ++chr5:89197188-89197288 ( 42) GCACCACGCCCT 1 ++chr14:21299129-21299229 ( 10) CGGCTCCACCCA 1 ++chr2:93306456-93306556 ( 31) AGGCCCCGCCCT 1 ++chr3:79383669-79383769 ( 49) GGCCCACACCCA 1 ++chr11:53839887-53839987 ( 59) GACCCACACCCT 1 ++chr12:78031164-78031264 ( 20) TGACCACGCCCA 1 ++chr4:151334551-151334651 ( 9) GGGCTCCACCCA 1 ++chr17:47735005-47735105 ( 52) TCACCCCACCCA 1 ++chr9:21362670-21362770 ( 60) CTGACACACCCT 1 ++chr11:32168936-32169036 ( 31) GAGCTCCACCCA 1 ++chr15:78243389-78243489 ( 38) AAGTCACACCCA 1 ++chr11:115374473-11537457 ( 32) TAGCCCCGCCCA 1 ++chr11:44322388-44322488 ( 6) GGGCTCCACCCA 1 ++chr16:8686808-8686908 ( 50) TCACCCCACCCT 1 ++chr1:77295121-77295221 ( 18) AGGTCACACCCT 1 ++chr19:55940203-55940303 ( 60) GTGTCACACCCT 1 ++chr14:56154882-56154982 ( 40) AGGTCACACCCT 1 ++chr15:95715579-95715679 ( 80) TAGCCCCGCCCT 1 ++chr5:118929926-118930026 ( 29) CAGCCTCACCCA 1 ++chr1:9738233-9738333 ( 16) CCACCCCACCCC 1 ++chr16:49839620-49839720 ( 75) GAAACACACCCT 1 ++chr1:82633923-82634023 ( 27) AGGACACACCCT 1 ++chr4:118293096-118293196 ( 60) CGGGCACGCCCA 1 ++chr11:117642059-11764215 ( 69) ACACCACGCCCA 1 ++chr4:9588077-9588177 ( 62) CCACCCCGCCCT 1 ++chr9:108709856-108709956 ( 75) GGACCACGCCCC 1 ++chr11:68709694-68709794 ( 49) GGTCCACACCCA 1 ++chr5:143681949-143682049 ( 36) TGGTCACACCCA 1 ++chr8:24164439-24164539 ( 26) CAGGCACGCCCT 1 ++chr14:70865966-70866066 ( 48) ACGCCCCACCCC 1 ++chr11:84636992-84637092 ( 33) CTGCTCCACCCA 1 ++chr13:56459265-56459365 ( 54) CAGCTACGCCCT 1 ++chr10:40924607-40924707 ( 80) AAAGCACACCCA 1 ++chr7:148956812-148956912 ( 38) CAGCCGCACCCA 1 ++chr5:73746597-73746697 ( 72) CTGCTCCACCCA 1 ++chr16:76323701-76323801 ( 66) TGGACACACCCA 1 ++chr2:25869095-25869195 ( 40) GGGCCTCACCCT 1 ++chr9:114375901-114376001 ( 36) GGGCCTCACCCT 1 ++chr19:45865026-45865126 ( 58) TCACCACGCCCA 1 ++chr11:32150817-32150917 ( 21) CTGCTCCACCCT 1 ++chr1:75175759-75175859 ( 26) CAGACACACCCC 1 ++chr12:70860460-70860560 ( 55) GGACTCCACCCA 1 ++chr9:70774507-70774607 ( 28) GGACTCCACCCA 1 ++chr13:57679177-57679277 ( 23) GAGTCACGCCCT 1 ++chr5:65203206-65203306 ( 42) TGCCCACACCCA 1 ++chr11:121295412-12129551 ( 84) GGACTCCACCCT 1 ++chr4:118863135-118863235 ( 50) ACGTCACACCCT 1 ++chr13:73612724-73612824 ( 47) TAAGCACACCCA 1 ++chr1:36976472-36976572 ( 38) AAGTCCCACCCT 1 ++chr6:135115627-135115727 ( 37) AAGACCCACCCA 1 ++chr4:41334758-41334858 ( 8) CCGGCACGCCCT 1 ++chr17:24289204-24289304 ( 68) AATCCACACCCA 1 ++chr9:66763905-66764005 ( 27) GCACCACGCCCC 1 ++chr6:34428673-34428773 ( 45) TTGCTACACCCT 1 ++chr13:100518007-10051810 ( 80) CAGCTCCGCCCA 1 ++chr5:143814328-143814428 ( 10) CTAACCCACCCA 1 ++chr14:55690870-55690970 ( 43) CAGCCACACACT 1 ++chr4:117504523-117504623 ( 24) GGACCGCACCCA 1 ++chr2:164599350-164599450 ( 77) GGACTACGCCCT 1 ++chr17:48438406-48438506 ( 54) AGACTCCACCCA 1 ++chr16:32508974-32509074 ( 78) TTACCCCGCCCA 1 ++chr11:104842982-10484308 ( 83) TGTCCACACCCT 1 ++chr6:57653288-57653388 ( 71) AAGTCACGCCCT 1 ++chr12:112505814-11250591 ( 57) AGGTCACGCCCT 1 ++chr3:88305499-88305599 ( 33) AGGCCACTCCCA 1 ++chr2:152650540-152650640 ( 31) CTACTACGCCCA 1 ++chr11:50038237-50038337 ( 78) GGGCCCCTCCCA 1 ++chrX:146984103-146984203 ( 30) CTCCCACGCCCT 1 ++chr11:87539593-87539693 ( 20) CAGCCACAACCA 1 ++chr11:86476947-86477047 ( 43) CAGCCACACTCT 1 ++chr17:47754579-47754679 ( 34) TGGTCACACCCX 1 ++chr11:69793284-69793384 ( 50) AGACTACGCCCT 1 ++chr7:28320390-28320490 ( 10) TTGCCCCGCCCC 1 ++chr15:73181611-73181711 ( 73) CTACCACTCCCT 1 ++chr7:135432388-135432488 ( 60) GGGCGACACCCT 1 ++chr17:26651346-26651446 ( 82) GTGCCACACCTA 1 ++chr10:59336304-59336404 ( 16) GGACTCCGCCCT 1 ++chr11:105013713-10501381 ( 73) CAACACCACCCA 1 ++chr6:83115545-83115645 ( 55) CTGCCTCGCCCT 1 ++chr8:83025149-83025249 ( 23) TGGGCCCGCCCT 1 ++chr4:128287321-128287421 ( 43) ACCCCACGCCCT 1 ++chr1:92185725-92185825 ( 40) CGTCTACACCCT 1 ++chr1:135696218-135696318 ( 5) CCGCCCCACGCA 1 ++chr3:60589029-60589129 ( 19) TCAGCACGCCCA 1 ++chr9:42909937-42910037 ( 77) GAACAACGCCCA 1 ++chr10:128184603-12818470 ( 60) GCGCCCCACACT 1 ++chr4:118862380-118862480 ( 57) AAGCAACGCCCT 1 ++chr15:56455063-56455163 ( 46) GGCCCCCGCCCC 1 ++chr1:88057040-88057140 ( 37) GGCACACGCCCT 1 ++chr17:87913077-87913177 ( 20) CAAGCACACGCA 1 ++chr17:25716183-25716283 ( 82) GGACCCCGCCTT 1 ++chr14:63729028-63729128 ( 59) XXXXCGCACCCT 1 ++chr11:51213800-51213900 ( 16) CCGCCACAXXXX 1 ++// ++ ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 1 position-specific scoring matrix ++-------------------------------------------------------------------------------- ++log-odds matrix: alength= 4 w= 12 n= 53400 bayes= 9.84999 E= 3.0e-225 ++ -67 68 40 -103 ++ 46 -64 44 -67 ++ 44 -292 130 -376 ++ -212 172 -167 -201 ++ -426 188 -578 -160 ++ 142 22 -419 -385 ++ -1446 203 -1446 -1446 ++ 164 -1446 -35 -426 ++ -552 202 -780 -780 ++ -467 200 -461 -552 ++ -780 202 -780 -467 ++ 86 -129 -681 76 ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 1 position-specific probability matrix ++-------------------------------------------------------------------------------- ++letter-probability matrix: alength= 4 w= 12 nsites= 225 E= 3.0e-225 ++ 0.161138 0.392196 0.321084 0.125582 ++ 0.352249 0.156640 0.329973 0.161138 ++ 0.347804 0.032196 0.601084 0.018916 ++ 0.058916 0.801084 0.076640 0.063360 ++ 0.013333 0.897778 0.004444 0.084444 ++ 0.684444 0.284444 0.013333 0.017778 ++ 0.000000 1.000000 0.000000 0.000000 ++ 0.795556 0.000000 0.191111 0.013333 ++ 0.005582 0.992196 0.001084 0.001138 ++ 0.010027 0.974418 0.009973 0.005582 ++ 0.001138 0.987751 0.001084 0.010027 ++ 0.464498 0.099947 0.002169 0.433387 ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 1 regular expression ++-------------------------------------------------------------------------------- ++[CG][AG][GA]CC[AC]CACCC[AT] ++-------------------------------------------------------------------------------- ++ ++ ++ ++ ++Time 142.32 secs. ++ ++******************************************************************************** ++ ++ ++******************************************************************************** ++MOTIF 2 MEME width = 8 sites = 176 llr = 1388 E-value = 7.4e-025 ++******************************************************************************** ++-------------------------------------------------------------------------------- ++ Motif 2 Description ++-------------------------------------------------------------------------------- ++Simplified A 26:a:aa3 ++pos.-specific C 4::::::2 ++probability G 3:a::::5 ++matrix T 14::a::: ++ ++ bits 2.0 ***** ++ 1.8 ***** ++ 1.6 ***** ++ 1.4 ***** ++Relative 1.2 ***** ++Entropy 1.0 ***** ++(11.4 bits) 0.8 ****** ++ 0.6 ****** ++ 0.4 ******* ++ 0.2 ******** ++ 0.0 -------- ++ ++Multilevel CAGATAAG ++consensus GT A ++sequence A ++ ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 2 sites sorted by position p-value ++-------------------------------------------------------------------------------- ++Sequence name Strand Start P-value Site ++------------- ------ ----- --------- -------- ++chr11:94858858-94858958 - 28 1.60e-05 ATTGTGCATA CAGATAAG GGTGTGTGGC ++chr2:37405046-37405146 + 49 1.60e-05 TAGTATTTCA CAGATAAG TAAGTTATCA ++chr1:77295121-77295221 - 41 1.60e-05 TGTTCCTCAA CAGATAAG GCTGAACAGA ++chr19:55940203-55940303 + 86 1.60e-05 TAACTGCCTG CAGATAAG AGGGGCT ++chr7:111007529-111007629 + 46 1.60e-05 ACTGTGGTGA CAGATAAG AGCCAGAGCT ++chr5:65203206-65203306 - 58 1.60e-05 GACATAGCTT CAGATAAG ATTCTGCCCA ++chr9:75406568-75406668 + 6 1.60e-05 CAGAG CAGATAAG CAAAATGGCC ++chr9:114375901-114376001 + 16 1.60e-05 TCCATGAACA CAGATAAG TCACCCCTTC ++chr7:104332487-104332587 - 15 1.60e-05 GGAGTGGCAG CAGATAAG CCAAAGACAA ++chr19:24354046-24354146 - 12 1.60e-05 XXXXXXXXTT CAGATAAG TCTCGGTTCT ++chr3:60623495-60623595 + 59 1.60e-05 CACGTGCTGG CAGATAAG AGCTGTTTTT ++chr11:90524331-90524431 + 57 3.19e-05 TAGAGGCAAC GAGATAAG ACTTTGCACC ++chr9:44096485-44096585 - 32 3.19e-05 TGAACTGCAA GAGATAAG CAATGAGGGG ++chr17:24339801-24339901 - 90 3.19e-05 CAT GAGATAAG CAGCTGCCAG ++chr13:76003198-76003298 - 50 3.19e-05 CTGCTAAGGA GAGATAAG ATGAGTCAAC ++chr16:10384211-10384311 + 52 3.19e-05 CCTGGAACCA GAGATAAG AAGCTTGGCC ++chr5:105994746-105994846 + 80 3.19e-05 TCTGTTGAGG GAGATAAG TCTTCAGGAT ++chr14:61272712-61272812 + 49 3.19e-05 CTGTCTCCTG GAGATAAG TCCAAGCCTC ++chr10:60612189-60612289 - 42 3.19e-05 ACACTAGGTG GAGATAAG AATGCCATTG ++chr10:127624309-12762440 - 92 3.19e-05 A GAGATAAG AGTXXXXXXX ++chr2:103324307-103324407 - 1 3.19e-05 ATATTCCTGT GAGATAAG ++chr9:121335572-121335672 - 12 3.19e-05 GTGACACTGT GAGATAAG GACTTAGTAG ++chr19:53259936-53260036 - 39 3.19e-05 GTGGTGGCAG GAGATAAG AAGATCGAAT ++chr8:83025149-83025249 + 91 3.19e-05 GTTGGGTGAT GAGATAAG GG ++chr4:9588077-9588177 - 19 3.19e-05 TTTCACAAAG GAGATAAG GACGTATTCT ++chr4:8631654-8631754 + 77 3.19e-05 TAGGGAAGAA GAGATAAG TTATTGTGGC ++chr4:111173962-111174062 - 49 4.79e-05 GCATGCTCCT CTGATAAG CATGGTGTCT ++chr14:69922787-69922887 + 78 4.79e-05 CAGGTGCATC CTGATAAG CAGGGAGGGA ++chr5:27985059-27985159 - 36 4.79e-05 CCTGTGACCT CTGATAAG AAATGTCTGA ++chr5:38900629-38900729 - 87 4.79e-05 TGTGGA CTGATAAG TGTATGAGAT ++chr7:56247541-56247641 - 26 4.79e-05 TGCTAGGGAA CTGATAAG GTGCCTCACA ++chr15:91082415-91082515 - 86 4.79e-05 ATAAAGC CTGATAAG AGACTATGGC ++chr7:19832206-19832306 - 18 4.79e-05 TGGGGCTTTT CTGATAAG AGGGCAGAAC ++chr11:96809236-96809336 - 25 4.79e-05 AGGGAGGACA CTGATAAG GTCTGGCCTT ++chr18:61379740-61379840 - 36 4.79e-05 TCACCCTGGT CTGATAAG GGCCAAGAGG ++chr11:115367839-11536793 + 56 4.79e-05 CACTGAAGCA CTGATAAG GCAGGCACGT ++chr17:87913077-87913177 + 69 4.79e-05 TCATCAAAGC CTGATAAG GAAAGCCGTC ++chr12:41846175-41846275 + 86 4.79e-05 GTGCCTGTGG CTGATAAG AAAGAGA ++chr5:140280104-140280204 - 32 4.79e-05 GCCCTCTGGG CTGATAAG ATAGGCTCTA ++chr13:96735032-96735132 + 57 4.79e-05 ATGTGTGTCG CTGATAAG AAAAAGGAAA ++chr4:46419778-46419878 + 75 6.39e-05 TGTCTCTGAT GTGATAAG TGCCAAGAGC ++chr16:8686808-8686908 - 72 6.39e-05 GTCCACTCCA GTGATAAG GCTGTCACAG ++chr11:68709694-68709794 + 78 6.39e-05 CTGTTGATAA GTGATAAG CAGACTACAA ++chr5:144579743-144579843 + 71 6.39e-05 CTGTGACGCC GTGATAAG AGTGTCTGCA ++chr7:106742880-106742980 + 11 6.39e-05 AGGGCTGGCT GTGATAAG AGTCATCTTC ++chr5:97380647-97380747 + 24 6.39e-05 GCGGGAGGGG GTGATAAG GCACACACTT ++chr13:94151185-94151285 - 38 6.39e-05 TGCAGGGATG GTGATAAG AAATGGGTAG ++chr14:71023665-71023765 + 57 6.39e-05 CAGGATATGG GTGATAAG ACTTGCCCAC ++chr7:139930394-139930494 - 73 6.39e-05 TCTGTGTGGT GTGATAAG GTATCTTTGT ++chr3:104477494-104477594 - 69 6.39e-05 CTGCACAAGT GTGATAAG AGGTCAATAT ++chr8:3522195-3522295 - 93 6.39e-05 . GTGATAAG CAATAAGAAC ++chr7:134369101-134369201 - 24 6.39e-05 TCTGCTCTGT GTGATAAG AAATGAAGGG ++chrX:146984103-146984203 + 75 6.39e-05 GACTCTAATG GTGATAAG CTCTAGGGGC ++chr3:100351339-100351439 - 45 6.39e-05 GCCTGAGGCA GTGATAAG GACCCGTGGT ++chr7:87847380-87847480 + 78 8.06e-05 CTGTTACCAG AAGATAAG CTCTGGTGTG ++chr6:38874025-38874125 + 87 8.06e-05 GGACATATTT AAGATAAG CCACTG ++chr11:97307229-97307329 - 75 8.06e-05 CAGGCGGACA AAGATAAG CAGCCTGACA ++chr8:126512499-126512599 - 46 8.06e-05 CTAAGGGAGA AAGATAAG AAAAGCTGGC ++chr5:28369134-28369234 - 31 8.06e-05 GGTACAGAGC AAGATAAG GCTTTAGTTG ++chr9:98389942-98390042 - 50 8.06e-05 GGTGGGGCTG AAGATAAG AAGGGCTATT ++chr15:34829704-34829804 + 45 8.06e-05 GGTGGGGCTG AAGATAAG ACCAAGATGG ++chr7:28266695-28266795 + 92 8.06e-05 NNNNNNNNNN AAGATAAG T ++chr12:70884546-70884646 - 38 8.06e-05 CTGGAGATCA AAGATAAG ACAATGGGTG ++chr4:111203043-111203143 + 93 8.06e-05 NNNNNNNNNN NAGATAAG ++chr16:91352913-91353013 - 37 8.06e-05 ATGGCTGGCA AAGATAAG GCTGTTTTCA ++chr9:42909937-42910037 - 32 8.06e-05 ATGGCTGAAC AAGATAAG AAGGGTTTTA ++chr5:121049617-121049717 + 24 8.06e-05 ACGAAGCCAA AAGATAAG CTTGCCAGGG ++chr11:87563494-87563594 - 87 8.06e-05 AAATAC AAGATAAG GTGAGGGAAG ++chr11:87539593-87539693 - 39 8.06e-05 TGAGAGGAGA AAGATAAG AGAGAAGCAG ++chr17:26651346-26651446 - 61 8.06e-05 TGTGTCCCAG AAGATAAG GACAAAGGTC ++chr7:28233710-28233810 + 33 9.74e-05 GTGAAAGTTC CAGATAAA GAGCCACACC ++chr8:87494749-87494849 - 37 9.74e-05 AGAATGGCTC CAGATAAA GCATCCTCTT ++chr13:74873193-74873293 + 61 9.74e-05 CTCAGTTCTA CAGATAAA AATAAACTGC ++chr15:56455063-56455163 - 22 9.74e-05 GTTGCAGTCA CAGATAAA ATAAATAAGC ++chr8:122895508-122895608 + 80 9.74e-05 CTGCTGTCTC CAGATAAA CCCTGAGGCC ++chr5:45951564-45951664 - 26 9.74e-05 AGTAAATGTC CAGATAAA CCTTTTTCCT ++chr10:57527584-57527684 + 68 9.74e-05 ATGGTCCTTT CAGATAAA AACGGTAAGG ++chr6:86027771-86027871 - 7 9.74e-05 CTGCCATGTT CAGATAAA GGCAGG ++chr12:27135943-27136043 + 41 9.74e-05 TGAGAAAACC CAGATAAA GAGGAACTGG ++chr1:183078714-183078814 - 28 9.74e-05 AAAAGCTCCA CAGATAAA GAGTGCTCAA ++chr11:84636992-84637092 + 69 1.14e-04 GAGGCCAGCA GAGATAAA GTTTTCATCA ++chr17:47735005-47735105 - 23 1.14e-04 ACTGGAGCCA GAGATAAA AGGCCAGAGA ++chr6:124614275-124614375 + 16 1.14e-04 TAGGAAGTTT GAGATAAA TTNNNNNNNN ++chr13:112837037-11283713 + 25 1.14e-04 TTGTAGGCAG GAGATAAA GGGACAACGG ++chr15:66969076-66969176 - 46 1.14e-04 CCAGAACTTA GAGATAAA GACCTGGGAG ++chr13:100518007-10051810 + 44 1.14e-04 AAAGAGGTGT GAGATAAA CAGGAGCGGA ++chr17:28946039-28946139 - 40 1.14e-04 GTAGCTAATC GAGATAAA ACCTAAGAAA ++chr11:32145484-32145584 + 72 1.14e-04 TCTGCAACAG GAGATAAA TGCTCCTGCC ++chr17:84135991-84136091 - 42 1.14e-04 GTGGTGCTCA GAGATAAA GGGAGAAGGA ++chr12:78031164-78031264 - 10 1.14e-04 CGTGGTCAGG GAGATAAA GATATCTGG ++chr8:74937709-74937809 + 92 1.31e-04 TGCAGAATGA ATGATAAG G ++chr13:35887680-35887780 - 17 1.31e-04 GCTGTGAACG ATGATAAG CACTTTGGGA ++chr9:108243079-108243179 - 74 1.31e-04 CTGGGAGGTT ATGATAAG AAACAGCTCC ++chr9:21940048-21940148 - 31 1.31e-04 CTAAGGCAAG ATGATAAG CCTGGACACT ++chr15:96173311-96173411 - 16 1.31e-04 TAAACTCACT ATGATAAG ACTTATCGAC ++chr11:44322388-44322488 + 62 1.31e-04 GGGAGAGACC ATGATAAG TTGCTTGTTA ++chr15:58828419-58828519 - 27 1.64e-04 TGTGACTGAG CTGATAAA ATGGCTGTGC ++chr6:34857295-34857395 - 31 1.64e-04 TGGTGAGGGA CTGATAAA TTTGGGTGTG ++chr7:151917813-151917913 + 56 1.64e-04 CAGATAGTCA CAGATAAC TTTCTTTTCC ++chr15:82060182-82060282 - 24 1.64e-04 GAACTGGACA CTGATAAA CAGGGTGGGG ++chr5:104483855-104483955 - 13 1.64e-04 TATTTTACTG CTGATAAA ACTGAGTGAC ++chr17:29575283-29575383 - 91 1.64e-04 TA CTGATAAA AGCAATCGTC ++chr4:129974284-129974384 - 57 1.64e-04 CCCTGTTTGT CTGATAAA GTGAGAGGGA ++chr16:8655670-8655770 - 15 1.64e-04 XXXXXXXTCT CTGATAAA CTCTCTCCCT ++chr2:25869095-25869195 - 8 1.64e-04 TAGCAGAGCG CAGATAAC AGTTCTA ++chr2:120881647-120881747 + 5 1.64e-04 CTGA CTGATAAA TCGAGCCATG ++chr5:34915766-34915866 - 13 1.64e-04 TGTGTGTGCT CTGATAAA GCTCCACAGA ++chr12:35474089-35474189 + 81 1.64e-04 ATGTTTATAA CTGATAAA AACCACTTGT ++chr7:25940385-25940485 + 46 1.64e-04 GGATCCTAGC CTGATAAA GGTGAGCTTT ++chr11:117642059-11764215 - 27 1.64e-04 TGCTCAGCCT CTGATAAA GAACAGTTAA ++chr11:32150817-32150917 + 67 1.64e-04 CTTGAACGAG CAGATAAC TAAGCCAAGC ++chr4:118862380-118862480 + 81 1.64e-04 CTGCCCACCC CTGATAAA GCGAGCGTTC ++chr5:37127174-37127274 - 22 1.64e-04 TCTGCTACTA CAGATAAC GGAGTCTCTG ++chr7:20321985-20322085 - 31 1.96e-04 ATGGGGCCAA GAGATAAC TCAGTGGAAG ++chr2:84652032-84652132 - 36 1.96e-04 XXXCTTGTTA GTGATAAA GAGGAGTAAC ++chr11:50038237-50038337 + 53 1.96e-04 CTGCTAGCTA GAGATAAC CTCAGCTCGG ++chr19:11699766-11699866 + 52 1.96e-04 CTGGACAGAA GAGATAAC AGAGCTAGCA ++chr16:92715757-92715857 + 79 1.96e-04 GCTCGCCCTG GAGATAAC AGCTTCACTG ++chr3:96232775-96232875 - 39 2.14e-04 AGGAACGTCA AAGATAAA CTCTCATCCC ++chr5:143814328-143814428 + 86 2.14e-04 GGGGAGACCG AAGATAAA CCCAGCC ++chr7:106135437-106135537 + 11 2.14e-04 ATAAGCATCA AAGATAAA GCAAAGCCTC ++chr4:122963964-122964064 + 11 2.14e-04 TCTTGAAAAC AAGATAAA TGTTGTACCT ++chr6:41654152-41654252 - 22 2.14e-04 CTGAGAAACT AAGATAAA AGAGGAGGTG ++chr3:19550494-19550594 + 31 2.14e-04 CTGCCCAGGG AAGATAAA GGGCGTTGGC ++chr10:112467641-11246774 - 1 2.14e-04 AGTTTCCCCC AAGATAAA ++chr13:114649130-11464923 + 1 2.14e-04 . AAGATAAA GACCCTTTCT ++chr11:115372412-11537251 + 27 2.14e-04 TCTGTCCCTG AAGATAAA CACATGTGCT ++chr3:145253491-145253591 + 50 2.14e-04 TATTTGGGGA AAGATAAA CTGCCACCAC ++chr11:80597917-80598017 - 67 2.47e-04 TCAGAAACCA GAGATAAX XXXXXXXXXX ++chr8:107486056-107486156 + 29 2.47e-04 TGCCTGTGCC CTGATAAC AGTGAGATAG ++chr10:20961509-20961609 + 57 2.47e-04 GGGAACCGCC CTGATAAC ATTTTGTGGT ++chr11:101176807-10117690 + 42 2.47e-04 TGTTGTGTCT TAGATAAG CCACGAGGCT ++chr2:132521380-132521480 + 53 2.47e-04 CCTGCCCTGG TAGATAAG GTGAAGACTC ++chr19:44460304-44460404 + 81 2.47e-04 AAAGTCCCCA TAGATAAG ATGCTAAAGA ++chr1:82633923-82634023 + 66 2.47e-04 TGGAGTAGTT CTGATAAC CCAGGCACAG ++chr11:32193433-32193533 - 12 2.47e-04 ACTCTTCCTA CTGATAAC ACAAAAGGGT ++chr7:148956812-148956912 + 58 2.47e-04 TGCGTTGTGG TAGATAAG CTGCTTAGCT ++chr4:41334758-41334858 + 70 2.47e-04 CAGTCTGGGC CTGATAAC TGGGGAGGGA ++chr5:139858101-139858201 - 69 2.47e-04 ATCTGGGCTC CTGATAAC CTCAGCTTTT ++chr9:31059931-31060031 + 6 2.47e-04 TGCTC CTGATAAC CAGAGGGGTG ++chr7:135432388-135432488 + 83 2.47e-04 CTGCAGCTCT CTGATAAC AGCAGGGAAG ++chr9:65063484-65063584 + 74 2.47e-04 CTGTTCTGCC TAGATAAG AAGTTGTCCC ++chr3:79383669-79383769 + 20 2.47e-04 ACAAGAACTT TAGATAAG TGAAATCTAC ++chr13:59915598-59915698 + 14 2.47e-04 AGGGACGGAA TAGATAAG GACACTAAGA ++chr10:40726423-40726523 + 90 2.47e-04 GTCTGTGAGT CTGATAAC GGG ++chr14:32981987-32982087 - 46 2.47e-04 CTGTTTGGCC TAGATAAG CAACTCTGGG ++chr3:116562120-116562220 + 85 2.47e-04 TTTGTGGCAA CTGATAAC AGGGTGTA ++chr3:102933243-102933343 - 65 2.47e-04 XXAGGAGCTC CTGATAAC ATAGTACCAC ++chr1:136638481-136638581 - 51 2.47e-04 GGTGGATGAC CTGATAAC ATAGGTGTGG ++chr13:73612724-73612824 - 75 2.47e-04 TCTTGAGTTC TAGATAAG CTCAGAAGAA ++chr15:83253023-83253123 - 10 2.63e-04 CCTGTACACA GTGATAAC CCTGGGGCC ++chr9:107206717-107206817 + 13 2.63e-04 GGAGGCAAGG GTGATAAC TTTGGGTGTG ++chr4:151334551-151334651 - 30 2.63e-04 CTTGAGGCTG GTGATAAC TAGCCTATGG ++chr16:44265653-44265753 + 32 2.63e-04 TGTCTGGTAG GTGATAAC AAGCTGCATC ++chr4:43977110-43977210 + 47 2.63e-04 GTGGTCGCCA GTGATAAC TTGCCTCCTA ++chr2:152650540-152650640 + 61 2.97e-04 GCACTGGGCT AAGATAAC CAGTGAGCAA ++chr14:70865966-70866066 - 29 2.97e-04 GCTGCCAGTA ATGATAAA GACAGTAACG ++chr19:24348712-24348812 + 58 2.97e-04 CCCAGGTATG AAGATAAC AGGAGAGAAG ++chr9:21362670-21362770 - 19 2.97e-04 CTGTACATAG AAGATAAC CAGGCATAAG ++chr19:5845898-5845998 + 35 2.97e-04 GTTGCAAGCT ATGATAAA GCAAGACTTT ++chr4:128532892-128532992 + 50 3.14e-04 TCCTTTAGAA TTGATAAG ATTCTGAAAG ++chr11:69793284-69793384 + 32 3.14e-04 TGCAGATTTC TTGATAAG AGCCTTCAGG ++chr8:24254795-24254895 - 44 3.14e-04 ATTTTTTAAA TTGATAAG TAACACATAT ++chr10:111261810-11126191 + 81 3.31e-04 ACACTGAGCC ATGATAAC AGCAGTTCTG ++chr11:94195589-94195689 - 48 3.48e-04 TGCAGGGGTG TAGATAAA AGGGAAAGCT ++chr2:31940724-31940824 + 16 3.48e-04 CATTAGCTTC TAGATAAA GGATAGTTTG ++chr2:24832340-24832440 + 16 3.48e-04 TGCCTTTCCT TAGATAAA GTAAACTCCG ++chr9:57618593-57618693 + 83 3.82e-04 TCTGTAGTAA TAGATAAC AGTGGAGCAG ++chr15:81700366-81700466 + 75 3.82e-04 AGAAATTACC TAGATAAC TAGCTGAACA ++chr6:132413557-132413657 + 86 3.82e-04 AAAGAAATAG TAGATAAC ACAAGTG ++chr13:104969484-10496958 - 81 4.16e-04 CTCTTGGCAA CAGATAAT CTTTCCGAGT ++chr6:38866492-38866592 - 44 4.48e-04 CTGCGGGACA GAGATAAT AACCAAGGAC ++chr18:57137387-57137487 - 8 4.48e-04 TCTGGAAGCA CCGATAAG GCATCAT ++chr19:5726888-5726988 - 78 4.63e-04 GGATGTGTGA GCGATAAG GAGTCTAATC ++chr5:144386182-144386282 + 53 4.63e-04 TTTGCCGTGT GCGATAAG GAAAGGATGG ++chr11:74652046-74652146 + 26 4.97e-04 GCTTATTTCC GTGATAAT TTTACTGACT ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 2 block diagrams ++-------------------------------------------------------------------------------- ++SEQUENCE NAME POSITION P-VALUE MOTIF DIAGRAM ++------------- ---------------- ------------- ++chr11:94858858-94858958 1.6e-05 27_[-2]_65 ++chr2:37405046-37405146 1.6e-05 48_[+2]_44 ++chr1:77295121-77295221 1.6e-05 40_[-2]_52 ++chr19:55940203-55940303 1.6e-05 85_[+2]_7 ++chr7:111007529-111007629 1.6e-05 45_[+2]_47 ++chr5:65203206-65203306 1.6e-05 57_[-2]_35 ++chr9:75406568-75406668 1.6e-05 5_[+2]_87 ++chr9:114375901-114376001 1.6e-05 15_[+2]_77 ++chr7:104332487-104332587 1.6e-05 14_[-2]_78 ++chr19:24354046-24354146 1.6e-05 11_[-2]_81 ++chr3:60623495-60623595 1.6e-05 58_[+2]_34 ++chr11:90524331-90524431 3.2e-05 56_[+2]_36 ++chr9:44096485-44096585 3.2e-05 31_[-2]_61 ++chr17:24339801-24339901 3.2e-05 89_[-2]_3 ++chr13:76003198-76003298 3.2e-05 49_[-2]_43 ++chr16:10384211-10384311 3.2e-05 51_[+2]_41 ++chr5:105994746-105994846 3.2e-05 79_[+2]_13 ++chr14:61272712-61272812 3.2e-05 48_[+2]_44 ++chr10:60612189-60612289 3.2e-05 41_[-2]_51 ++chr10:127624309-12762440 3.2e-05 91_[-2]_1 ++chr2:103324307-103324407 3.2e-05 [-2]_92 ++chr9:121335572-121335672 3.2e-05 11_[-2]_81 ++chr19:53259936-53260036 3.2e-05 38_[-2]_54 ++chr8:83025149-83025249 3.2e-05 90_[+2]_2 ++chr4:9588077-9588177 3.2e-05 18_[-2]_74 ++chr4:8631654-8631754 3.2e-05 76_[+2]_16 ++chr4:111173962-111174062 4.8e-05 48_[-2]_44 ++chr14:69922787-69922887 4.8e-05 77_[+2]_15 ++chr5:27985059-27985159 4.8e-05 35_[-2]_57 ++chr5:38900629-38900729 4.8e-05 86_[-2]_6 ++chr7:56247541-56247641 4.8e-05 25_[-2]_67 ++chr15:91082415-91082515 4.8e-05 85_[-2]_7 ++chr7:19832206-19832306 4.8e-05 17_[-2]_75 ++chr11:96809236-96809336 4.8e-05 24_[-2]_68 ++chr18:61379740-61379840 4.8e-05 35_[-2]_57 ++chr11:115367839-11536793 4.8e-05 55_[+2]_37 ++chr17:87913077-87913177 4.8e-05 68_[+2]_24 ++chr12:41846175-41846275 4.8e-05 85_[+2]_7 ++chr5:140280104-140280204 4.8e-05 31_[-2]_61 ++chr13:96735032-96735132 4.8e-05 56_[+2]_36 ++chr4:46419778-46419878 6.4e-05 74_[+2]_18 ++chr16:8686808-8686908 6.4e-05 71_[-2]_21 ++chr11:68709694-68709794 6.4e-05 77_[+2]_15 ++chr5:144579743-144579843 6.4e-05 70_[+2]_22 ++chr7:106742880-106742980 6.4e-05 10_[+2]_82 ++chr5:97380647-97380747 6.4e-05 23_[+2]_69 ++chr13:94151185-94151285 6.4e-05 37_[-2]_55 ++chr14:71023665-71023765 6.4e-05 56_[+2]_36 ++chr7:139930394-139930494 6.4e-05 72_[-2]_20 ++chr3:104477494-104477594 6.4e-05 68_[-2]_24 ++chr8:3522195-3522295 6.4e-05 92_[-2] ++chr7:134369101-134369201 6.4e-05 23_[-2]_69 ++chrX:146984103-146984203 6.4e-05 74_[+2]_18 ++chr3:100351339-100351439 6.4e-05 44_[-2]_48 ++chr7:87847380-87847480 8.1e-05 77_[+2]_15 ++chr6:38874025-38874125 8.1e-05 86_[+2]_6 ++chr11:97307229-97307329 8.1e-05 74_[-2]_18 ++chr8:126512499-126512599 8.1e-05 45_[-2]_47 ++chr5:28369134-28369234 8.1e-05 30_[-2]_62 ++chr9:98389942-98390042 8.1e-05 49_[-2]_43 ++chr15:34829704-34829804 8.1e-05 44_[+2]_48 ++chr7:28266695-28266795 8.1e-05 91_[+2]_1 ++chr12:70884546-70884646 8.1e-05 37_[-2]_55 ++chr4:111203043-111203143 8.1e-05 92_[+2] ++chr16:91352913-91353013 8.1e-05 36_[-2]_56 ++chr9:42909937-42910037 8.1e-05 31_[-2]_61 ++chr5:121049617-121049717 8.1e-05 23_[+2]_69 ++chr11:87563494-87563594 8.1e-05 86_[-2]_6 ++chr11:87539593-87539693 8.1e-05 38_[-2]_54 ++chr17:26651346-26651446 8.1e-05 60_[-2]_32 ++chr7:28233710-28233810 9.7e-05 32_[+2]_60 ++chr8:87494749-87494849 9.7e-05 36_[-2]_56 ++chr13:74873193-74873293 9.7e-05 60_[+2]_32 ++chr15:56455063-56455163 9.7e-05 21_[-2]_71 ++chr8:122895508-122895608 9.7e-05 79_[+2]_13 ++chr5:45951564-45951664 9.7e-05 25_[-2]_67 ++chr10:57527584-57527684 9.7e-05 67_[+2]_25 ++chr6:86027771-86027871 9.7e-05 6_[-2]_86 ++chr12:27135943-27136043 9.7e-05 40_[+2]_52 ++chr1:183078714-183078814 9.7e-05 27_[-2]_65 ++chr11:84636992-84637092 0.00011 68_[+2]_24 ++chr17:47735005-47735105 0.00011 22_[-2]_70 ++chr6:124614275-124614375 0.00011 15_[+2]_77 ++chr13:112837037-11283713 0.00011 24_[+2]_68 ++chr15:66969076-66969176 0.00011 45_[-2]_47 ++chr13:100518007-10051810 0.00011 43_[+2]_49 ++chr17:28946039-28946139 0.00011 39_[-2]_53 ++chr11:32145484-32145584 0.00011 71_[+2]_21 ++chr17:84135991-84136091 0.00011 41_[-2]_51 ++chr12:78031164-78031264 0.00011 9_[-2]_83 ++chr8:74937709-74937809 0.00013 91_[+2]_1 ++chr13:35887680-35887780 0.00013 16_[-2]_76 ++chr9:108243079-108243179 0.00013 73_[-2]_19 ++chr9:21940048-21940148 0.00013 30_[-2]_62 ++chr15:96173311-96173411 0.00013 15_[-2]_77 ++chr11:44322388-44322488 0.00013 61_[+2]_31 ++chr15:58828419-58828519 0.00016 26_[-2]_66 ++chr6:34857295-34857395 0.00016 30_[-2]_62 ++chr7:151917813-151917913 0.00016 55_[+2]_37 ++chr15:82060182-82060282 0.00016 23_[-2]_69 ++chr5:104483855-104483955 0.00016 12_[-2]_80 ++chr17:29575283-29575383 0.00016 90_[-2]_2 ++chr4:129974284-129974384 0.00016 56_[-2]_36 ++chr16:8655670-8655770 0.00016 14_[-2]_78 ++chr2:25869095-25869195 0.00016 7_[-2]_85 ++chr2:120881647-120881747 0.00016 4_[+2]_88 ++chr5:34915766-34915866 0.00016 12_[-2]_80 ++chr12:35474089-35474189 0.00016 80_[+2]_12 ++chr7:25940385-25940485 0.00016 45_[+2]_47 ++chr11:117642059-11764215 0.00016 26_[-2]_66 ++chr11:32150817-32150917 0.00016 66_[+2]_26 ++chr4:118862380-118862480 0.00016 80_[+2]_12 ++chr5:37127174-37127274 0.00016 21_[-2]_71 ++chr7:20321985-20322085 0.0002 30_[-2]_62 ++chr2:84652032-84652132 0.0002 35_[-2]_57 ++chr11:50038237-50038337 0.0002 52_[+2]_40 ++chr19:11699766-11699866 0.0002 51_[+2]_41 ++chr16:92715757-92715857 0.0002 78_[+2]_14 ++chr3:96232775-96232875 0.00021 38_[-2]_54 ++chr5:143814328-143814428 0.00021 85_[+2]_7 ++chr7:106135437-106135537 0.00021 10_[+2]_82 ++chr4:122963964-122964064 0.00021 10_[+2]_82 ++chr6:41654152-41654252 0.00021 21_[-2]_71 ++chr3:19550494-19550594 0.00021 30_[+2]_62 ++chr10:112467641-11246774 0.00021 [-2]_92 ++chr13:114649130-11464923 0.00021 [+2]_92 ++chr11:115372412-11537251 0.00021 26_[+2]_66 ++chr3:145253491-145253591 0.00021 49_[+2]_43 ++chr11:80597917-80598017 0.00025 66_[-2]_26 ++chr8:107486056-107486156 0.00025 28_[+2]_64 ++chr10:20961509-20961609 0.00025 56_[+2]_36 ++chr11:101176807-10117690 0.00025 41_[+2]_51 ++chr2:132521380-132521480 0.00025 52_[+2]_40 ++chr19:44460304-44460404 0.00025 80_[+2]_12 ++chr1:82633923-82634023 0.00025 65_[+2]_27 ++chr11:32193433-32193533 0.00025 11_[-2]_81 ++chr7:148956812-148956912 0.00025 57_[+2]_35 ++chr4:41334758-41334858 0.00025 69_[+2]_23 ++chr5:139858101-139858201 0.00025 68_[-2]_24 ++chr9:31059931-31060031 0.00025 5_[+2]_87 ++chr7:135432388-135432488 0.00025 82_[+2]_10 ++chr9:65063484-65063584 0.00025 73_[+2]_19 ++chr3:79383669-79383769 0.00025 19_[+2]_73 ++chr13:59915598-59915698 0.00025 13_[+2]_79 ++chr10:40726423-40726523 0.00025 89_[+2]_3 ++chr14:32981987-32982087 0.00025 45_[-2]_47 ++chr3:116562120-116562220 0.00025 84_[+2]_8 ++chr3:102933243-102933343 0.00025 64_[-2]_28 ++chr1:136638481-136638581 0.00025 50_[-2]_42 ++chr13:73612724-73612824 0.00025 74_[-2]_18 ++chr15:83253023-83253123 0.00026 9_[-2]_83 ++chr9:107206717-107206817 0.00026 12_[+2]_80 ++chr4:151334551-151334651 0.00026 29_[-2]_63 ++chr16:44265653-44265753 0.00026 31_[+2]_61 ++chr4:43977110-43977210 0.00026 46_[+2]_46 ++chr2:152650540-152650640 0.0003 60_[+2]_32 ++chr14:70865966-70866066 0.0003 28_[-2]_64 ++chr19:24348712-24348812 0.0003 57_[+2]_35 ++chr9:21362670-21362770 0.0003 18_[-2]_74 ++chr19:5845898-5845998 0.0003 34_[+2]_58 ++chr4:128532892-128532992 0.00031 49_[+2]_43 ++chr11:69793284-69793384 0.00031 31_[+2]_61 ++chr8:24254795-24254895 0.00031 43_[-2]_49 ++chr10:111261810-11126191 0.00033 80_[+2]_12 ++chr11:94195589-94195689 0.00035 47_[-2]_45 ++chr2:31940724-31940824 0.00035 15_[+2]_77 ++chr2:24832340-24832440 0.00035 15_[+2]_77 ++chr9:57618593-57618693 0.00038 82_[+2]_10 ++chr15:81700366-81700466 0.00038 74_[+2]_18 ++chr6:132413557-132413657 0.00038 85_[+2]_7 ++chr13:104969484-10496958 0.00042 80_[-2]_12 ++chr6:38866492-38866592 0.00045 43_[-2]_49 ++chr18:57137387-57137487 0.00045 7_[-2]_85 ++chr19:5726888-5726988 0.00046 77_[-2]_15 ++chr5:144386182-144386282 0.00046 52_[+2]_40 ++chr11:74652046-74652146 0.0005 25_[+2]_67 ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 2 in BLOCKS format ++-------------------------------------------------------------------------------- ++BL MOTIF 2 width=8 seqs=176 ++chr11:94858858-94858958 ( 28) CAGATAAG 1 ++chr2:37405046-37405146 ( 49) CAGATAAG 1 ++chr1:77295121-77295221 ( 41) CAGATAAG 1 ++chr19:55940203-55940303 ( 86) CAGATAAG 1 ++chr7:111007529-111007629 ( 46) CAGATAAG 1 ++chr5:65203206-65203306 ( 58) CAGATAAG 1 ++chr9:75406568-75406668 ( 6) CAGATAAG 1 ++chr9:114375901-114376001 ( 16) CAGATAAG 1 ++chr7:104332487-104332587 ( 15) CAGATAAG 1 ++chr19:24354046-24354146 ( 12) CAGATAAG 1 ++chr3:60623495-60623595 ( 59) CAGATAAG 1 ++chr11:90524331-90524431 ( 57) GAGATAAG 1 ++chr9:44096485-44096585 ( 32) GAGATAAG 1 ++chr17:24339801-24339901 ( 90) GAGATAAG 1 ++chr13:76003198-76003298 ( 50) GAGATAAG 1 ++chr16:10384211-10384311 ( 52) GAGATAAG 1 ++chr5:105994746-105994846 ( 80) GAGATAAG 1 ++chr14:61272712-61272812 ( 49) GAGATAAG 1 ++chr10:60612189-60612289 ( 42) GAGATAAG 1 ++chr10:127624309-12762440 ( 92) GAGATAAG 1 ++chr2:103324307-103324407 ( 1) GAGATAAG 1 ++chr9:121335572-121335672 ( 12) GAGATAAG 1 ++chr19:53259936-53260036 ( 39) GAGATAAG 1 ++chr8:83025149-83025249 ( 91) GAGATAAG 1 ++chr4:9588077-9588177 ( 19) GAGATAAG 1 ++chr4:8631654-8631754 ( 77) GAGATAAG 1 ++chr4:111173962-111174062 ( 49) CTGATAAG 1 ++chr14:69922787-69922887 ( 78) CTGATAAG 1 ++chr5:27985059-27985159 ( 36) CTGATAAG 1 ++chr5:38900629-38900729 ( 87) CTGATAAG 1 ++chr7:56247541-56247641 ( 26) CTGATAAG 1 ++chr15:91082415-91082515 ( 86) CTGATAAG 1 ++chr7:19832206-19832306 ( 18) CTGATAAG 1 ++chr11:96809236-96809336 ( 25) CTGATAAG 1 ++chr18:61379740-61379840 ( 36) CTGATAAG 1 ++chr11:115367839-11536793 ( 56) CTGATAAG 1 ++chr17:87913077-87913177 ( 69) CTGATAAG 1 ++chr12:41846175-41846275 ( 86) CTGATAAG 1 ++chr5:140280104-140280204 ( 32) CTGATAAG 1 ++chr13:96735032-96735132 ( 57) CTGATAAG 1 ++chr4:46419778-46419878 ( 75) GTGATAAG 1 ++chr16:8686808-8686908 ( 72) GTGATAAG 1 ++chr11:68709694-68709794 ( 78) GTGATAAG 1 ++chr5:144579743-144579843 ( 71) GTGATAAG 1 ++chr7:106742880-106742980 ( 11) GTGATAAG 1 ++chr5:97380647-97380747 ( 24) GTGATAAG 1 ++chr13:94151185-94151285 ( 38) GTGATAAG 1 ++chr14:71023665-71023765 ( 57) GTGATAAG 1 ++chr7:139930394-139930494 ( 73) GTGATAAG 1 ++chr3:104477494-104477594 ( 69) GTGATAAG 1 ++chr8:3522195-3522295 ( 93) GTGATAAG 1 ++chr7:134369101-134369201 ( 24) GTGATAAG 1 ++chrX:146984103-146984203 ( 75) GTGATAAG 1 ++chr3:100351339-100351439 ( 45) GTGATAAG 1 ++chr7:87847380-87847480 ( 78) AAGATAAG 1 ++chr6:38874025-38874125 ( 87) AAGATAAG 1 ++chr11:97307229-97307329 ( 75) AAGATAAG 1 ++chr8:126512499-126512599 ( 46) AAGATAAG 1 ++chr5:28369134-28369234 ( 31) AAGATAAG 1 ++chr9:98389942-98390042 ( 50) AAGATAAG 1 ++chr15:34829704-34829804 ( 45) AAGATAAG 1 ++chr7:28266695-28266795 ( 92) AAGATAAG 1 ++chr12:70884546-70884646 ( 38) AAGATAAG 1 ++chr4:111203043-111203143 ( 93) XAGATAAG 1 ++chr16:91352913-91353013 ( 37) AAGATAAG 1 ++chr9:42909937-42910037 ( 32) AAGATAAG 1 ++chr5:121049617-121049717 ( 24) AAGATAAG 1 ++chr11:87563494-87563594 ( 87) AAGATAAG 1 ++chr11:87539593-87539693 ( 39) AAGATAAG 1 ++chr17:26651346-26651446 ( 61) AAGATAAG 1 ++chr7:28233710-28233810 ( 33) CAGATAAA 1 ++chr8:87494749-87494849 ( 37) CAGATAAA 1 ++chr13:74873193-74873293 ( 61) CAGATAAA 1 ++chr15:56455063-56455163 ( 22) CAGATAAA 1 ++chr8:122895508-122895608 ( 80) CAGATAAA 1 ++chr5:45951564-45951664 ( 26) CAGATAAA 1 ++chr10:57527584-57527684 ( 68) CAGATAAA 1 ++chr6:86027771-86027871 ( 7) CAGATAAA 1 ++chr12:27135943-27136043 ( 41) CAGATAAA 1 ++chr1:183078714-183078814 ( 28) CAGATAAA 1 ++chr11:84636992-84637092 ( 69) GAGATAAA 1 ++chr17:47735005-47735105 ( 23) GAGATAAA 1 ++chr6:124614275-124614375 ( 16) GAGATAAA 1 ++chr13:112837037-11283713 ( 25) GAGATAAA 1 ++chr15:66969076-66969176 ( 46) GAGATAAA 1 ++chr13:100518007-10051810 ( 44) GAGATAAA 1 ++chr17:28946039-28946139 ( 40) GAGATAAA 1 ++chr11:32145484-32145584 ( 72) GAGATAAA 1 ++chr17:84135991-84136091 ( 42) GAGATAAA 1 ++chr12:78031164-78031264 ( 10) GAGATAAA 1 ++chr8:74937709-74937809 ( 92) ATGATAAG 1 ++chr13:35887680-35887780 ( 17) ATGATAAG 1 ++chr9:108243079-108243179 ( 74) ATGATAAG 1 ++chr9:21940048-21940148 ( 31) ATGATAAG 1 ++chr15:96173311-96173411 ( 16) ATGATAAG 1 ++chr11:44322388-44322488 ( 62) ATGATAAG 1 ++chr15:58828419-58828519 ( 27) CTGATAAA 1 ++chr6:34857295-34857395 ( 31) CTGATAAA 1 ++chr7:151917813-151917913 ( 56) CAGATAAC 1 ++chr15:82060182-82060282 ( 24) CTGATAAA 1 ++chr5:104483855-104483955 ( 13) CTGATAAA 1 ++chr17:29575283-29575383 ( 91) CTGATAAA 1 ++chr4:129974284-129974384 ( 57) CTGATAAA 1 ++chr16:8655670-8655770 ( 15) CTGATAAA 1 ++chr2:25869095-25869195 ( 8) CAGATAAC 1 ++chr2:120881647-120881747 ( 5) CTGATAAA 1 ++chr5:34915766-34915866 ( 13) CTGATAAA 1 ++chr12:35474089-35474189 ( 81) CTGATAAA 1 ++chr7:25940385-25940485 ( 46) CTGATAAA 1 ++chr11:117642059-11764215 ( 27) CTGATAAA 1 ++chr11:32150817-32150917 ( 67) CAGATAAC 1 ++chr4:118862380-118862480 ( 81) CTGATAAA 1 ++chr5:37127174-37127274 ( 22) CAGATAAC 1 ++chr7:20321985-20322085 ( 31) GAGATAAC 1 ++chr2:84652032-84652132 ( 36) GTGATAAA 1 ++chr11:50038237-50038337 ( 53) GAGATAAC 1 ++chr19:11699766-11699866 ( 52) GAGATAAC 1 ++chr16:92715757-92715857 ( 79) GAGATAAC 1 ++chr3:96232775-96232875 ( 39) AAGATAAA 1 ++chr5:143814328-143814428 ( 86) AAGATAAA 1 ++chr7:106135437-106135537 ( 11) AAGATAAA 1 ++chr4:122963964-122964064 ( 11) AAGATAAA 1 ++chr6:41654152-41654252 ( 22) AAGATAAA 1 ++chr3:19550494-19550594 ( 31) AAGATAAA 1 ++chr10:112467641-11246774 ( 1) AAGATAAA 1 ++chr13:114649130-11464923 ( 1) AAGATAAA 1 ++chr11:115372412-11537251 ( 27) AAGATAAA 1 ++chr3:145253491-145253591 ( 50) AAGATAAA 1 ++chr11:80597917-80598017 ( 67) GAGATAAX 1 ++chr8:107486056-107486156 ( 29) CTGATAAC 1 ++chr10:20961509-20961609 ( 57) CTGATAAC 1 ++chr11:101176807-10117690 ( 42) TAGATAAG 1 ++chr2:132521380-132521480 ( 53) TAGATAAG 1 ++chr19:44460304-44460404 ( 81) TAGATAAG 1 ++chr1:82633923-82634023 ( 66) CTGATAAC 1 ++chr11:32193433-32193533 ( 12) CTGATAAC 1 ++chr7:148956812-148956912 ( 58) TAGATAAG 1 ++chr4:41334758-41334858 ( 70) CTGATAAC 1 ++chr5:139858101-139858201 ( 69) CTGATAAC 1 ++chr9:31059931-31060031 ( 6) CTGATAAC 1 ++chr7:135432388-135432488 ( 83) CTGATAAC 1 ++chr9:65063484-65063584 ( 74) TAGATAAG 1 ++chr3:79383669-79383769 ( 20) TAGATAAG 1 ++chr13:59915598-59915698 ( 14) TAGATAAG 1 ++chr10:40726423-40726523 ( 90) CTGATAAC 1 ++chr14:32981987-32982087 ( 46) TAGATAAG 1 ++chr3:116562120-116562220 ( 85) CTGATAAC 1 ++chr3:102933243-102933343 ( 65) CTGATAAC 1 ++chr1:136638481-136638581 ( 51) CTGATAAC 1 ++chr13:73612724-73612824 ( 75) TAGATAAG 1 ++chr15:83253023-83253123 ( 10) GTGATAAC 1 ++chr9:107206717-107206817 ( 13) GTGATAAC 1 ++chr4:151334551-151334651 ( 30) GTGATAAC 1 ++chr16:44265653-44265753 ( 32) GTGATAAC 1 ++chr4:43977110-43977210 ( 47) GTGATAAC 1 ++chr2:152650540-152650640 ( 61) AAGATAAC 1 ++chr14:70865966-70866066 ( 29) ATGATAAA 1 ++chr19:24348712-24348812 ( 58) AAGATAAC 1 ++chr9:21362670-21362770 ( 19) AAGATAAC 1 ++chr19:5845898-5845998 ( 35) ATGATAAA 1 ++chr4:128532892-128532992 ( 50) TTGATAAG 1 ++chr11:69793284-69793384 ( 32) TTGATAAG 1 ++chr8:24254795-24254895 ( 44) TTGATAAG 1 ++chr10:111261810-11126191 ( 81) ATGATAAC 1 ++chr11:94195589-94195689 ( 48) TAGATAAA 1 ++chr2:31940724-31940824 ( 16) TAGATAAA 1 ++chr2:24832340-24832440 ( 16) TAGATAAA 1 ++chr9:57618593-57618693 ( 83) TAGATAAC 1 ++chr15:81700366-81700466 ( 75) TAGATAAC 1 ++chr6:132413557-132413657 ( 86) TAGATAAC 1 ++chr13:104969484-10496958 ( 81) CAGATAAT 1 ++chr6:38866492-38866592 ( 44) GAGATAAT 1 ++chr18:57137387-57137487 ( 8) CCGATAAG 1 ++chr19:5726888-5726988 ( 78) GCGATAAG 1 ++chr5:144386182-144386282 ( 53) GCGATAAG 1 ++chr11:74652046-74652146 ( 26) GTGATAAT 1 ++// ++ ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 2 position-specific scoring matrix ++-------------------------------------------------------------------------------- ++log-odds matrix: alength= 4 w= 8 n= 55800 bayes= 9.33278 E= 7.4e-025 ++ -27 63 34 -130 ++ 116 -384 -1410 68 ++ -1410 -1410 203 -1410 ++ 197 -1410 -1410 -1410 ++ -1410 -1410 -1410 197 ++ 197 -1410 -1410 -1410 ++ 197 -1410 -1410 -1410 ++ 13 -41 109 -379 ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 2 position-specific probability matrix ++-------------------------------------------------------------------------------- ++letter-probability matrix: alength= 4 w= 8 nsites= 176 E= 7.4e-025 ++ 0.211682 0.376386 0.308205 0.103727 ++ 0.573864 0.017045 0.000000 0.409091 ++ 0.000000 0.000000 1.000000 0.000000 ++ 1.000000 0.000000 0.000000 0.000000 ++ 0.000000 0.000000 0.000000 1.000000 ++ 1.000000 0.000000 0.000000 0.000000 ++ 1.000000 0.000000 0.000000 0.000000 ++ 0.279864 0.183205 0.518432 0.018500 ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 2 regular expression ++-------------------------------------------------------------------------------- ++[CGA][AT]GATAA[GA] ++-------------------------------------------------------------------------------- ++ ++ ++ ++ ++Time 235.83 secs. ++ ++******************************************************************************** ++ ++ ++******************************************************************************** ++MOTIF 3 MEME width = 29 sites = 6 llr = 177 E-value = 2.3e-006 ++******************************************************************************** ++-------------------------------------------------------------------------------- ++ Motif 3 Description ++-------------------------------------------------------------------------------- ++Simplified A ::::7:::::::87:8:7:a2::88:::: ++pos.-specific C a22a:282a2282:::a2a:8a2:28228 ++probability G ::8:::2::::::3a::::::::2:::7: ++matrix T :8::38:8:882:::2:2::::8::2822 ++ ++ bits 2.0 * * * * * ** * ++ 1.8 * * * * * ** * ++ 1.6 * * * * * ** * ++ 1.4 **** ******** * * ********* * ++Relative 1.2 **** ******** *** ********* * ++Entropy 1.0 ***************** ********* * ++(42.7 bits) 0.8 ***************************** ++ 0.6 ***************************** ++ 0.4 ***************************** ++ 0.2 ***************************** ++ 0.0 ----------------------------- ++ ++Multilevel CTGCATCTCTTCAAGACACACCTAACTGC ++consensus T G ++sequence ++ ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 3 sites sorted by position p-value ++-------------------------------------------------------------------------------- ++Sequence name Strand Start P-value Site ++------------- ------ ----- --------- ----------------------------- ++chr19:44460304-44460404 - 26 3.52e-18 CACACCCAAA CTGCATCTCTTCAAGACACACCTAACTGC GTCTGACAAA ++chr2:72858950-72859050 - 42 9.00e-17 CACACCCAAT CTGCATCTCTTCAGGACCCACCTAACTGC ATCTTACTAG ++chr14:55043397-55043497 + 25 3.09e-15 CACACCCTAA CTGCTTCCCTTCAGGACACACCCAACTGC ATCTGACAGC ++chr1:183078714-183078814 + 61 3.43e-14 CACACCCAAG CCGCACCTCCTTAAGACACACCTAACTGC ATGTGACAGG ++chr4:44016939-44017039 - 53 4.32e-13 CACACCCAAA CTGCATCTCTTCCAGACACAACTGCCTCT CACAGACACT ++chr5:118933400-118933500 + 47 4.06e-12 CCTCCGGTGT CTCCTTGTCTCCAAGTCTCACCTAATCTC CTTGGGACAA ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 3 block diagrams ++-------------------------------------------------------------------------------- ++SEQUENCE NAME POSITION P-VALUE MOTIF DIAGRAM ++------------- ---------------- ------------- ++chr19:44460304-44460404 3.5e-18 25_[-3]_46 ++chr2:72858950-72859050 9e-17 41_[-3]_30 ++chr14:55043397-55043497 3.1e-15 24_[+3]_47 ++chr1:183078714-183078814 3.4e-14 60_[+3]_11 ++chr4:44016939-44017039 4.3e-13 52_[-3]_19 ++chr5:118933400-118933500 4.1e-12 46_[+3]_25 ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 3 in BLOCKS format ++-------------------------------------------------------------------------------- ++BL MOTIF 3 width=29 seqs=6 ++chr19:44460304-44460404 ( 26) CTGCATCTCTTCAAGACACACCTAACTGC 1 ++chr2:72858950-72859050 ( 42) CTGCATCTCTTCAGGACCCACCTAACTGC 1 ++chr14:55043397-55043497 ( 25) CTGCTTCCCTTCAGGACACACCCAACTGC 1 ++chr1:183078714-183078814 ( 61) CCGCACCTCCTTAAGACACACCTAACTGC 1 ++chr4:44016939-44017039 ( 53) CTGCATCTCTTCCAGACACAACTGCCTCT 1 ++chr5:118933400-118933500 ( 47) CTCCTTGTCTCCAAGTCTCACCTAATCTC 1 ++// ++ ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 3 position-specific scoring matrix ++-------------------------------------------------------------------------------- ++log-odds matrix: alength= 4 w= 29 n= 43200 bayes= 13.2611 E= 2.3e-006 ++ -923 203 -923 -923 ++ -923 -55 -923 170 ++ -923 -55 177 -923 ++ -923 203 -923 -923 ++ 138 -923 -923 38 ++ -923 -55 -923 170 ++ -923 177 -55 -923 ++ -923 -55 -923 170 ++ -923 203 -923 -923 ++ -923 -55 -923 170 ++ -923 -55 -923 170 ++ -923 177 -923 -62 ++ 170 -55 -923 -923 ++ 138 -923 45 -923 ++ -923 -923 203 -923 ++ 170 -923 -923 -62 ++ -923 203 -923 -923 ++ 138 -55 -923 -62 ++ -923 203 -923 -923 ++ 196 -923 -923 -923 ++ -62 177 -923 -923 ++ -923 203 -923 -923 ++ -923 -55 -923 170 ++ 170 -923 -55 -923 ++ 170 -55 -923 -923 ++ -923 177 -923 -62 ++ -923 -55 -923 170 ++ -923 -55 145 -62 ++ -923 177 -923 -62 ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 3 position-specific probability matrix ++-------------------------------------------------------------------------------- ++letter-probability matrix: alength= 4 w= 29 nsites= 6 E= 2.3e-006 ++ 0.000000 1.000000 0.000000 0.000000 ++ 0.000000 0.166667 0.000000 0.833333 ++ 0.000000 0.166667 0.833333 0.000000 ++ 0.000000 1.000000 0.000000 0.000000 ++ 0.666667 0.000000 0.000000 0.333333 ++ 0.000000 0.166667 0.000000 0.833333 ++ 0.000000 0.833333 0.166667 0.000000 ++ 0.000000 0.166667 0.000000 0.833333 ++ 0.000000 1.000000 0.000000 0.000000 ++ 0.000000 0.166667 0.000000 0.833333 ++ 0.000000 0.166667 0.000000 0.833333 ++ 0.000000 0.833333 0.000000 0.166667 ++ 0.833333 0.166667 0.000000 0.000000 ++ 0.666667 0.000000 0.333333 0.000000 ++ 0.000000 0.000000 1.000000 0.000000 ++ 0.833333 0.000000 0.000000 0.166667 ++ 0.000000 1.000000 0.000000 0.000000 ++ 0.666667 0.166667 0.000000 0.166667 ++ 0.000000 1.000000 0.000000 0.000000 ++ 1.000000 0.000000 0.000000 0.000000 ++ 0.166667 0.833333 0.000000 0.000000 ++ 0.000000 1.000000 0.000000 0.000000 ++ 0.000000 0.166667 0.000000 0.833333 ++ 0.833333 0.000000 0.166667 0.000000 ++ 0.833333 0.166667 0.000000 0.000000 ++ 0.000000 0.833333 0.000000 0.166667 ++ 0.000000 0.166667 0.000000 0.833333 ++ 0.000000 0.166667 0.666667 0.166667 ++ 0.000000 0.833333 0.000000 0.166667 ++-------------------------------------------------------------------------------- ++ ++-------------------------------------------------------------------------------- ++ Motif 3 regular expression ++-------------------------------------------------------------------------------- ++CTGC[AT]TCTCTTCA[AG]GACACACCTAACTGC ++-------------------------------------------------------------------------------- ++ ++ ++ ++ ++Time 325.79 secs. ++ ++******************************************************************************** ++ ++ ++******************************************************************************** ++SUMMARY OF MOTIFS ++******************************************************************************** ++ ++-------------------------------------------------------------------------------- ++ Combined block diagrams: non-overlapping sites with p-value < 0.0001 ++-------------------------------------------------------------------------------- ++SEQUENCE NAME COMBINED P-VALUE MOTIF DIAGRAM ++------------- ---------------- ------------- ++chr1:157319655-157319755 3.42e-01 100 ++chr8:24254795-24254895 2.72e-01 100 ++chr15:76778490-76778590 1.58e-02 3_[+3(4.02e-05)]_68 ++chr6:57695286-57695386 3.61e-01 100 ++chr10:59336304-59336404 7.13e-02 100 ++chr1:43307689-43307789 8.53e-01 100 ++chr4:111175598-111175698 1.95e-01 100 ++chr19:47458493-47458593 1.00e+00 100 ++chr13:73612724-73612824 2.54e-03 46_[-1(3.85e-05)]_42 ++chr7:16507688-16507788 3.50e-01 100 ++chr6:132413557-132413657 4.88e-01 100 ++chr10:110604368-11060446 1.21e-03 35_[-1(3.50e-06)]_53 ++chr3:100351339-100351439 1.72e-02 44_[-2(6.39e-05)]_48 ++chr2:78556315-78556415 2.01e-02 28_[-3(3.47e-05)]_43 ++chr18:65586914-65587014 1.00e+00 100 ++chr4:8631654-8631754 1.40e-02 76_[+2(3.19e-05)]_16 ++chr11:4232025-4232125 1.00e+00 100 ++chr4:143002327-143002427 4.44e-01 100 ++chr14:79702843-79702943 3.24e-03 52_[+1(2.34e-06)]_36 ++chr3:145253491-145253591 1.35e-03 60_[+1(2.86e-06)]_28 ++chr11:69793284-69793384 9.63e-03 49_[+1(9.26e-05)]_39 ++chr4:135745625-135745725 2.14e-01 100 ++chr1:136638481-136638581 5.48e-05 11_[+1(4.22e-07)]_77 ++chr10:126642276-12664237 1.13e-02 57_[+1(1.18e-05)]_31 ++chr18:23868476-23868576 1.91e-02 65_[-1(4.35e-06)]_23 ++chr6:134934722-134934822 7.88e-01 100 ++chr17:12397642-12397742 8.03e-01 100 ++chr11:44322388-44322488 2.01e-03 5_[+1(2.02e-05)]_83 ++chr7:106679807-106679907 4.84e-02 100 ++chr17:26651346-26651446 9.12e-04 60_[-2(8.06e-05)]_32 ++chr12:78031164-78031264 3.20e-04 19_[+1(1.83e-05)]_69 ++chr5:37127174-37127274 8.06e-04 85_[+2(1.60e-05)]_7 ++chr19:5845898-5845998 1.11e-01 100 ++chr1:183078714-183078814 1.02e-13 27_[-2(9.74e-05)]_11_[+1(9.18e-06)]_\ ++ 2_[+3(3.43e-14)]_11 ++chr3:102933243-102933343 3.86e-02 100 ++chr16:91804488-91804588 1.97e-01 100 ++chr3:116562120-116562220 1.28e-01 100 ++chr13:96735032-96735132 2.14e-02 56_[+2(4.79e-05)]_36 ++chr6:38860750-38860850 9.94e-01 100 ++chr11:102226516-10222661 5.48e-01 100 ++chr1:9763391-9763491 6.82e-01 100 ++chr9:107275713-107275813 5.01e-02 100 ++chr6:86610038-86610138 3.06e-01 100 ++chr8:87362362-87362462 1.97e-03 55_[+1(6.14e-06)]_33 ++chr11:115626399-11562649 4.28e-01 100 ++chr12:112796793-11279689 5.13e-03 35_[-1(9.18e-06)]_53 ++chr14:32981987-32982087 6.24e-02 100 ++chr15:57638556-57638656 7.89e-01 100 ++chr1:135696218-135696318 1.25e-01 100 ++chr19:32372781-32372881 2.02e-01 100 ++chr12:70394725-70394825 8.83e-04 53_[+1(2.86e-06)]_35 ++chr4:118862380-118862480 2.16e-02 100 ++chr16:76323701-76323801 3.32e-03 65_[+1(2.91e-05)]_23 ++chr12:112063120-11206322 4.75e-01 100 ++chr7:107640799-107640899 8.01e-01 100 ++chr11:4577309-4577409 9.95e-01 100 ++chr9:66197481-66197581 6.62e-01 100 ++chr6:31150321-31150421 5.05e-02 100 ++chr18:57137387-57137487 3.80e-03 100 ++chr5:144386182-144386282 1.16e-01 100 ++chr10:69792642-69792742 1.00e+00 100 ++chr11:115372412-11537251 3.34e-01 100 ++chr11:32150817-32150917 2.96e-03 20_[-1(3.21e-05)]_68 ++chrX:146984103-146984203 2.95e-03 29_[+1(7.31e-05)]_33_[+2(6.39e-05)]_\ ++ 18 ++chr5:65255864-65255964 2.08e-04 5_[+1(1.05e-07)]_6_[+1(1.08e-05)]_\ ++ 24_[+1(5.43e-06)]_29 ++chr3:145353763-145353863 9.93e-01 100 ++chr6:70740090-70740190 7.31e-01 100 ++chr13:3345624-3345724 8.54e-01 100 ++chr13:114649130-11464923 1.61e-03 46_[-1(9.18e-06)]_42 ++chr2:25148315-25148415 4.92e-01 100 ++chr11:87539593-87539693 1.01e-03 19_[-1(7.89e-05)]_7_[-2(8.06e-05)]_\ ++ 54 ++chr7:134369101-134369201 6.34e-03 23_[-2(6.39e-05)]_69 ++chr10:40726423-40726523 1.32e-03 56_[-1(4.35e-06)]_32 ++chr1:90207103-90207203 5.95e-01 100 ++chr12:27135943-27136043 2.86e-04 40_[+2(9.74e-05)]_32_[+1(4.66e-06)]_\ ++ 8 ++chr2:34638537-34638637 9.58e-01 100 ++chr5:73746597-73746697 1.03e-02 71_[-1(2.91e-05)]_17 ++chr11:74652046-74652146 3.13e-01 100 ++chr4:9588077-9588177 1.33e-03 18_[-2(3.19e-05)]_35_[+1(2.38e-05)]_\ ++ 27 ++chr11:53839887-53839987 2.87e-02 58_[+1(1.83e-05)]_30 ++chr2:84681995-84682095 8.28e-02 100 ++chr18:82836059-82836159 9.34e-01 100 ++chr5:140280104-140280204 5.18e-02 31_[-2(4.79e-05)]_61 ++chr15:41338513-41338613 7.12e-01 100 ++chr7:99891352-99891452 4.96e-03 19_[+1(6.14e-06)]_69 ++chr11:69714223-69714323 8.58e-02 100 ++chr1:88057040-88057140 4.00e-03 4_[-3(5.84e-05)]_67 ++chr11:117642059-11764215 4.82e-03 68_[-1(2.38e-05)]_20 ++chr17:37006053-37006153 1.42e-01 100 ++chr7:139969683-139969783 8.01e-04 23_[+1(1.38e-06)]_65 ++chr6:34428673-34428773 1.05e-01 44_[-1(4.49e-05)]_44 ++chrX:119944785-119944885 1.00e+00 100 ++chr17:84135991-84136091 3.54e-03 38_[+3(9.16e-05)]_33 ++chr7:91033421-91033521 2.96e-01 100 ++chr15:83139084-83139184 7.81e-04 21_[+1(2.86e-06)]_31_[+1(4.16e-05)]_\ ++ 24 ++chr7:38963791-38963891 1.76e-01 100 ++chr18:54151150-54151250 4.49e-03 1_[+3(3.29e-05)]_70 ++chr11:87563494-87563594 6.41e-02 86_[-2(8.06e-05)]_6 ++chr19:45121627-45121727 6.25e-01 100 ++chr8:83025149-83025249 1.10e-03 90_[+2(3.19e-05)]_2 ++chr5:121847518-121847618 1.84e-01 100 ++chr11:32145484-32145584 8.86e-02 100 ++chr19:5922115-5922215 3.42e-01 100 ++chr12:41846175-41846275 3.46e-02 85_[+2(4.79e-05)]_7 ++chr11:61770985-61771085 1.24e-01 100 ++chr2:24832340-24832440 1.05e-03 43_[-1(6.14e-06)]_45 ++chr7:139915432-139915532 1.38e-02 47_[-1(6.97e-06)]_41 ++chr19:56465962-56466062 7.29e-01 100 ++chr12:58298569-58298669 7.89e-01 100 ++chr15:79757890-79757990 8.89e-01 100 ++chr12:71933518-71933618 7.20e-01 100 ++chr4:118863135-118863235 7.01e-04 49_[+1(3.85e-05)]_39 ++chr5:121049617-121049717 3.72e-02 23_[+2(8.06e-05)]_69 ++chr5:144737551-144737651 3.78e-02 100 ++chr4:153400587-153400687 7.70e-01 100 ++chr19:60889898-60889998 9.95e-01 100 ++chr16:49776999-49777099 6.87e-04 87_[+1(2.86e-06)]_1 ++chr11:121295412-12129551 5.51e-02 83_[+1(3.85e-05)]_5 ++chr4:118293096-118293196 1.73e-02 59_[+1(2.38e-05)]_29 ++chr16:32508974-32509074 1.05e-02 77_[+1(5.87e-05)]_11 ++chr2:167454294-167454394 1.03e-02 47_[+1(8.35e-06)]_41 ++chr13:59915598-59915698 2.68e-03 42_[+2(4.79e-05)]_50 ++chr8:3522195-3522295 8.85e-02 92_[-2(6.39e-05)] ++chr3:79383669-79383769 2.08e-03 48_[+1(1.65e-05)]_40 ++chr5:87232755-87232855 1.91e-01 100 ++chr6:146196316-146196416 1.00e+00 100 ++chr17:47754579-47754679 1.63e-01 33_[+1(9.26e-05)]_55 ++chr13:94158460-94158560 2.09e-01 100 ++chr17:28946039-28946139 4.37e-02 100 ++chr9:102674394-102674494 9.84e-01 100 ++chr7:25940385-25940485 7.09e-02 100 ++chr9:65063484-65063584 4.27e-02 100 ++chr11:90547829-90547929 1.85e-03 71_[+1(1.81e-06)]_17 ++chr11:57315370-57315470 6.85e-01 100 ++chr3:60623495-60623595 8.05e-05 31_[-1(9.18e-06)]_15_[+2(1.60e-05)]_\ ++ 34 ++chr13:63465095-63465195 2.98e-01 100 ++chr14:63796626-63796726 1.00e-02 48_[+1(5.43e-06)]_40 ++chr4:32949806-32949906 4.32e-02 100 ++chr6:149136526-149136626 9.28e-01 100 ++chr10:112467641-11246774 3.65e-01 100 ++chr10:59711555-59711655 1.00e+00 100 ++chr5:37112215-37112315 7.64e-03 54_[-1(5.39e-05)]_34 ++chr10:128184603-12818470 1.24e-01 100 ++chr16:92715757-92715857 4.18e-03 100 ++chr9:64640065-64640165 3.92e-01 100 ++chr3:103708584-103708684 1.13e-01 100 ++chr6:136416750-136416850 2.75e-01 100 ++chr9:104996245-104996345 7.43e-01 100 ++chr2:157978336-157978436 5.79e-03 45_[+1(9.84e-06)]_43 ++chr7:128009272-128009372 1.07e-01 100 ++chr13:112511938-11251203 9.10e-01 100 ++chr2:28928359-28928459 2.96e-01 100 ++chr13:34169860-34169960 4.11e-01 100 ++chr12:35474089-35474189 4.45e-02 100 ++chr3:104477494-104477594 1.80e-01 68_[-2(6.39e-05)]_24 ++chr5:34915766-34915866 8.02e-04 43_[+1(7.89e-05)]_45 ++chr1:60399689-60399789 5.93e-01 100 ++chr8:107823857-107823957 4.64e-05 30_[-1(3.50e-06)]_58 ++chr2:153321069-153321169 2.89e-01 100 ++chr1:133343882-133343982 9.19e-04 38_[-1(1.81e-06)]_50 ++chr7:128850882-128850982 2.81e-02 2_[-1(8.35e-06)]_86 ++chr12:112505814-11250591 6.41e-02 56_[-1(6.36e-05)]_32 ++chr3:30811842-30811942 5.57e-01 100 ++chr6:57653288-57653388 3.63e-02 41_[+1(2.38e-05)]_17_[+1(6.36e-05)]_\ ++ 18 ++chr4:106351519-106351619 3.12e-01 100 ++chr11:61773535-61773635 9.85e-01 100 ++chr12:16754497-16754597 8.08e-01 100 ++chr3:68858679-68858779 1.61e-01 100 ++chr9:70774507-70774607 1.51e-02 27_[+1(3.54e-05)]_33_[-1(9.26e-05)]_\ ++ 16 ++chr15:78888126-78888226 2.93e-02 37_[+3(1.07e-05)]_34 ++chr8:125244308-125244408 8.87e-01 100 ++chr15:81700366-81700466 7.53e-05 33_[+1(3.50e-06)]_55 ++chr10:60585890-60585990 6.49e-01 100 ++chr2:91483171-91483271 3.23e-01 100 ++chr7:135432388-135432488 1.61e-02 100 ++chr1:122155871-122155971 4.33e-01 100 ++chr9:57147432-57147532 1.00e+00 100 ++chr14:63729028-63729128 5.09e-01 100 ++chr9:42909937-42910037 1.47e-02 31_[-2(8.06e-05)]_61 ++chr5:118933400-118933500 2.15e-10 2_[+1(2.21e-05)]_32_[+3(4.06e-12)]_\ ++ 25 ++chr11:115374473-11537457 7.05e-03 31_[+1(2.02e-05)]_57 ++chr19:53259936-53260036 1.80e-05 11_[-1(3.16e-07)]_15_[-2(3.19e-05)]_\ ++ 54 ++chr3:107899565-107899665 3.40e-01 100 ++chr4:119486254-119486354 1.39e-01 100 ++chr19:45865026-45865126 2.93e-02 57_[+1(3.21e-05)]_31 ++chr16:91352913-91353013 2.86e-05 36_[-2(8.06e-05)]_16_[+1(2.11e-07)]_\ ++ 28 ++chr9:121335572-121335672 1.02e-02 11_[-2(3.19e-05)]_81 ++chr15:78243389-78243489 1.55e-02 37_[-1(2.02e-05)]_51 ++chr9:40980320-40980420 8.38e-02 100 ++chr2:103324307-103324407 1.44e-02 [-2(3.19e-05)]_92 ++chr4:116666092-116666192 1.78e-01 100 ++chr2:167169232-167169332 1.34e-01 4_[+3(8.41e-05)]_67 ++chr11:102236404-10223650 8.56e-03 13_[+1(6.86e-05)]_75 ++chr10:128286731-12828683 9.12e-01 100 ++chr17:87913077-87913177 5.23e-04 29_[+3(9.16e-05)]_10_[+2(4.79e-05)]_\ ++ 24 ++chr7:111019147-111019247 5.56e-02 100 ++chr15:73181611-73181711 1.03e-01 100 ++chr9:66763905-66764005 1.36e-02 26_[-1(4.49e-05)]_62 ++chr7:139930394-139930494 5.11e-03 72_[-2(6.39e-05)]_20 ++chr9:31059931-31060031 8.91e-04 17_[-1(8.35e-06)]_71 ++chr15:76083899-76083999 9.72e-05 50_[+1(2.11e-07)]_6_[+1(2.34e-06)]_\ ++ 20 ++chr13:98513311-98513411 2.63e-01 100 ++chr2:93306456-93306556 1.32e-02 30_[-1(1.65e-05)]_58 ++chr14:69939826-69939926 8.39e-02 100 ++chr1:70948720-70948820 1.00e+00 100 ++chr10:127624309-12762440 1.14e-01 91_[-2(3.19e-05)]_1 ++chr5:104188914-104189014 6.04e-01 100 ++chr4:126645608-126645708 5.93e-01 100 ++chr6:86027771-86027871 2.85e-05 6_[-2(9.74e-05)]_12_[-1(2.11e-07)]_\ ++ 62 ++chr14:71023665-71023765 9.45e-02 56_[+2(6.39e-05)]_36 ++chr2:130961395-130961495 3.05e-02 100 ++chr11:115367839-11536793 1.09e-04 55_[+2(4.79e-05)]_16_[+1(2.34e-06)]_\ ++ 9 ++chr4:111203043-111203143 2.09e-01 92_[+2(8.06e-05)] ++chr11:57590459-57590559 7.17e-01 100 ++chr15:96173311-96173411 2.50e-01 100 ++chr11:115373882-11537398 1.06e-02 75_[+1(1.29e-05)]_13 ++chr11:115139145-11513924 2.59e-01 100 ++chr18:61379740-61379840 2.19e-05 35_[-2(4.79e-05)]_14_[+1(3.16e-07)]_\ ++ 31 ++chr10:126640071-12664017 5.71e-01 100 ++chr15:95715579-95715679 8.80e-03 67_[-1(2.21e-05)]_[-1(2.21e-05)]_9 ++chr13:47204525-47204625 1.00e+00 100 ++chr9:112905110-112905210 3.30e-03 84_[-1(3.16e-07)]_4 ++chr3:51034100-51034200 4.32e-01 100 ++chr17:48438406-48438506 3.98e-02 53_[-1(5.87e-05)]_35 ++chr8:122302552-122302652 2.15e-01 100 ++chr13:94151185-94151285 3.98e-02 37_[-2(6.39e-05)]_55 ++chr4:132847120-132847220 5.51e-03 32_[-1(1.18e-05)]_56 ++chr11:95661714-95661814 1.21e-01 100 ++chr5:144685596-144685696 3.51e-01 100 ++chr11:121294774-12129487 3.24e-02 100 ++chr6:82964292-82964392 9.88e-01 100 ++chr17:29067182-29067282 3.45e-03 9_[+1(1.18e-05)]_23_[-1(9.26e-05)]_\ ++ 44 ++chr6:121187424-121187524 5.78e-01 100 ++chr17:24289204-24289304 1.86e-02 49_[-1(3.85e-05)]_6_[+1(4.49e-05)]_\ ++ 21 ++chr2:72858950-72859050 9.07e-15 41_[-3(9.00e-17)]_2_[-1(9.18e-06)]_\ ++ 16 ++chr5:117587453-117587553 5.02e-01 100 ++chr12:80012616-80012716 5.33e-03 16_[+1(1.38e-06)]_72 ++chr6:56860899-56860999 1.00e+00 100 ++chr2:84852385-84852485 8.60e-01 100 ++chr13:112833729-11283382 3.63e-04 35_[-1(2.11e-07)]_53 ++chr10:57527584-57527684 4.19e-04 32_[+1(2.02e-06)]_23_[+2(9.74e-05)]_\ ++ 25 ++chr10:76673548-76673648 3.42e-01 100 ++chr5:17334951-17335051 1.49e-01 100 ++chr5:139858101-139858201 2.45e-04 37_[+1(1.38e-06)]_51 ++chr16:14166505-14166605 9.86e-01 100 ++chr2:35181511-35181611 3.88e-01 100 ++chr19:24354046-24354146 7.04e-02 11_[-2(1.60e-05)]_81 ++chr7:111009339-111009439 1.05e-01 100 ++chr16:34319202-34319302 7.85e-02 100 ++chr4:41334758-41334858 6.79e-03 7_[-1(4.49e-05)]_81 ++chr4:44084688-44084788 2.24e-03 64_[+1(6.14e-06)]_24 ++chr10:60612189-60612289 4.17e-04 18_[-1(5.43e-06)]_11_[-2(3.19e-05)]_\ ++ 51 ++chr11:61433607-61433707 4.09e-03 4_[+1(6.97e-06)]_84 ++chr11:117187371-11718747 7.33e-03 45_[-1(8.35e-06)]_43 ++chr11:104842982-10484308 1.72e-01 82_[-1(6.36e-05)]_6 ++chr7:148956812-148956912 9.24e-03 37_[-1(2.91e-05)]_51 ++chr19:11699766-11699866 4.73e-02 100 ++chr2:118499054-118499154 3.76e-02 64_[-3(6.15e-05)]_7 ++chr10:30482937-30483037 2.38e-01 100 ++chr3:88305499-88305599 1.31e-01 32_[-1(6.86e-05)]_56 ++chr3:101355777-101355877 8.07e-01 100 ++chr4:135407872-135407972 8.83e-02 100 ++chr1:170140426-170140526 4.22e-01 100 ++chr2:164599350-164599450 7.27e-02 76_[-1(5.87e-05)]_12 ++chr12:17246026-17246126 7.94e-01 100 ++chr4:43977110-43977210 4.30e-04 31_[-1(6.38e-07)]_57 ++chr19:5896487-5896587 7.55e-01 100 ++chr13:39515524-39515624 9.91e-01 100 ++chr14:61272712-61272812 4.02e-02 48_[+2(3.19e-05)]_44 ++chr19:6236069-6236169 9.61e-03 41_[-1(8.35e-06)]_47 ++chr4:128532892-128532992 6.99e-04 64_[+1(1.81e-06)]_24 ++chr11:96809236-96809336 8.77e-02 24_[-2(4.79e-05)]_68 ++chr12:102194282-10219438 1.40e-03 20_[+1(2.86e-06)]_68 ++chr4:155335984-155336084 2.90e-01 100 ++chr17:85277578-85277678 9.60e-04 83_[+1(2.02e-06)]_5 ++chr6:81915768-81915868 1.12e-02 [-1(2.86e-06)]_88 ++chr5:115468249-115468349 1.17e-03 21_[+1(6.97e-06)]_67 ++chr13:100518007-10051810 1.17e-05 31_[-3(2.93e-06)]_19_[+1(4.91e-05)]_\ ++ 9 ++chr2:28462971-28463071 3.77e-03 11_[+1(2.34e-06)]_77 ++chr10:57252235-57252335 9.91e-01 100 ++chr14:20884080-20884180 7.01e-01 100 ++chr2:5220410-5220510 1.00e+00 100 ++chr2:25742740-25742840 3.12e-03 36_[-1(1.38e-06)]_52 ++chr7:104332487-104332587 2.58e-03 14_[-2(1.60e-05)]_78 ++chr2:120881647-120881747 1.82e-01 100 ++chr6:83115545-83115645 4.62e-03 100 ++chr1:175901566-175901666 7.73e-01 100 ++chr9:114375901-114376001 3.43e-04 15_[+2(1.60e-05)]_12_[+1(3.21e-05)]_\ ++ 53 ++chr6:125826720-125826820 1.00e+00 100 ++chr11:51213800-51213900 9.98e-01 100 ++chr4:32996228-32996328 2.80e-01 100 ++chr4:132785398-132785498 5.89e-01 100 ++chr9:75406568-75406668 4.51e-04 5_[+2(1.60e-05)]_40_[-1(1.29e-05)]_\ ++ 35 ++chr5:105994746-105994846 1.86e-02 79_[+2(3.19e-05)]_13 ++chr1:169314207-169314307 4.53e-04 17_[+1(9.54e-07)]_71 ++chr11:104890314-10489041 1.50e-01 100 ++chr1:92185725-92185825 1.63e-01 100 ++chr2:25869095-25869195 2.25e-03 39_[-1(3.21e-05)]_49 ++chr16:32449730-32449830 4.18e-01 100 ++chr15:66969076-66969176 1.24e-01 100 ++chr17:47672782-47672882 2.16e-01 100 ++chr9:118957546-118957646 9.97e-01 100 ++chr1:183187346-183187446 2.23e-01 100 ++chr8:24164439-24164539 8.19e-03 11_[-1(6.36e-05)]_2_[+1(2.61e-05)]_\ ++ 63 ++chr11:75460436-75460536 2.31e-01 100 ++chr4:44016939-44017039 2.71e-11 52_[-3(4.32e-13)]_2_[-1(9.18e-06)]_\ ++ 5 ++chr11:32193433-32193533 1.74e-01 100 ++chr2:31940724-31940824 2.76e-03 62_[-1(9.84e-06)]_26 ++chr12:113882351-11388245 4.28e-01 100 ++chr9:21940048-21940148 1.14e-04 8_[+1(3.16e-07)]_80 ++chr12:70884546-70884646 2.33e-02 37_[-2(8.06e-05)]_55 ++chr7:28266695-28266795 2.09e-01 91_[+2(8.06e-05)]_1 ++chr17:91618497-91618597 9.98e-01 100 ++chr3:51492457-51492557 2.65e-04 27_[-1(3.16e-07)]_61 ++chr5:30289968-30290068 1.03e-04 52_[+1(2.34e-06)]_36 ++chr1:59010622-59010722 2.78e-01 100 ++chr2:125973397-125973497 1.00e+00 100 ++chr9:34860986-34861086 7.75e-02 100 ++chr10:25018819-25018919 5.24e-01 100 ++chr14:21479094-21479194 6.24e-02 100 ++chr3:84162552-84162652 1.72e-03 65_[-1(4.35e-06)]_23 ++chr11:32168936-32169036 3.93e-02 30_[-1(2.02e-05)]_58 ++chr5:143681949-143682049 1.18e-03 35_[+1(2.61e-05)]_53 ++chr5:97380647-97380747 7.21e-03 23_[+2(6.39e-05)]_69 ++chr18:32719456-32719556 8.86e-02 100 ++chr5:144438246-144438346 9.77e-01 100 ++chr9:108243079-108243179 1.51e-04 29_[+1(1.91e-06)]_59 ++chr17:34266308-34266408 4.29e-01 100 ++chr3:84607841-84607941 8.05e-01 100 ++chr14:56154882-56154982 5.50e-02 39_[+1(2.21e-05)]_49 ++chr15:34829704-34829804 1.03e-04 32_[-1(6.97e-06)]_[+2(8.06e-05)]_7_\ ++ [+1(2.91e-05)]_29 ++chr13:112837037-11283713 1.03e-01 100 ++chr10:40924607-40924707 8.21e-03 79_[+1(2.91e-05)]_9 ++chr8:113026623-113026723 8.49e-01 100 ++chr5:130455804-130455904 2.23e-02 41_[+3(2.55e-05)]_30 ++chr9:7790420-7790520 4.51e-04 73_[-1(1.38e-06)]_15 ++chr13:35887680-35887780 1.64e-04 45_[+1(3.50e-06)]_43 ++chr17:25039618-25039718 8.11e-03 41_[-1(5.43e-06)]_47 ++chr2:103962051-103962151 1.39e-02 33_[-1(6.97e-06)]_55 ++chr7:25993968-25994068 1.48e-03 46_[+1(9.54e-07)]_42 ++chr12:117249634-11724973 3.76e-01 100 ++chr1:82633923-82634023 6.50e-03 26_[+1(2.38e-05)]_62 ++chr4:76585119-76585219 2.53e-01 100 ++chr12:77866194-77866294 5.46e-01 100 ++chr11:50038237-50038337 4.60e-03 77_[+1(7.31e-05)]_11 ++chr16:8655670-8655770 2.23e-01 100 ++chr19:6300360-6300460 5.29e-04 1_[-1(2.86e-06)]_87 ++chr4:132806563-132806663 6.93e-01 100 ++chr7:106951864-106951964 4.97e-01 100 ++chr1:196501890-196501990 9.14e-01 100 ++chr17:25716183-25716283 1.46e-01 100 ++chr7:148354573-148354673 1.21e-03 43_[-1(9.18e-06)]_18_[+1(4.91e-05)]_\ ++ 15 ++chr7:19832206-19832306 4.59e-05 17_[-2(4.79e-05)]_9_[+1(1.38e-06)]_\ ++ 54 ++chr4:129140944-129141044 8.65e-04 66_[+1(6.97e-06)]_22 ++chr16:49839620-49839720 3.23e-02 74_[+1(2.38e-05)]_14 ++chr3:95468978-95469078 8.74e-01 100 ++chr15:91082415-91082515 2.25e-04 44_[+1(4.35e-06)]_29_[-2(4.79e-05)]_\ ++ 7 ++chr7:128112656-128112756 1.87e-04 43_[-1(8.35e-06)]_45 ++chr19:17397730-17397830 4.65e-01 100 ++chr5:22924216-22924316 4.32e-01 100 ++chr11:94195589-94195689 3.29e-03 70_[+1(5.87e-05)]_18 ++chr7:106742880-106742980 7.70e-02 10_[+2(6.39e-05)]_82 ++chr2:167256470-167256570 2.28e-01 100 ++chr5:138127196-138127296 1.41e-02 41_[-1(4.35e-06)]_47 ++chr6:124614275-124614375 2.57e-01 100 ++chr5:45951564-45951664 1.80e-05 25_[-2(9.74e-05)]_33_[+1(3.16e-07)]_\ ++ 22 ++chr19:44460304-44460404 3.89e-17 25_[-3(3.52e-18)]_2_[-1(9.18e-06)]_\ ++ 32 ++chr7:26004856-26004956 5.34e-01 100 ++chr4:129974284-129974384 5.56e-02 100 ++chr5:89197188-89197288 4.71e-03 41_[-1(1.47e-05)]_12_[+1(4.91e-05)]_\ ++ 23 ++chr16:10384211-10384311 7.67e-04 13_[-1(1.29e-05)]_26_[+2(3.19e-05)]_\ ++ 41 ++chr9:48582636-48582736 1.00e+00 100 ++chr9:59598185-59598285 6.17e-02 100 ++chr9:21362670-21362770 6.80e-03 59_[-1(2.02e-05)]_29 ++chr5:137730859-137730959 1.55e-02 100 ++chr15:38473209-38473309 1.15e-01 100 ++chr9:98389942-98390042 7.93e-05 49_[-2(8.06e-05)]_[+1(6.97e-06)]_31 ++chr2:132521380-132521480 1.11e-01 100 ++chr3:19550494-19550594 3.71e-02 100 ++chr10:93585403-93585503 2.36e-01 100 ++chr7:110976194-110976294 9.56e-02 100 ++chr9:113850420-113850520 1.21e-02 35_[-1(4.89e-06)]_53 ++chr2:150491522-150491622 3.67e-01 100 ++chr9:107198662-107198762 1.80e-01 100 ++chr17:29575283-29575383 2.50e-02 100 ++chr12:33905457-33905557 5.49e-01 100 ++chr17:45884715-45884815 1.34e-03 46_[+1(2.34e-06)]_42 ++chr11:31712261-31712361 1.38e-01 100 ++chr2:155437821-155437921 1.00e+00 100 ++chr8:122895508-122895608 8.29e-02 79_[+2(9.74e-05)]_13 ++chr7:103853791-103853891 4.10e-02 87_[-1(1.83e-05)]_1 ++chr12:70860460-70860560 7.40e-03 54_[+1(3.54e-05)]_34 ++chr2:84652032-84652132 1.55e-01 100 ++chr19:24609086-24609186 1.09e-02 58_[-3(5.84e-05)]_13 ++chr8:109948099-109948199 4.13e-01 100 ++chr11:24999930-25000030 1.00e+00 100 ++chr5:144579743-144579843 5.04e-03 70_[+2(6.39e-05)]_22 ++chr14:70506761-70506861 7.85e-02 100 ++chr8:74937709-74937809 2.79e-05 14_[+1(9.54e-07)]_39_[+1(2.86e-06)]_\ ++ 23 ++chr5:65203206-65203306 1.04e-03 41_[-1(3.85e-05)]_4_[-2(1.60e-05)]_\ ++ 35 ++chr6:72229420-72229520 1.00e+00 100 ++chr19:5726888-5726988 1.11e-01 100 ++chr16:44265653-44265753 1.17e-03 2_[-1(1.18e-05)]_86 ++chr15:103088528-10308862 1.82e-01 100 ++chr3:121365444-121365544 4.70e-01 100 ++chr15:56455063-56455163 1.30e-02 21_[-2(9.74e-05)]_71 ++chr17:47735005-47735105 1.41e-03 51_[-1(2.02e-05)]_37 ++chr5:104483855-104483955 1.57e-02 100 ++chr4:151334551-151334651 2.94e-03 8_[-1(2.02e-05)]_80 ++chr6:135115627-135115727 1.27e-03 36_[+1(4.16e-05)]_52 ++chr7:20250334-20250434 1.11e-01 100 ++chr4:128287321-128287421 1.40e-02 22_[-1(5.87e-05)]_66 ++chr4:117504523-117504623 2.60e-02 23_[-1(5.87e-05)]_65 ++chr1:181078665-181078765 5.28e-01 100 ++chr9:122282102-122282202 9.41e-01 100 ++chr7:28320390-28320490 2.33e-01 100 ++chr6:41654152-41654252 3.57e-02 100 ++chr5:108943417-108943517 6.49e-02 100 ++chr1:75175759-75175859 1.67e-02 25_[+1(3.54e-05)]_63 ++chr13:112863644-11286374 6.73e-05 31_[-1(2.21e-05)]_30_[+1(4.89e-06)]_\ ++ 15 ++chr6:145703214-145703314 3.14e-01 100 ++chr19:43786023-43786123 8.12e-01 100 ++chr5:28369134-28369234 3.38e-03 30_[-2(8.06e-05)]_26_[+1(9.26e-05)]_\ ++ 24 ++chr3:108248003-108248103 4.64e-03 28_[-1(1.18e-05)]_60 ++chr8:126512499-126512599 2.04e-02 45_[-2(8.06e-05)]_47 ++chr13:3866265-3866365 3.41e-05 68_[+1(2.11e-07)]_20 ++chrX:39372438-39372538 3.24e-01 100 ++chr12:116305851-11630595 1.48e-02 49_[-3(9.04e-06)]_22 ++chr4:33073879-33073979 9.11e-02 100 ++chr8:92969520-92969620 1.00e+00 100 ++chr4:31985597-31985697 6.63e-01 100 ++chr7:111007529-111007629 3.21e-05 20_[-1(1.08e-05)]_13_[+2(1.60e-05)]_\ ++ 47 ++chr1:36976472-36976572 4.42e-03 37_[+1(4.16e-05)]_51 ++chr18:23982469-23982569 9.92e-01 100 ++chr13:35769193-35769293 3.37e-01 100 ++chr11:69759802-69759902 4.05e-03 34_[+1(1.18e-05)]_54 ++chr11:97307229-97307329 1.31e-01 74_[-2(8.06e-05)]_18 ++chr7:53193728-53193828 2.95e-01 100 ++chr1:173470675-173470775 4.16e-01 100 ++chr19:55940203-55940303 6.93e-04 59_[-1(2.21e-05)]_14_[+2(1.60e-05)]_\ ++ 7 ++chr13:3862102-3862202 2.88e-03 19_[-1(6.38e-07)]_69 ++chr2:118962055-118962155 8.88e-01 100 ++chr4:154303236-154303336 3.30e-01 100 ++chr16:33115730-33115830 1.00e+00 100 ++chr3:89612430-89612530 2.00e-02 1_[+3(4.40e-05)]_70 ++chr8:113905789-113905889 5.67e-01 100 ++chr9:44773666-44773766 1.10e-01 100 ++chr1:122244436-122244536 9.57e-01 100 ++chr4:34497471-34497571 8.82e-01 100 ++chr13:74873193-74873293 5.90e-04 25_[-1(1.47e-05)]_23_[+2(9.74e-05)]_\ ++ 32 ++chr7:106959478-106959578 8.04e-01 100 ++chr15:76883556-76883656 9.27e-01 100 ++chr1:9738233-9738333 3.61e-03 15_[+1(2.38e-05)]_73 ++chr11:68709694-68709794 2.18e-03 48_[+1(2.61e-05)]_17_[+2(6.39e-05)]_\ ++ 15 ++chr1:36977018-36977118 4.68e-01 100 ++chr15:82060182-82060282 5.45e-04 10_[+1(1.38e-06)]_78 ++chr1:77295121-77295221 2.62e-04 17_[+1(2.21e-05)]_11_[-2(1.60e-05)]_\ ++ 52 ++chr4:141307993-141308093 5.14e-01 100 ++chr14:21299129-21299229 1.08e-02 9_[-1(1.65e-05)]_6_[-1(7.89e-05)]_\ ++ 61 ++chr3:153454529-153454629 7.68e-01 100 ++chr3:138480015-138480115 2.66e-01 100 ++chr2:103728070-103728170 9.94e-01 100 ++chr9:107982358-107982458 2.39e-01 100 ++chr8:87494749-87494849 3.40e-04 36_[-2(9.74e-05)]_35_[-1(6.14e-06)]_\ ++ 9 ++chr1:135846956-135847056 1.19e-02 100 ++chr13:76003198-76003298 3.72e-02 49_[-2(3.19e-05)]_43 ++chr4:154285744-154285844 6.99e-05 28_[-1(6.97e-06)]_60 ++chr10:111261810-11126191 2.11e-03 45_[-1(4.35e-06)]_43 ++chr11:101309432-10130953 2.96e-03 59_[+1(9.26e-05)]_[-1(1.38e-06)]_17 ++chr4:154862419-154862519 9.20e-03 33_[-3(4.90e-05)]_38 ++chr7:56247541-56247641 1.16e-02 25_[-2(4.79e-05)]_67 ++chr11:86476947-86477047 7.80e-03 42_[+1(8.59e-05)]_46 ++chr3:151777795-151777895 2.42e-01 100 ++chr12:116856336-11685643 8.53e-01 100 ++chr7:134716501-134716601 4.67e-01 100 ++chr13:56459265-56459365 7.17e-03 53_[-1(2.91e-05)]_35 ++chr13:23643344-23643444 3.01e-01 100 ++chr2:37405046-37405146 4.84e-02 48_[+2(1.60e-05)]_44 ++chr7:16987194-16987294 8.66e-03 100 ++chr11:101176807-10117690 2.57e-02 100 ++chr6:38874025-38874125 9.31e-02 86_[+2(8.06e-05)]_6 ++chr1:134264177-134264277 9.20e-01 100 ++chr13:113639369-11363946 5.59e-02 100 ++chr11:84636992-84637092 9.13e-04 32_[+1(2.91e-05)]_56 ++chr10:20961509-20961609 3.44e-02 100 ++chr3:19087306-19087406 2.28e-01 100 ++chr4:122963964-122964064 2.50e-03 27_[-1(6.97e-06)]_61 ++chr11:94858858-94858958 2.14e-06 7_[+3(1.28e-05)]_12_[+1(1.18e-05)]_\ ++ [+3(5.74e-05)]_11 ++chr7:106135437-106135537 1.79e-01 100 ++chr18:74156785-74156885 3.82e-01 100 ++chr16:3349854-3349954 9.97e-01 100 ++chr11:6313293-6313393 5.05e-01 100 ++chr12:110018191-11001829 4.50e-01 100 ++chr18:62325791-62325891 8.72e-03 100 ++chr8:107486056-107486156 5.61e-02 100 ++chr9:57618593-57618693 5.11e-02 100 ++chr7:6315631-6315731 1.80e-01 100 ++chr7:151917813-151917913 1.94e-05 22_[-1(3.16e-07)]_66 ++chr9:70682446-70682546 2.22e-03 18_[+1(9.84e-06)]_70 ++chr5:64826641-64826741 1.78e-03 71_[+1(1.81e-06)]_[+1(6.38e-07)]_5 ++chr6:35303480-35303580 7.49e-02 100 ++chr5:38900629-38900729 1.36e-01 86_[-2(4.79e-05)]_6 ++chr2:131039491-131039591 6.94e-02 100 ++chr9:107206717-107206817 3.52e-04 22_[-1(1.38e-06)]_66 ++chr12:85791924-85792024 8.62e-01 100 ++chr7:101244828-101244928 6.71e-01 100 ++chr11:80597917-80598017 4.00e-01 100 ++chr12:90222446-90222546 1.35e-01 100 ++chr9:42938267-42938367 3.26e-02 100 ++chr17:28960251-28960351 1.61e-04 24_[-1(1.05e-07)]_64 ++chr8:73222227-73222327 2.49e-01 100 ++chr6:120124363-120124463 1.49e-01 100 ++chr5:27985059-27985159 5.49e-05 35_[-2(4.79e-05)]_33_[+1(1.81e-06)]_\ ++ 12 ++chr13:20241987-20242087 6.18e-01 100 ++chr17:84209564-84209664 1.00e+00 100 ++chr14:55690870-55690970 2.63e-03 42_[-1(5.87e-05)]_[-3(2.98e-05)]_17 ++chr1:135693775-135693875 2.80e-03 3_[+1(3.50e-06)]_85 ++chr7:20321985-20322085 1.23e-03 51_[-1(1.18e-05)]_37 ++chr7:86884670-86884770 2.58e-01 100 ++chr11:86427475-86427575 7.00e-04 26_[+1(9.54e-07)]_62 ++chr1:173447613-173447713 5.58e-01 100 ++chr19:24348712-24348812 7.00e-02 100 ++chr8:19899370-19899470 4.94e-01 100 ++chr1:155596605-155596705 1.76e-03 13_[-1(2.86e-06)]_75 ++chr14:70865966-70866066 7.29e-03 47_[-1(2.91e-05)]_41 ++chr17:24339801-24339901 1.93e-02 89_[-2(3.19e-05)]_3 ++chr7:82905683-82905783 1.00e+00 100 ++chr7:38977098-38977198 2.01e-01 100 ++chr7:149571621-149571721 1.48e-03 36_[+1(6.14e-06)]_52 ++chr11:107308643-10730874 1.03e-02 80_[+1(1.81e-06)]_8 ++chr14:79987351-79987451 2.58e-01 100 ++chr1:88208802-88208902 1.11e-02 30_[+3(8.27e-05)]_41 ++chr11:107258863-10725896 1.00e+00 100 ++chr2:52304247-52304347 3.45e-01 100 ++chr5:77087236-77087336 2.05e-02 70_[-1(8.35e-06)]_18 ++chr14:55043397-55043497 3.60e-13 10_[+1(9.84e-06)]_2_[+3(3.09e-15)]_\ ++ 47 ++chr14:41760573-41760673 7.77e-04 65_[+1(1.38e-06)]_23 ++chr8:73367285-73367385 1.94e-01 100 ++chr7:148976465-148976565 5.71e-01 100 ++chr5:143814328-143814428 2.28e-03 9_[+1(5.87e-05)]_79 ++chr9:44096485-44096585 2.53e-05 31_[-2(3.19e-05)]_21_[+1(9.54e-07)]_\ ++ 28 ++chr14:69922787-69922887 4.77e-03 77_[+2(4.79e-05)]_15 ++chr18:75107912-75108012 7.97e-01 100 ++chr11:96817329-96817429 6.73e-04 78_[-1(1.81e-06)]_10 ++chr15:62052573-62052673 3.17e-01 100 ++chr13:45622655-45622755 4.43e-02 100 ++chr17:45710229-45710329 3.38e-01 100 ++chr3:144332974-144333074 1.80e-01 100 ++chr2:152650540-152650640 2.09e-02 30_[+1(7.31e-05)]_58 ++chr17:84179514-84179614 1.26e-03 43_[-1(1.38e-06)]_45 ++chr11:69186640-69186740 4.34e-05 43_[+1(3.54e-05)]_11_[-1(1.38e-06)]_\ ++ 22 ++chr9:108709856-108709956 4.72e-02 74_[-1(2.61e-05)]_14 ++chr7:28233710-28233810 9.37e-05 32_[+2(9.74e-05)]_[+1(4.22e-07)]_48 ++chr1:22562530-22562630 9.76e-01 100 ++chr6:38866492-38866592 2.38e-04 72_[-1(2.11e-07)]_16 ++chr17:26079524-26079624 1.90e-03 87_[+1(1.81e-06)]_1 ++chr19:4558364-4558464 8.54e-01 100 ++chr17:43466517-43466617 7.97e-04 23_[+1(3.16e-07)]_65 ++chr3:151860092-151860192 9.94e-01 100 ++chr13:45499433-45499533 9.88e-01 100 ++chr3:104843904-104844004 2.02e-01 100 ++chr13:57679177-57679277 6.15e-03 22_[+1(3.85e-05)]_66 ++chr15:98860005-98860105 2.88e-02 57_[+1(5.39e-05)]_31 ++chr19:8797699-8797799 1.34e-01 100 ++chr11:89087922-89088022 3.86e-01 100 ++chr7:38970374-38970474 9.63e-01 100 ++chr11:97793525-97793625 1.00e+00 100 ++chr6:28617038-28617138 4.34e-01 100 ++chr13:107890788-10789088 3.43e-02 100 ++chr3:60589029-60589129 2.42e-01 100 ++chr7:148318027-148318127 6.02e-02 100 ++chr15:80573349-80573449 5.02e-01 100 ++chr5:129513005-129513105 5.75e-02 100 ++chr6:56190306-56190406 1.00e+00 100 ++chr6:72324693-72324793 7.35e-03 83_[-1(9.54e-07)]_5 ++chr16:8686808-8686908 1.33e-03 49_[+1(2.21e-05)]_10_[-2(6.39e-05)]_\ ++ 21 ++chr4:111173962-111174062 2.60e-04 48_[-2(4.79e-05)]_15_[+1(9.18e-06)]_\ ++ 17 ++chr13:113537910-11353801 3.51e-03 62_[+1(2.86e-06)]_26 ++chr6:34857295-34857395 2.06e-04 16_[+1(2.34e-06)]_72 ++chr8:98213264-98213364 5.57e-01 100 ++chr15:27299346-27299446 8.22e-01 100 ++chr2:31917151-31917251 8.21e-01 100 ++chr10:59465794-59465894 4.05e-01 100 ++chr18:32716208-32716308 5.89e-01 100 ++chr3:96232775-96232875 2.03e-02 100 ++chr6:131327331-131327431 1.00e+00 100 ++chr18:34136393-34136493 8.43e-01 100 ++chr13:104969484-10496958 1.42e-02 100 ++chr4:154282317-154282417 9.86e-01 100 ++chr4:134960761-134960861 5.14e-02 41_[-1(7.31e-05)]_47 ++chr8:51109538-51109638 1.00e+00 100 ++chr15:83253023-83253123 1.13e-02 100 ++chr5:118929926-118930026 1.54e-02 28_[-1(2.38e-05)]_60 ++chr15:58828419-58828519 2.21e-04 73_[+1(4.22e-07)]_15 ++chr11:105013713-10501381 1.21e-01 100 ++chr7:87847380-87847480 4.37e-02 77_[+2(8.06e-05)]_15 ++chr13:114606035-11460613 3.73e-01 100 ++chr4:46419778-46419878 6.13e-03 74_[+2(6.39e-05)]_18 ++chr5:33616213-33616313 5.79e-03 52_[+1(9.54e-07)]_36 ++chr11:90524331-90524431 1.58e-05 25_[-1(6.38e-07)]_19_[+2(3.19e-05)]_\ ++ 36 ++-------------------------------------------------------------------------------- ++ ++******************************************************************************** ++ ++ ++******************************************************************************** ++Stopped because nmotifs = 3 reached. ++******************************************************************************** ++ ++CPU: IMB12-010665 ++ ++******************************************************************************** +diff -ruN a/doc/examples/memechip_example_output_files/meme_out/meme.xml b/doc/examples/memechip_example_output_files/meme_out/meme.xml +--- a/doc/examples/memechip_example_output_files/meme_out/meme.xml 1970-01-01 10:00:00.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/meme_out/meme.xml 2014-10-07 17:17:30.000000000 +1000 +@@ -0,0 +1,9133 @@ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++]> ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++0.249 ++0.251 ++0.251 ++0.249 ++ ++ ++ ++ ++meme memechip_example_output_files/seqs-sampled -oc memechip_example_output_files/meme_out -dna -mod zoops -nmotifs 3 -minw 6 -maxw 30 -bfile memechip_example_output_files/background -revcomp -nostatus ++IMB12-010665 ++zoops ++3 ++inf ++E-value of product of p-values ++6 ++30 ++ 0.00 ++11 ++1 ++yes ++2 ++600 ++0.8 ++1 ++uni ++0.5 ++dirichlet ++0.01 ++50 ++1e-05 ++600 ++60000 ++0 ++ 1 ++both ++ ++Stopped because nmotifs = 3 reached. ++ ++ ++0.256 ++0.244 ++0.244 ++0.256 ++ ++ ++ ++ ++ ++ ++ ++ ++-67 ++68 ++40 ++-103 ++ ++ ++46 ++-64 ++44 ++-67 ++ ++ ++44 ++-292 ++130 ++-376 ++ ++ ++-212 ++172 ++-167 ++-201 ++ ++ ++-426 ++188 ++-578 ++-160 ++ ++ ++142 ++22 ++-419 ++-385 ++ ++ ++-1446 ++203 ++-1446 ++-1446 ++ ++ ++164 ++-1446 ++-35 ++-426 ++ ++ ++-552 ++202 ++-780 ++-780 ++ ++ ++-467 ++200 ++-461 ++-552 ++ ++ ++-780 ++202 ++-780 ++-467 ++ ++ ++86 ++-129 ++-681 ++76 ++ ++ ++ ++ ++ ++ ++0.161138 ++0.392196 ++0.321084 ++0.125582 ++ ++ ++0.352249 ++0.156640 ++0.329973 ++0.161138 ++ ++ ++0.347804 ++0.032196 ++0.601084 ++0.018916 ++ ++ ++0.058916 ++0.801084 ++0.076640 ++0.063360 ++ ++ ++0.013333 ++0.897778 ++0.004444 ++0.084444 ++ ++ ++0.684444 ++0.284444 ++0.013333 ++0.017778 ++ ++ ++0.000000 ++1.000000 ++0.000000 ++0.000000 ++ ++ ++0.795556 ++0.000000 ++0.191111 ++0.013333 ++ ++ ++0.005582 ++0.992196 ++0.001084 ++0.001138 ++ ++ ++0.010027 ++0.974418 ++0.009973 ++0.005582 ++ ++ ++0.001138 ++0.987751 ++0.001084 ++0.010027 ++ ++ ++0.464498 ++0.099947 ++0.002169 ++0.433387 ++ ++ ++ ++ ++[CG][AG][GA]CC[AC]CACCC[AT] ++ ++ ++ ++GGCCTAGGGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GAGCTACCTC ++ ++ ++CTGGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACATTCTCAC ++ ++ ++XXXXXXXXGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTCTCTATCT ++ ++ ++CCTAGCCGTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCTGGGTTGG ++ ++ ++GATGATGAAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCCATGAACT ++ ++ ++ACAAGAGACT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTCTGCCATG ++ ++ ++TGCGCTTGCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTACCTTGGC ++ ++ ++CCATGCTCAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GAGTCACTGG ++ ++ ++AACCCTGGGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCTTGCCTTG ++ ++ ++CTGCTGCAGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GAAGGCAGGG ++ ++ ++ACACGCCCCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGTCTGGCAA ++ ++ ++CGGTTTATAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TACTCCTGCT ++ ++ ++CTACCACT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGTGTCCAGG ++ ++ ++XTAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CXXXXXXXXX ++ ++ ++GGGTGAAAAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTCTCTCTTC ++ ++ ++CGAATGTGGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CAGGAGCTGG ++ ++ ++GCCATGTGAT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCCAGAGGCA ++ ++ ++TCCAGATAAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TGCTAGCCTT ++ ++ ++CTCTAAGCAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTACATGGGC ++ ++ ++AGCCTATCAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTTCGGGCCT ++ ++ ++GCCCCACCCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTGCA ++ ++ ++CTTGGCTGAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGCGTCTCCC ++ ++ ++TTATCACTGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCCAGGGGAA ++ ++ ++GGGCCTTACC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GAAACAAACT ++ ++ ++AAGCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACTTCTTGAT ++ ++ ++CTTTGGAGCG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACCCTAAAGT ++ ++ ++TTCCATTTCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CAGTGACTAG ++ ++ ++GAACCTAAGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCCAGGTGAC ++ ++ ++CAGGCAGCCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGGTTGTTCC ++ ++ ++GAGGAGATAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTGAGAAGGG ++ ++ ++AGGTCCATAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCACCAGATC ++ ++ ++TTTGTTGTTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAGGAGTCAA ++ ++ ++TATTGGGAGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAGTTATCAC ++ ++ ++TCTGAGCATA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TGGGCGGAGC ++ ++ ++TGCATCCTTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTTTATCAGT ++ ++ ++GAAAAGCCCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGATGTCTGA ++ ++ ++TAACATTGCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AACTACCAGC ++ ++ ++TGATGCCCCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGAAGAGCCA ++ ++ ++CCTGCAGGTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGTTTTTTTA ++ ++ ++TTTACACACC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CGGGAGAGGC ++ ++ ++TCAGCCTCAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCACCCCAGT ++ ++ ++GAACACTAAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++T ++ ++ ++TTCCTTTCCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTTCTCTCCC ++ ++ ++TCAAACTTAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTACCCCA ++ ++ ++GATAACACTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACTGCCCATC ++ ++ ++AAGATTCTGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTGCCCACTA ++ ++ ++ATGATCAATC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACAACTACCC ++ ++ ++ATACACCCTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTCCCCAAGG ++ ++ ++GCTACTGCTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTAAATATCT ++ ++ ++AGGCCCTTGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGAGC ++ ++ ++GACAGTTCTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TAGAGACAGC ++ ++ ++GGCTGGGCCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AATTTATCAG ++ ++ ++GATCTCCAAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TGAGGTAGGA ++ ++ ++TGGAGTCTGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CCTAGAGCAC ++ ++ ++TGGGCGGGGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTGACTCCAC ++ ++ ++ACGTCTGTCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTGCTGACA ++ ++ ++ACTTTGAAGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCCTCCCTAG ++ ++ ++AGATGTCTGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGTCTGCCAG ++ ++ ++CACTGGCTCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GAGCAGCTAG ++ ++ ++TGTGAACATG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGGATGCAGA ++ ++ ++TGGCTCTAAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++G ++ ++ ++AGCCACCGTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTATCAAGCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTCAACAGCT ++ ++ ++TTAATAGTTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++C ++ ++ ++TGGGTTTTAT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTGGCCTCCA ++ ++ ++TAACTTTCCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTCCTATCTG ++ ++ ++AGATAAACTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TGCTGACTGT ++ ++ ++TAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATCCTCTTCA ++ ++ ++AGCCTTCTCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CCCTCCCTTG ++ ++ ++GCTCTTTATT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTTTGGCTCA ++ ++ ++CCTCCCCTAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GAACTTATCA ++ ++ ++TCACCAGCAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCGTCTCAGA ++ ++ ++TGACTTTGGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCCTGCTCCC ++ ++ ++TTGCTCTTGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTAGCAAAAG ++ ++ ++GAGATAAAAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CCCAGCAGAG ++ ++ ++CATTTTGCAT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTCCCTCACC ++ ++ ++CTGCCAGATG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GAGTATGCAA ++ ++ ++AGCAGGCAGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTCTACCTAC ++ ++ ++CCATTCAGCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCTAGCTC ++ ++ ++GCTCACACTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AATCTGCATA ++ ++ ++CTCCCTAGCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAGCTGTTTC ++ ++ ++TGCAGTTAAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGTGACAGTG ++ ++ ++ATGCCATTGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CATTTGAGTA ++ ++ ++CCTGGCGCGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGAATTTGAT ++ ++ ++TTTCCCTCAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGTCAGGTGG ++ ++ ++GTGCTCCAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTGGGATGGC ++ ++ ++CCATTCCCCG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCCTATCGAG ++ ++ ++AAGAGCACAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTATGTTCTT ++ ++ ++GACTTTGGGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTTTAGGAAT ++ ++ ++TGCCCCATCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCCTAAGGCT ++ ++ ++AGCCAAGAGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGTACAACAT ++ ++ ++CAGTCCCACC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AACTCCATCT ++ ++ ++TTCTTATCTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACCAGGCCAG ++ ++ ++ACCATGCTCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACCCCACCTT ++ ++ ++CCCACCTCAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCCCTGAGAA ++ ++ ++GTCTTATCTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AACCCCAGTT ++ ++ ++GTGAGTCTGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTTCCCTCCA ++ ++ ++CACC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCCTGCAGCT ++ ++ ++TGTTACAAAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GACAGCGCTC ++ ++ ++XAAAGCCATA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTGCATCCAA ++ ++ ++CCAGTAACCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GACACCCTGG ++ ++ ++AGCCTCTAGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCCCAGCAGG ++ ++ ++GGGTTCTCTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCCTCCCTCT ++ ++ ++TCTGCTCCGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCTGGTTATC ++ ++ ++TCAACACGCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AA ++ ++ ++TGTGTGCATG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TGCGTGTATA ++ ++ ++CATGCTTGTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATATCAGAGC ++ ++ ++GGGACTTTTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AACTGCATCT ++ ++ ++GCTCTCATCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTTCGTGGCA ++ ++ ++CTGTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AACTGCATCT ++ ++ ++AAGGCCTTTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATCTGCATCT ++ ++ ++ACGTGGGAGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTGGTCTGAG ++ ++ ++GCATTACAGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AACCCAACAG ++ ++ ++CAGATGTACC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGCCCTTTAG ++ ++ ++GGAGCTTTTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGCCGCACCT ++ ++ ++GAAACTTTTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AACTGCTTCC ++ ++ ++ACAGGGAAGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCCAGCGTGC ++ ++ ++GGGCCGTGGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TAGTGTGACT ++ ++ ++TTTGATAAAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGATAATATA ++ ++ ++CCACAGTCTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCTGACACTA ++ ++ ++AGAACCACAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CCCATGGGGC ++ ++ ++GCACAATAGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGCCACCCCT ++ ++ ++TATACCCCGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AACAGCTGGT ++ ++ ++CCGCATAAGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTTCACTTCT ++ ++ ++ACAGTAAGTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GA ++ ++ ++GACACGTCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TATCCCAATT ++ ++ ++ACTTTCCACT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TGCCCTATCT ++ ++ ++CCAGTGGGAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTTTCTGTTA ++ ++ ++AACTAGAGTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCCTCTCCTC ++ ++ ++CACAAAACTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTTTGTGATT ++ ++ ++ATCTCCAGTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTAAGCGCTG ++ ++ ++AGTGTAGGGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GAGAGTGGGA ++ ++ ++CTTCTAAAGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATCTATCAGA ++ ++ ++CCCACTTGCG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAGCTGCAG ++ ++ ++ATATCTACCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TACAGTCCCA ++ ++ ++GCGTGCTGAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AATAAATGTG ++ ++ ++CTGCAGGTGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGCTGTCTAC ++ ++ ++TTTATCTCCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CCCATCATGC ++ ++ ++CTAGCCTATG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGTTTCTG ++ ++ ++CAAGTGTCCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTCCTCTCCA ++ ++ ++GAAGATAGGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CCTGAGTTGG ++ ++ ++TAGCGTCTGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCCCTTGGCC ++ ++ ++GCCTAAGGCG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAGTCACTGT ++ ++ ++GATGGCTCCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGCACAGACA ++ ++ ++CTGCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCAGCCGGCC ++ ++ ++CTGATTACGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTGTGACAGC ++ ++ ++CCCGTCTGAT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTCTGTTCAG ++ ++ ++CAGTTATGCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATTACTGTCA ++ ++ ++AGGACATTGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCCCCCTGGT ++ ++ ++CAGTGTTAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGGTCCCACC ++ ++ ++GTCTGGCCGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTGAACAGAG ++ ++ ++GTAACGGCCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCACTCACAC ++ ++ ++ACACTTGAAT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCCCTCGGTT ++ ++ ++AGACACAGGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AACTGTGTGG ++ ++ ++CGAAGCAATC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AACGCTAGAG ++ ++ ++TTAGAAACAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGGCGGAGCG ++ ++ ++TGGCCCCTCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TGAACAGTGC ++ ++ ++ACTCCCTTCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AACTTGTCAA ++ ++ ++TGTAGACCTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACAGACACTG ++ ++ ++GCTGCTAAGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCCTTGCCAA ++ ++ ++TGGAGTACCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TATCAATGGT ++ ++ ++CAAGTGGGGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGCTGCCAGT ++ ++ ++TGTCTTCGGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCAGCCTTGC ++ ++ ++CTCTCAGCAT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TAGAAGACTG ++ ++ ++GCGAGATGAT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCCACACCC ++ ++ ++TACCACAACG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGAGGAGACA ++ ++ ++TACTTTGCAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCCTCTCTAC ++ ++ ++GCAAGTGCCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGTAGGGATG ++ ++ ++GACAGATCCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCTTTCCTCG ++ ++ ++ACCCCTTCCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTGCTGAGCA ++ ++ ++TTCCTACCAT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTGAACAAGC ++ ++ ++CCACAGTGGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TGGCCTGGGT ++ ++ ++TGACTCAGCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATCCAATGCT ++ ++ ++TTGGCGCCTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTGTAACTGC ++ ++ ++GTTGAGTTCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TGCCCTTTCC ++ ++ ++GCATCTGCAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCTTAGAACT ++ ++ ++GATAAGATTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTACTTCGGA ++ ++ ++CCCATGGCTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TATCT ++ ++ ++CCCTCCTCTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CCCCAACTGA ++ ++ ++AGAAACACCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGTGTGGCCT ++ ++ ++TCTGAGAGTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CAGAGGAGCT ++ ++ ++AAGCATTCTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACTAAGCACA ++ ++ ++GGTAAACAAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCTAGAA ++ ++ ++GCTGTCCCCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TACCACAGGC ++ ++ ++AATTTGATAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGGAAAGAGC ++ ++ ++GCCGAGGTAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCTAGCAATC ++ ++ ++TCTGCAGAAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTTCCGCCC ++ ++ ++TCCGTTTCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TGCCCAAAGT ++ ++ ++AAGCAACTCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGGGGACCCA ++ ++ ++AGGCAGTACT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTGCTTGCTG ++ ++ ++GCTGCTTCAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTTCCTTTGC ++ ++ ++ATTTGGCCCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCCCTCTGTC ++ ++ ++CTTCTCAGAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTCTTTGGCT ++ ++ ++ACTAAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GAGAGCAXXX ++ ++ ++AGAAACGCTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTTAATTTTT ++ ++ ++CCTACTCCAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTCAGTTTCT ++ ++ ++AGGGAGCCTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTGCAXXXXX ++ ++ ++TCATCAGTGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGACCTGTGC ++ ++ ++CGGCTACAGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TGCCAGATCC ++ ++ ++TTCTTCTTCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGGCTCATCC ++ ++ ++AAGAGAGAAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACTGTCAAGT ++ ++ ++GATTATCATA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TACTCAGACA ++ ++ ++CATTAGGAGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++NNNNNNNNNN ++ ++ ++AGCCTTCAGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCCCACTCCA ++ ++ ++AACCATCCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++NNNNNNNNNN ++ ++ ++ATATCAAGGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACATCTCAGC ++ ++ ++CCCAGAAACT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CCTGCAGCTC ++ ++ ++CACCCAT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTGTGTGTCC ++ ++ ++AACGACGAAT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAGTGGTCTG ++ ++ ++CAAATTACTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGCGGGCCAG ++ ++ ++CTCATTCCTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGCTGACAAG ++ ++ ++TGTCTGCCAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTTGCCTACC ++ ++ ++GTAGACCCCG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCTAATCTAG ++ ++ ++CTCAGAAGGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTTGACTAGA ++ ++ ++TCTGAGGGCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCTC ++ ++ ++GAGCCTTCTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTGGCTGGGA ++ ++ ++CTGCAAAACA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AANNNNNNNN ++ ++ ++CTAATTAGCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCGGATTAGC ++ ++ ++ATAAACAAAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTCTGCCCAC ++ ++ ++TGGCATTTAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCAACAGTTG ++ ++ ++GGAGGATGGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATCCGCAGGA ++ ++ ++GGAGAGACGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTTTAGAATT ++ ++ ++GTGAGCTTCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTCACCT ++ ++ ++NNNNNNNNNN ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGGAGGGCCC ++ ++ ++AAATCATCCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++NNNNNNNNNN ++ ++ ++ ++ ++ ++ ++ ++-27 ++63 ++34 ++-130 ++ ++ ++116 ++-384 ++-1410 ++68 ++ ++ ++-1410 ++-1410 ++203 ++-1410 ++ ++ ++197 ++-1410 ++-1410 ++-1410 ++ ++ ++-1410 ++-1410 ++-1410 ++197 ++ ++ ++197 ++-1410 ++-1410 ++-1410 ++ ++ ++197 ++-1410 ++-1410 ++-1410 ++ ++ ++13 ++-41 ++109 ++-379 ++ ++ ++ ++ ++ ++ ++0.211682 ++0.376386 ++0.308205 ++0.103727 ++ ++ ++0.573864 ++0.017045 ++0.000000 ++0.409091 ++ ++ ++0.000000 ++0.000000 ++1.000000 ++0.000000 ++ ++ ++1.000000 ++0.000000 ++0.000000 ++0.000000 ++ ++ ++0.000000 ++0.000000 ++0.000000 ++1.000000 ++ ++ ++1.000000 ++0.000000 ++0.000000 ++0.000000 ++ ++ ++1.000000 ++0.000000 ++0.000000 ++0.000000 ++ ++ ++0.279864 ++0.183205 ++0.518432 ++0.018500 ++ ++ ++ ++ ++[CGA][AT]GATAA[GA] ++ ++ ++ ++ATTGTGCATA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGTGTGTGGC ++ ++ ++TAGTATTTCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TAAGTTATCA ++ ++ ++TGTTCCTCAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCTGAACAGA ++ ++ ++TAACTGCCTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGGGGCT ++ ++ ++ACTGTGGTGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGCCAGAGCT ++ ++ ++GACATAGCTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATTCTGCCCA ++ ++ ++CAGAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CAAAATGGCC ++ ++ ++TCCATGAACA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCACCCCTTC ++ ++ ++GGAGTGGCAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CCAAAGACAA ++ ++ ++XXXXXXXXTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCTCGGTTCT ++ ++ ++CACGTGCTGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGCTGTTTTT ++ ++ ++TAGAGGCAAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACTTTGCACC ++ ++ ++TGAACTGCAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CAATGAGGGG ++ ++ ++CAT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CAGCTGCCAG ++ ++ ++CTGCTAAGGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATGAGTCAAC ++ ++ ++CCTGGAACCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAGCTTGGCC ++ ++ ++TCTGTTGAGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCTTCAGGAT ++ ++ ++CTGTCTCCTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCCAAGCCTC ++ ++ ++ACACTAGGTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AATGCCATTG ++ ++ ++A ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGTXXXXXXX ++ ++ ++ATATTCCTGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTGACACTGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GACTTAGTAG ++ ++ ++GTGGTGGCAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAGATCGAAT ++ ++ ++GTTGGGTGAT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GG ++ ++ ++TTTCACAAAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GACGTATTCT ++ ++ ++TAGGGAAGAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTATTGTGGC ++ ++ ++GCATGCTCCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CATGGTGTCT ++ ++ ++CAGGTGCATC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CAGGGAGGGA ++ ++ ++CCTGTGACCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAATGTCTGA ++ ++ ++TGTGGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TGTATGAGAT ++ ++ ++TGCTAGGGAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTGCCTCACA ++ ++ ++ATAAAGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGACTATGGC ++ ++ ++TGGGGCTTTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGGGCAGAAC ++ ++ ++AGGGAGGACA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTCTGGCCTT ++ ++ ++TCACCCTGGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGCCAAGAGG ++ ++ ++CACTGAAGCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCAGGCACGT ++ ++ ++TCATCAAAGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GAAAGCCGTC ++ ++ ++GTGCCTGTGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAAGAGA ++ ++ ++GCCCTCTGGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATAGGCTCTA ++ ++ ++ATGTGTGTCG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAAAAGGAAA ++ ++ ++TGTCTCTGAT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TGCCAAGAGC ++ ++ ++GTCCACTCCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCTGTCACAG ++ ++ ++CTGTTGATAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CAGACTACAA ++ ++ ++CTGTGACGCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGTGTCTGCA ++ ++ ++AGGGCTGGCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGTCATCTTC ++ ++ ++GCGGGAGGGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCACACACTT ++ ++ ++TGCAGGGATG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAATGGGTAG ++ ++ ++CAGGATATGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACTTGCCCAC ++ ++ ++TCTGTGTGGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTATCTTTGT ++ ++ ++CTGCACAAGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGGTCAATAT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CAATAAGAAC ++ ++ ++TCTGCTCTGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAATGAAGGG ++ ++ ++GACTCTAATG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTCTAGGGGC ++ ++ ++GCCTGAGGCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GACCCGTGGT ++ ++ ++CTGTTACCAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTCTGGTGTG ++ ++ ++GGACATATTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CCACTG ++ ++ ++CAGGCGGACA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CAGCCTGACA ++ ++ ++CTAAGGGAGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAAAGCTGGC ++ ++ ++GGTACAGAGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCTTTAGTTG ++ ++ ++GGTGGGGCTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAGGGCTATT ++ ++ ++GGTGGGGCTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACCAAGATGG ++ ++ ++NNNNNNNNNN ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++T ++ ++ ++CTGGAGATCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACAATGGGTG ++ ++ ++NNNNNNNNNN ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATGGCTGGCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCTGTTTTCA ++ ++ ++ATGGCTGAAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAGGGTTTTA ++ ++ ++ACGAAGCCAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTTGCCAGGG ++ ++ ++AAATAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTGAGGGAAG ++ ++ ++TGAGAGGAGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGAGAAGCAG ++ ++ ++TGTGTCCCAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GACAAAGGTC ++ ++ ++GTGAAAGTTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GAGCCACACC ++ ++ ++AGAATGGCTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCATCCTCTT ++ ++ ++CTCAGTTCTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AATAAACTGC ++ ++ ++GTTGCAGTCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATAAATAAGC ++ ++ ++CTGCTGTCTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CCCTGAGGCC ++ ++ ++AGTAAATGTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CCTTTTTCCT ++ ++ ++ATGGTCCTTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AACGGTAAGG ++ ++ ++CTGCCATGTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGCAGG ++ ++ ++TGAGAAAACC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GAGGAACTGG ++ ++ ++AAAAGCTCCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GAGTGCTCAA ++ ++ ++GAGGCCAGCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTTTTCATCA ++ ++ ++ACTGGAGCCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGGCCAGAGA ++ ++ ++TAGGAAGTTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTNNNNNNNN ++ ++ ++TTGTAGGCAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGGACAACGG ++ ++ ++CCAGAACTTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GACCTGGGAG ++ ++ ++AAAGAGGTGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CAGGAGCGGA ++ ++ ++GTAGCTAATC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACCTAAGAAA ++ ++ ++TCTGCAACAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TGCTCCTGCC ++ ++ ++GTGGTGCTCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGGAGAAGGA ++ ++ ++CGTGGTCAGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GATATCTGG ++ ++ ++TGCAGAATGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++G ++ ++ ++GCTGTGAACG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CACTTTGGGA ++ ++ ++CTGGGAGGTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAACAGCTCC ++ ++ ++CTAAGGCAAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CCTGGACACT ++ ++ ++TAAACTCACT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACTTATCGAC ++ ++ ++GGGAGAGACC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTGCTTGTTA ++ ++ ++TGTGACTGAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATGGCTGTGC ++ ++ ++TGGTGAGGGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTTGGGTGTG ++ ++ ++CAGATAGTCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTTCTTTTCC ++ ++ ++GAACTGGACA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CAGGGTGGGG ++ ++ ++TATTTTACTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACTGAGTGAC ++ ++ ++TA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGCAATCGTC ++ ++ ++CCCTGTTTGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTGAGAGGGA ++ ++ ++XXXXXXXTCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTCTCTCCCT ++ ++ ++TAGCAGAGCG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGTTCTA ++ ++ ++CTGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCGAGCCATG ++ ++ ++TGTGTGTGCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCTCCACAGA ++ ++ ++ATGTTTATAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AACCACTTGT ++ ++ ++GGATCCTAGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGTGAGCTTT ++ ++ ++TGCTCAGCCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GAACAGTTAA ++ ++ ++CTTGAACGAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TAAGCCAAGC ++ ++ ++CTGCCCACCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCGAGCGTTC ++ ++ ++TCTGCTACTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGAGTCTCTG ++ ++ ++ATGGGGCCAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TCAGTGGAAG ++ ++ ++XXXCTTGTTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GAGGAGTAAC ++ ++ ++CTGCTAGCTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTCAGCTCGG ++ ++ ++CTGGACAGAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGAGCTAGCA ++ ++ ++GCTCGCCCTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGCTTCACTG ++ ++ ++AGGAACGTCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTCTCATCCC ++ ++ ++GGGGAGACCG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CCCAGCC ++ ++ ++ATAAGCATCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCAAAGCCTC ++ ++ ++TCTTGAAAAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TGTTGTACCT ++ ++ ++CTGAGAAACT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGAGGAGGTG ++ ++ ++CTGCCCAGGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGGCGTTGGC ++ ++ ++AGTTTCCCCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GACCCTTTCT ++ ++ ++TCTGTCCCTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CACATGTGCT ++ ++ ++TATTTGGGGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTGCCACCAC ++ ++ ++TCAGAAACCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++XXXXXXXXXX ++ ++ ++TGCCTGTGCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGTGAGATAG ++ ++ ++GGGAACCGCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATTTTGTGGT ++ ++ ++TGTTGTGTCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CCACGAGGCT ++ ++ ++CCTGCCCTGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTGAAGACTC ++ ++ ++AAAGTCCCCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATGCTAAAGA ++ ++ ++TGGAGTAGTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CCAGGCACAG ++ ++ ++ACTCTTCCTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACAAAAGGGT ++ ++ ++TGCGTTGTGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTGCTTAGCT ++ ++ ++CAGTCTGGGC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TGGGGAGGGA ++ ++ ++ATCTGGGCTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTCAGCTTTT ++ ++ ++TGCTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CAGAGGGGTG ++ ++ ++CTGCAGCTCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGCAGGGAAG ++ ++ ++CTGTTCTGCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAGTTGTCCC ++ ++ ++ACAAGAACTT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TGAAATCTAC ++ ++ ++AGGGACGGAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GACACTAAGA ++ ++ ++GTCTGTGAGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGG ++ ++ ++CTGTTTGGCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CAACTCTGGG ++ ++ ++TTTGTGGCAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGGGTGTA ++ ++ ++XXAGGAGCTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATAGTACCAC ++ ++ ++GGTGGATGAC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATAGGTGTGG ++ ++ ++TCTTGAGTTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTCAGAAGAA ++ ++ ++CCTGTACACA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CCTGGGGCC ++ ++ ++GGAGGCAAGG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTTGGGTGTG ++ ++ ++CTTGAGGCTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TAGCCTATGG ++ ++ ++TGTCTGGTAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AAGCTGCATC ++ ++ ++GTGGTCGCCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTGCCTCCTA ++ ++ ++GCACTGGGCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CAGTGAGCAA ++ ++ ++GCTGCCAGTA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GACAGTAACG ++ ++ ++CCCAGGTATG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGGAGAGAAG ++ ++ ++CTGTACATAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CAGGCATAAG ++ ++ ++GTTGCAAGCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCAAGACTTT ++ ++ ++TCCTTTAGAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATTCTGAAAG ++ ++ ++TGCAGATTTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGCCTTCAGG ++ ++ ++ATTTTTTAAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TAACACATAT ++ ++ ++ACACTGAGCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGCAGTTCTG ++ ++ ++TGCAGGGGTG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGGGAAAGCT ++ ++ ++CATTAGCTTC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GGATAGTTTG ++ ++ ++TGCCTTTCCT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTAAACTCCG ++ ++ ++TCTGTAGTAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AGTGGAGCAG ++ ++ ++AGAAATTACC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TAGCTGAACA ++ ++ ++AAAGAAATAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ACAAGTG ++ ++ ++CTCTTGGCAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTTTCCGAGT ++ ++ ++CTGCGGGACA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++AACCAAGGAC ++ ++ ++TCTGGAAGCA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GCATCAT ++ ++ ++GGATGTGTGA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GAGTCTAATC ++ ++ ++TTTGCCGTGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GAAAGGATGG ++ ++ ++GCTTATTTCC ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++TTTACTGACT ++ ++ ++ ++ ++ ++ ++ ++-923 ++203 ++-923 ++-923 ++ ++ ++-923 ++-55 ++-923 ++170 ++ ++ ++-923 ++-55 ++177 ++-923 ++ ++ ++-923 ++203 ++-923 ++-923 ++ ++ ++138 ++-923 ++-923 ++38 ++ ++ ++-923 ++-55 ++-923 ++170 ++ ++ ++-923 ++177 ++-55 ++-923 ++ ++ ++-923 ++-55 ++-923 ++170 ++ ++ ++-923 ++203 ++-923 ++-923 ++ ++ ++-923 ++-55 ++-923 ++170 ++ ++ ++-923 ++-55 ++-923 ++170 ++ ++ ++-923 ++177 ++-923 ++-62 ++ ++ ++170 ++-55 ++-923 ++-923 ++ ++ ++138 ++-923 ++45 ++-923 ++ ++ ++-923 ++-923 ++203 ++-923 ++ ++ ++170 ++-923 ++-923 ++-62 ++ ++ ++-923 ++203 ++-923 ++-923 ++ ++ ++138 ++-55 ++-923 ++-62 ++ ++ ++-923 ++203 ++-923 ++-923 ++ ++ ++196 ++-923 ++-923 ++-923 ++ ++ ++-62 ++177 ++-923 ++-923 ++ ++ ++-923 ++203 ++-923 ++-923 ++ ++ ++-923 ++-55 ++-923 ++170 ++ ++ ++170 ++-923 ++-55 ++-923 ++ ++ ++170 ++-55 ++-923 ++-923 ++ ++ ++-923 ++177 ++-923 ++-62 ++ ++ ++-923 ++-55 ++-923 ++170 ++ ++ ++-923 ++-55 ++145 ++-62 ++ ++ ++-923 ++177 ++-923 ++-62 ++ ++ ++ ++ ++ ++ ++0.000000 ++1.000000 ++0.000000 ++0.000000 ++ ++ ++0.000000 ++0.166667 ++0.000000 ++0.833333 ++ ++ ++0.000000 ++0.166667 ++0.833333 ++0.000000 ++ ++ ++0.000000 ++1.000000 ++0.000000 ++0.000000 ++ ++ ++0.666667 ++0.000000 ++0.000000 ++0.333333 ++ ++ ++0.000000 ++0.166667 ++0.000000 ++0.833333 ++ ++ ++0.000000 ++0.833333 ++0.166667 ++0.000000 ++ ++ ++0.000000 ++0.166667 ++0.000000 ++0.833333 ++ ++ ++0.000000 ++1.000000 ++0.000000 ++0.000000 ++ ++ ++0.000000 ++0.166667 ++0.000000 ++0.833333 ++ ++ ++0.000000 ++0.166667 ++0.000000 ++0.833333 ++ ++ ++0.000000 ++0.833333 ++0.000000 ++0.166667 ++ ++ ++0.833333 ++0.166667 ++0.000000 ++0.000000 ++ ++ ++0.666667 ++0.000000 ++0.333333 ++0.000000 ++ ++ ++0.000000 ++0.000000 ++1.000000 ++0.000000 ++ ++ ++0.833333 ++0.000000 ++0.000000 ++0.166667 ++ ++ ++0.000000 ++1.000000 ++0.000000 ++0.000000 ++ ++ ++0.666667 ++0.166667 ++0.000000 ++0.166667 ++ ++ ++0.000000 ++1.000000 ++0.000000 ++0.000000 ++ ++ ++1.000000 ++0.000000 ++0.000000 ++0.000000 ++ ++ ++0.166667 ++0.833333 ++0.000000 ++0.000000 ++ ++ ++0.000000 ++1.000000 ++0.000000 ++0.000000 ++ ++ ++0.000000 ++0.166667 ++0.000000 ++0.833333 ++ ++ ++0.833333 ++0.000000 ++0.166667 ++0.000000 ++ ++ ++0.833333 ++0.166667 ++0.000000 ++0.000000 ++ ++ ++0.000000 ++0.833333 ++0.000000 ++0.166667 ++ ++ ++0.000000 ++0.166667 ++0.000000 ++0.833333 ++ ++ ++0.000000 ++0.166667 ++0.666667 ++0.166667 ++ ++ ++0.000000 ++0.833333 ++0.000000 ++0.166667 ++ ++ ++ ++ ++CTGC[AT]TCTCTTCA[AG]GACACACCTAACTGC ++ ++ ++ ++CACACCCAAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++GTCTGACAAA ++ ++ ++CACACCCAAT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATCTTACTAG ++ ++ ++CACACCCTAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATCTGACAGC ++ ++ ++CACACCCAAG ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ATGTGACAGG ++ ++ ++CACACCCAAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CACAGACACT ++ ++ ++CCTCCGGTGT ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++CTTGGGACAA ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ +diff -ruN a/doc/examples/memechip_example_output_files/meme_tomtom_out/tomtom.html b/doc/examples/memechip_example_output_files/meme_tomtom_out/tomtom.html +--- a/doc/examples/memechip_example_output_files/meme_tomtom_out/tomtom.html 1970-01-01 10:00:00.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/meme_tomtom_out/tomtom.html 2014-10-07 17:18:21.000000000 +1000 +@@ -0,0 +1,3593 @@ ++ ++ ++ ++ ++ ++TOMTOM ++ ++ ++ ++ ++
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    ++
    ++

    The name of the query motif.

    ++ ++
    ++
    ++

    The alternate name of the query motif.

    ++ ++
    ++
    ++

    A link to more information about the query motif.

    ++ ++
    ++
    ++

    The motif preview. On supporting browsers this will display as a motif ++ logo, otherwise the consensus sequence will be displayed.

    ++ ++
    ++
    ++

    The number of significant matches of the query motif to a motif in ++ the target database.

    ++ ++
    ++
    ++

    Links to the first 20 matches of the query motif to a motif in the ++ target database.

    ++ ++
    ++
    ++

    The database name.

    ++ ++
    ++
    ++

    The number of motifs read from the motif database minus the number that ++ had to be discarded due to conflicting IDs.

    ++ ++
    ++
    ++

    The number of motifs that had a match with at least one of the query ++ motifs.

    ++ ++
    ++
    ++

    The summary gives information about the matched motif. Mouse over each ++ row to show further help buttons for each specific title.

    ++ ++
    ++
    ++

    The name of the matched motif.

    ++ ++
    ++
    ++

    The alternative name of the matched motif.

    ++ ++
    ++
    ++

    The database containing the matched motif.

    ++ ++
    ++
    ++

    The probability that the match occurred by random chance according to the null model.

    ++ ++
    ++
    ++

    The expected number of false positives in the matches up to this point.

    ++ ++
    ++
    ++

    The minimum False Discovery Rate required to include the match.

    ++ ++
    ++
    ++

    The number of letters that overlaped in the optimal alignment.

    ++ ++
    ++
    ++

    The offset of the query motif to the matched motif in the optimal alignment.

    ++ ++
    ++
    ++

    The orientation of the matched motif that gave the optimal alignment. ++ A value of "normal" means that the matched motif is as it appears in ++ the database otherwise the matched motif has been reverse complemented.

    ++ ++
    ++
    ++

    The image shows the alignment of the two motifs. The matched motif is ++ shown on the top and the query motif is shown on the bottom.

    ++ ++
    ++
    ++

    By clicking the link "Create custom LOGO ↧" a form to make custom logos ++ will be displayed. The download button can then be clicked to generate a motif ++ matching the selected specifications.

    ++ ++
    ++
    ++

    Two image formats, png and eps, are avaliable. The pixel based portable ++ network graphic (png) format is commonly used on the Internet and the ++ Encapsulated PostScript (eps) format is more suitable for publications ++ that might require scaling.

    ++ ++
    ++
    ++

    Toggle error bars indicating the confidence of a motif based on the ++ number of sites used in its creation.

    ++ ++
    ++
    ++

    Toggle adding pseudocounts for Small Sample ++ Correction.

    ++ ++
    ++
    ++

    Toggle a full reverse complement of the alignment.

    ++ ++
    ++
    ++

    Specify the width of the generated logo.

    ++ ++
    ++
    ++

    Specify the height of the generated logo.

    ++ ++
    ++
    ++

    ++ ++
    ++
    ++

    ++ ++
    ++
    ++ ++

    ++ For further information on how to interpret these results or to get a ++ copy of the MEME software please access ++ http://meme.nbcr.net. ++

    ++

    If you use TOMTOM in your research, please cite the following paper:
    ++ Shobhit Gupta, JA Stamatoyannopolous, Timothy Bailey and William Stafford Noble, ++ "Quantifying similarity between motifs", ++ Genome Biology, 8(2):R24, 2007. ++ [full text]

    ++
    ++ ++ ++ ++ ++

    Query Motifs

    ++Next Top ++
    ++ ++ ++ ++ ++

    Target Databases

    ++Previous Next Top ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++

    Database 
    ++

    Number of Motifs 
    ++

    Motifs Matched 
    ++

    JASPAR_CORE_2009.meme4768
    ++ ++ ++ ++

    Matches to Query: 1 (MEME) ++

    ++Previous Next Top ++
    ++
    ++++++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    ++

    Summary 
    ++

    ++

    Alignment 
    ++

    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Name 
    ++
    MA0039.2
    Alt. Name 
    ++
    Klf4
    Database 
    ++
    JASPAR_CORE_2009.meme
    ++p-value 
    ++
    2.48357e-07
    ++E-value 
    ++
    0.000118218
    ++q-value 
    ++
    0.000236126
    Overlap 
    ++
    10
    Offset 
    ++
    -2
    Orientation 
    ++
    Reverse Complement
    Create custom LOGO ↧ [Next Match] [Query Top]
    ++

    Summary 
    ++

    ++

    Alignment 
    ++

    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Name 
    ++
    MA0333.1
    Alt. Name 
    ++
    MET31
    Database 
    ++
    JASPAR_CORE_2009.meme
    ++p-value 
    ++
    0.00132912
    ++E-value 
    ++
    0.63266
    ++q-value 
    ++
    0.631832
    Overlap 
    ++
    9
    Offset 
    ++
    -1
    Orientation 
    ++
    Reverse Complement
    Create custom LOGO ↧[Previous Match] [Query Top]
    ++ ++ ++ ++

    Matches to Query: 2 (MEME) ++

    ++Previous Next Top ++
    ++
    ++++++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    ++

    Summary 
    ++

    ++

    Alignment 
    ++

    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Name 
    ++
    MA0035.2
    Alt. Name 
    ++
    Gata1
    Database 
    ++
    JASPAR_CORE_2009.meme
    ++p-value 
    ++
    3.53758e-09
    ++E-value 
    ++
    1.68389e-06
    ++q-value 
    ++
    3.35626e-06
    Overlap 
    ++
    8
    Offset 
    ++
    1
    Orientation 
    ++
    Normal
    Create custom LOGO ↧ [Next Match] [Query Top]
    ++

    Summary 
    ++

    ++

    Alignment 
    ++

    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Name 
    ++
    MA0140.1
    Alt. Name 
    ++
    Tal1::Gata1
    Database 
    ++
    JASPAR_CORE_2009.meme
    ++p-value 
    ++
    9.72835e-09
    ++E-value 
    ++
    4.63069e-06
    ++q-value 
    ++
    4.61485e-06
    Overlap 
    ++
    8
    Offset 
    ++
    10
    Orientation 
    ++
    Normal
    Create custom LOGO ↧[Previous Match] [Next Match] [Query Top]
    ++

    Summary 
    ++

    ++

    Alignment 
    ++

    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Name 
    ++
    MA0300.1
    Alt. Name 
    ++
    GAT1
    Database 
    ++
    JASPAR_CORE_2009.meme
    ++p-value 
    ++
    0.000193941
    ++E-value 
    ++
    0.0923161
    ++q-value 
    ++
    0.0613336
    Overlap 
    ++
    8
    Offset 
    ++
    0
    Orientation 
    ++
    Normal
    Create custom LOGO ↧[Previous Match] [Next Match] [Query Top]
    ++

    Summary 
    ++

    ++

    Alignment 
    ++

    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Name 
    ++
    MA0307.1
    Alt. Name 
    ++
    GLN3
    Database 
    ++
    JASPAR_CORE_2009.meme
    ++p-value 
    ++
    0.000749289
    ++E-value 
    ++
    0.356662
    ++q-value 
    ++
    0.177721
    Overlap 
    ++
    5
    Offset 
    ++
    -2
    Orientation 
    ++
    Normal
    Create custom LOGO ↧[Previous Match] [Next Match] [Query Top]
    ++

    Summary 
    ++

    ++

    Alignment 
    ++

    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Name 
    ++
    MA0309.1
    Alt. Name 
    ++
    GZF3
    Database 
    ++
    JASPAR_CORE_2009.meme
    ++p-value 
    ++
    0.00153681
    ++E-value 
    ++
    0.731523
    ++q-value 
    ++
    0.267074
    Overlap 
    ++
    7
    Offset 
    ++
    -1
    Orientation 
    ++
    Normal
    Create custom LOGO ↧[Previous Match] [Next Match] [Query Top]
    ++

    Summary 
    ++

    ++

    Alignment 
    ++

    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Name 
    ++
    MA0439.1
    Alt. Name 
    ++
    YRR1
    Database 
    ++
    JASPAR_CORE_2009.meme
    ++p-value 
    ++
    0.00168902
    ++E-value 
    ++
    0.803973
    ++q-value 
    ++
    0.267074
    Overlap 
    ++
    8
    Offset 
    ++
    3
    Orientation 
    ++
    Reverse Complement
    Create custom LOGO ↧[Previous Match] [Query Top]
    ++ ++ ++ ++

    Matches to Query: 3 (MEME) ++

    ++Previous Next Top ++
    ++
    ++++++
    ++
    ++ ++
    ++
    TOMTOM version
    4.10.0 (Release date: Wed May 21 10:35:36 2014 +1000) ++
    ++
    ++
    Reference
    ++ ++ Shobhit Gupta, JA Stamatoyannopolous, Timothy Bailey and William Stafford Noble, ++ "Quantifying similarity between motifs", ++ Genome Biology, 8(2):R24, 2007. ++ ++
    ++
    ++
    Command line summary
    ++
    Background letter frequencies (from memechip_example_output_files/background):
    A: 0.256   C: 0.244   G: 0.244   T: 0.256
    ++
    Result calculation took 18.581 seconds
    ++
    ++show model parameters... ++ ++
    ++




















































    ++ ++ +diff -ruN a/doc/examples/memechip_example_output_files/meme_tomtom_out/tomtom.txt b/doc/examples/memechip_example_output_files/meme_tomtom_out/tomtom.txt +--- a/doc/examples/memechip_example_output_files/meme_tomtom_out/tomtom.txt 1970-01-01 10:00:00.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/meme_tomtom_out/tomtom.txt 2014-10-07 17:18:21.000000000 +1000 +@@ -0,0 +1,9 @@ ++#Query ID Target ID Optimal offset p-value E-value q-value Overlap Query consensus Target consensus Orientation ++1 MA0039.2 -2 2.48357e-07 0.000118218 0.000236126 10 CAGCCACACCCA GCCCCACCCA - ++1 MA0333.1 -1 0.00132912 0.63266 0.631832 9 CAGCCACACCCA CGCCACACT - ++2 MA0035.2 1 3.53758e-09 1.68389e-06 3.35626e-06 8 CAGATAAG ACAGATAAGAA + ++2 MA0140.1 10 9.72835e-09 4.63069e-06 4.61485e-06 8 CAGATAAG CTGGTGGGGACAGATAAG + ++2 MA0300.1 0 0.000193941 0.0923161 0.0613336 8 CAGATAAG CCGATAAG + ++2 MA0307.1 -2 0.000749289 0.356662 0.177721 5 CAGATAAG GATAA + ++2 MA0309.1 -1 0.00153681 0.731523 0.267074 7 CAGATAAG TGATAAGA + ++2 MA0439.1 3 0.00168902 0.803973 0.267074 8 CAGATAAG GCGGAGATAAG - +diff -ruN a/doc/examples/memechip_example_output_files/meme_tomtom_out/tomtom.xml b/doc/examples/memechip_example_output_files/meme_tomtom_out/tomtom.xml +--- a/doc/examples/memechip_example_output_files/meme_tomtom_out/tomtom.xml 1970-01-01 10:00:00.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/meme_tomtom_out/tomtom.xml 2014-10-07 17:18:21.000000000 +1000 +@@ -0,0 +1,224 @@ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++]> ++ ++ ++ tomtom -verbosity 1 -oc memechip_example_output_files/meme_tomtom_out -min-overlap 5 -dist pearson -evalue -thresh 1 -no-ssc -bfile memechip_example_output_files/background memechip_example_output_files/meme_out/meme.xml JASPAR_CORE_2009.meme ++ ++ 1 ++ ++ IMB12-010665 ++ Tue Oct 7 17:18:03 2014 ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ +diff -ruN a/doc/examples/memechip_example_output_files/motif_alignment.txt b/doc/examples/memechip_example_output_files/motif_alignment.txt +--- a/doc/examples/memechip_example_output_files/motif_alignment.txt 2014-05-13 08:34:33.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/motif_alignment.txt 2014-10-07 17:18:24.000000000 +1000 +@@ -1,144 +1,184 @@ + #Query ID Target ID Optimal offset p-value E-value q-value Overlap Query consensus Target consensus Orientation +-0 0 0 2.47962e-14 5.70313e-13 1.14063e-12 10 TGGGTGGGGC TGGGTGGGGC + +-0 1 -1 3.0266e-06 6.96119e-05 6.96119e-05 6 TGGGTGGGGC GGGTGT + +-0 16 0 0.000712543 0.0163885 0.0109257 10 TGGGTGGGGC GGGGCGGGGT + +-0 17 -2 0.00220449 0.0507034 0.0227714 8 TGGGTGGGGC AGTGTGGCG + +-0 10 0 0.00282373 0.0649459 0.0227714 9 TGGGTGGGGC GGGGCGTGA + +-0 19 4 0.00297018 0.0683142 0.0227714 10 TGGGTGGGGC TAAAAAAGTGGGGT - +-0 13 2 0.00981676 0.225785 0.0645101 8 TGGGTGGGGC AGGGGGCGGA + +-0 8 0 0.0114207 0.262676 0.065669 8 TGGGTGGGGC GGGGTGTG - +-0 15 -4 0.0172201 0.396062 0.0880137 6 TGGGTGGGGC TGTGGCG - +-1 1 0 3.03913e-08 6.99e-07 1.398e-06 6 GGGTGT GGGTGT + +-1 0 1 8.04348e-06 0.000185 0.000185 6 GGGTGT TGGGTGGGGC + +-1 8 1 0.000605543 0.0139275 0.009285 6 GGGTGT GGGGTGTG - +-1 10 1 0.0044328 0.101955 0.0509773 6 GGGTGT GGGGCGTGA + +-1 13 3 0.00597897 0.137516 0.0550066 6 GGGTGT AGGGGGCGGA + +-2 2 0 6.56412e-33 1.50975e-31 3.01949e-31 18 CTGGTGGGGACAGATAAG CTGGTGGGGACAGATAAG + +-2 4 -9 2.49216e-05 0.000573197 0.000573197 9 CTGGTGGGGACAGATAAG ACAGATAAGAA + +-2 3 -11 4.38914e-05 0.0010095 0.000673001 6 CTGGTGGGGACAGATAAG AGATAA - +-2 5 -10 0.000207679 0.00477662 0.00238831 8 CTGGTGGGGACAGATAAG CCGATAAG + +-2 9 -12 0.000290203 0.00667466 0.00266986 5 CTGGTGGGGACAGATAAG GATAA + +-2 7 -11 0.000949454 0.0218374 0.00727915 7 CTGGTGGGGACAGATAAG CGATAAG + +-2 6 -11 0.00137658 0.0316613 0.00904608 7 CTGGTGGGGACAGATAAG TGATAAGA + +-2 11 -11 0.00232081 0.0533787 0.0133447 6 CTGGTGGGGACAGATAAG AGATAG + +-2 18 -11 0.00705725 0.162317 0.0360704 5 CTGGTGGGGACAGATAAG AGAAA + +-2 12 -11 0.00876069 0.201496 0.0402992 5 CTGGTGGGGACAGATAAG TGATA + +-3 3 0 4.21216e-07 9.68798e-06 1.9376e-05 6 TTATCT TTATCT + +-3 4 3 1.11316e-05 0.000256026 0.000256026 6 TTATCT TTCTTATCTGT - +-3 2 1 2.41182e-05 0.000554719 0.000369813 6 TTATCT CTTATCTGTCCCCACCAG - +-3 9 0 0.000366635 0.0084326 0.0042163 5 TTATCT TTATC - +-3 11 0 0.00113821 0.0261789 0.0093134 6 TTATCT CTATCT - +-3 6 2 0.00121479 0.0279402 0.0093134 6 TTATCT TCTTATCA - +-3 5 1 0.00168377 0.0387268 0.0110648 6 TTATCT CTTATCGG - +-3 12 -1 0.00352318 0.0810331 0.0188682 5 TTATCT TATCA - +-3 7 1 0.0036916 0.0849068 0.0188682 6 TTATCT CTTATCG - +-3 18 -1 0.00686758 0.157954 0.0315909 5 TTATCT TTTCT - +-3 21 0 0.00813422 0.187087 0.0340158 6 TTATCT CTATCA + +-3 20 0 0.0143365 0.329739 0.0549565 6 TTATCT GTATCA - +-4 4 0 2.68111e-18 6.16655e-17 1.23331e-16 11 ACAGATAAGAA ACAGATAAGAA + +-4 2 9 1.49363e-05 0.000343535 0.000343535 9 ACAGATAAGAA CTGGTGGGGACAGATAAG + +-4 3 -2 2.47647e-05 0.000569588 0.000379725 6 ACAGATAAGAA AGATAA - +-4 6 -2 0.000202322 0.00465341 0.00202979 8 ACAGATAAGAA TGATAAGA + +-4 9 -3 0.000220629 0.00507448 0.00202979 5 ACAGATAAGAA GATAA + +-4 5 -1 0.000316847 0.00728749 0.00242916 8 ACAGATAAGAA CCGATAAG + +-4 7 -2 0.00118586 0.0272748 0.0077928 7 ACAGATAAGAA CGATAAG + +-4 11 -2 0.002827 0.065021 0.0162553 6 ACAGATAAGAA AGATAG + +-4 18 -2 0.00693806 0.159575 0.0354612 5 ACAGATAAGAA AGAAA + +-4 12 -2 0.0102534 0.235827 0.0471655 5 ACAGATAAGAA TGATA + +-5 5 0 1.52268e-09 3.50216e-08 7.00433e-08 8 CCGATAAG CCGATAAG + +-5 7 -1 3.64893e-06 8.39255e-05 8.39255e-05 7 CCGATAAG CGATAAG + +-5 6 -1 7.48688e-05 0.00172198 0.00114799 7 CCGATAAG TGATAAGA + +-5 4 1 0.000453283 0.0104255 0.00521276 8 CCGATAAG ACAGATAAGAA + +-5 9 -2 0.00059009 0.0135721 0.00542883 5 CCGATAAG GATAA + +-5 2 10 0.0012207 0.0280761 0.00935869 8 CCGATAAG CTGGTGGGGACAGATAAG + +-5 3 -1 0.00220901 0.0508072 0.0145164 6 CCGATAAG AGATAA - +-5 12 -1 0.00371142 0.0853628 0.0213407 5 CCGATAAG TGATA + +-5 11 -1 0.0162115 0.372865 0.0828589 6 CCGATAAG AGATAG + +-6 6 0 4.30218e-11 9.89502e-10 1.979e-09 8 TGATAAGA TGATAAGA + +-6 7 0 2.71912e-05 0.000625399 0.000578988 7 TGATAAGA CGATAAG + +-6 5 1 3.77601e-05 0.000868481 0.000578988 7 TGATAAGA CCGATAAG + +-6 4 2 0.000224141 0.00515523 0.00257762 8 TGATAAGA ACAGATAAGAA + +-6 9 -1 0.000514692 0.0118379 0.00473517 5 TGATAAGA GATAA + +-6 3 0 0.000880736 0.0202569 0.00675231 6 TGATAAGA AGATAA - +-6 12 0 0.00115892 0.0266552 0.00761576 5 TGATAAGA TGATA + +-6 2 11 0.00660393 0.15189 0.0379726 7 TGATAAGA CTGGTGGGGACAGATAAG + +-6 11 0 0.0108952 0.25059 0.0556866 6 TGATAAGA AGATAG + +-6 21 0 0.0156824 0.360696 0.0721391 6 TGATAAGA TGATAG - +-6 20 0 0.0200528 0.461215 0.0838573 6 TGATAAGA TGATAC + +-7 7 0 8.48315e-09 1.95112e-07 3.90225e-07 7 CGATAAG CGATAAG + +-7 5 1 3.71731e-05 0.000854981 0.000854981 7 CGATAAG CCGATAAG + +-7 6 0 8.87614e-05 0.00204151 0.00136101 7 CGATAAG TGATAAGA + +-7 9 -1 0.000745079 0.0171368 0.00856841 5 CGATAAG GATAA + +-7 4 2 0.00335818 0.0772382 0.0308953 7 CGATAAG ACAGATAAGAA + +-7 3 0 0.00488788 0.112421 0.0374738 6 CGATAAG AGATAA - +-7 12 0 0.00749341 0.172349 0.0441618 5 CGATAAG TGATA + +-7 2 11 0.00768031 0.176647 0.0441618 7 CGATAAG CTGGTGGGGACAGATAAG + +-7 14 0 0.0167041 0.384195 0.0853766 5 CGATAAG GGATA + +-8 8 0 3.25352e-10 7.48309e-09 1.49662e-08 8 CACACCCC CACACCCC + +-8 1 -1 0.000595519 0.0136969 0.0136969 6 CACACCCC ACACCC - +-8 10 1 0.00308791 0.0710218 0.0473479 8 CACACCCC TCACGCCCC - +-9 9 0 6.99981e-07 1.60996e-05 3.21991e-05 5 GATAA GATAA + +-9 3 1 0.000269565 0.0062 0.00453658 5 GATAA AGATAA - +-9 4 3 0.000295908 0.00680588 0.00453658 5 GATAA ACAGATAAGAA + +-9 7 1 0.000404321 0.00929938 0.00453658 5 GATAA CGATAAG + +-9 5 2 0.000539058 0.0123983 0.00453658 5 GATAA CCGATAAG + +-9 2 12 0.000591728 0.0136098 0.00453658 5 GATAA CTGGTGGGGACAGATAAG + +-9 6 1 0.00116766 0.0268562 0.0076732 5 GATAA TGATAAGA + +-9 11 1 0.00263029 0.0604967 0.0151242 5 GATAA AGATAG + +-9 12 1 0.00445425 0.102448 0.0227662 4 GATAA TGATA + +-9 21 1 0.00541563 0.124559 0.0249119 5 GATAA TGATAG - +-9 14 1 0.00822288 0.189126 0.0343866 4 GATAA GGATA + +-10 10 0 4.59583e-10 1.05704e-08 2.11408e-08 9 GGGGCGTGA GGGGCGTGA + +-10 16 0 0.00143352 0.0329709 0.0329709 9 GGGGCGTGA GGGGCGGGGT + +-10 13 2 0.00281516 0.0647486 0.0341572 8 GGGGCGTGA AGGGGGCGGA + +-10 0 0 0.00297019 0.0683144 0.0341572 9 GGGGCGTGA TGGGTGGGGC + +-10 8 0 0.00426504 0.0980959 0.0392384 8 GGGGCGTGA GGGGTGTG - +-10 1 -1 0.00545697 0.12551 0.0418368 6 GGGGCGTGA GGGTGT + +-11 11 0 1.11202e-09 2.55765e-08 5.1153e-08 6 AGATAG AGATAG + +-11 21 0 0.000298819 0.00687285 0.00687285 6 AGATAG TGATAG - +-11 3 0 0.00136916 0.0314907 0.0209938 6 AGATAG AGATAA - +-11 9 -1 0.00190857 0.0438971 0.0219485 5 AGATAG GATAA + +-11 12 0 0.0042092 0.0968117 0.034601 5 AGATAG TGATA + +-11 4 2 0.00451317 0.103803 0.034601 6 AGATAG ACAGATAAGAA + +-11 2 11 0.00912497 0.209874 0.0599641 6 AGATAG CTGGTGGGGACAGATAAG + +-11 18 0 0.0113817 0.26178 0.0639918 5 AGATAG AGAAA + +-11 5 1 0.0125201 0.287963 0.0639918 6 AGATAG CCGATAAG + +-11 6 0 0.0142098 0.326825 0.065365 6 AGATAG TGATAAGA + +-12 12 0 1.2333e-06 2.83659e-05 5.67318e-05 5 TGATA TGATA + +-12 21 0 0.000110221 0.00253507 0.00253507 5 TGATA TGATAG - +-12 20 0 0.00133148 0.030624 0.020416 5 TGATA TGATAC + +-12 6 0 0.00226142 0.0520126 0.0251279 5 TGATA TGATAAGA + +-12 3 0 0.00318205 0.0731872 0.0251279 5 TGATA AGATAA - +-12 5 1 0.00327755 0.0753836 0.0251279 5 TGATA CCGATAAG + +-12 11 0 0.00389591 0.089606 0.0256017 5 TGATA AGATAG + +-12 9 -1 0.00520043 0.11961 0.0299025 4 TGATA GATAA + +-12 7 0 0.00750697 0.17266 0.038369 5 TGATA CGATAAG + +-12 4 2 0.020234 0.465383 0.0930765 5 TGATA ACAGATAAGAA + +-13 13 0 5.34248e-16 1.22877e-14 2.45754e-14 10 AGGGGGCGGA AGGGGGCGGA + +-13 16 -2 0.00148612 0.0341809 0.0269454 8 AGGGGGCGGA GGGGCGGGGT + +-13 10 -2 0.00175731 0.0404181 0.0269454 8 AGGGGGCGGA GGGGCGTGA + +-13 1 -3 0.00521055 0.119843 0.0599214 6 AGGGGGCGGA GGGTGT + +-13 0 -2 0.00752755 0.173134 0.0692534 8 AGGGGGCGGA TGGGTGGGGC + +-14 14 0 6.55517e-08 1.50769e-06 3.01538e-06 5 GGATA GGATA + +-15 15 0 3.68753e-08 8.48133e-07 1.69627e-06 7 CGCCACA CGCCACA + +-15 17 0 3.40477e-06 7.83097e-05 7.83097e-05 7 CGCCACA CGCCACACT - +-16 16 0 2.58037e-16 5.93484e-15 1.18697e-14 10 GGGGCGGGGT GGGGCGGGGT + +-16 0 0 0.000743826 0.017108 0.017108 10 GGGGCGGGGT TGGGTGGGGC + +-16 10 0 0.00124499 0.0286349 0.0190899 9 GGGGCGGGGT GGGGCGTGA + +-16 13 2 0.00223279 0.0513543 0.0256771 8 GGGGCGGGGT AGGGGGCGGA + +-17 17 0 1.3973e-12 3.21379e-11 6.42758e-11 9 AGTGTGGCG AGTGTGGCG + +-17 15 -2 9.18342e-06 0.000211219 0.000211219 7 AGTGTGGCG TGTGGCG - +-17 0 2 0.00208284 0.0479053 0.0319369 8 AGTGTGGCG TGGGTGGGGC + +-18 18 0 1.63329e-06 3.75656e-05 7.51312e-05 5 AGAAA AGAAA + +-19 19 0 4.92523e-25 1.1328e-23 2.2656e-23 14 ACCCCACTTTTTTA ACCCCACTTTTTTA + +-19 0 0 0.00115493 0.0265633 0.0265633 10 ACCCCACTTTTTTA GCCCCACCCA - +-20 20 0 2.40789e-07 5.53814e-06 1.10763e-05 6 TGATAC TGATAC + +-20 12 0 0.000577456 0.0132815 0.0132815 5 TGATAC TGATA + +-20 21 0 0.00408786 0.0940207 0.0626805 6 TGATAC TGATAG - +-21 21 0 1.15834e-05 0.000266419 0.000532837 6 CTATCA CTATCA + +-21 12 -1 0.000255743 0.00588209 0.00588209 5 CTATCA TATCA - +-21 11 0 0.000518913 0.011935 0.00795667 6 CTATCA CTATCT - +-21 20 0 0.00595571 0.136981 0.0563068 6 CTATCA GTATCA - +-21 9 0 0.00612031 0.140767 0.0563068 5 CTATCA TTATC - +-21 3 0 0.010138 0.233175 0.0777249 6 CTATCA TTATCT + +-22 22 0 1.08164e-23 2.48776e-22 4.97552e-22 11 AAGTAGTGTTC AAGTAGTGTTC + ++0 0 0 6.11542e-19 1.59001e-17 3.18002e-17 12 CAGCCACACCCA CAGCCACACCCA + ++0 1 -2 8.73729e-08 2.2717e-06 2.2717e-06 10 CAGCCACACCCA GCCCCACCCA - ++0 2 -5 1.06593e-05 0.000277142 0.000184761 6 CAGCCACACCCA ACACCC - ++0 10 -4 0.00321747 0.0836542 0.0349067 8 CAGCCACACCCA CACACCCC + ++0 20 -1 0.00335641 0.0872667 0.0349067 9 CAGCCACACCCA CGCCACACT - ++0 19 -2 0.00895119 0.232731 0.0622372 10 CAGCCACACCCA ACCCCGCCCC - ++0 18 -1 0.00923818 0.240193 0.0622372 7 CAGCCACACCCA CGCCACA + ++0 12 -3 0.00957495 0.248949 0.0622372 9 CAGCCACACCCA TCACGCCCC - ++0 15 12 0.0124124 0.322721 0.0663299 12 CAGCCACACCCA CTGCATCTCTTCAAGACACACCTAACTGC + ++0 25 -1 0.0127558 0.33165 0.0663299 11 CAGCCACACCCA GAACACTACTT - ++0 22 -2 0.0162587 0.422727 0.0768594 10 CAGCCACACCCA ACCCCACTTTTTTA + ++1 1 0 3.89427e-14 1.01251e-12 2.02502e-12 10 TGGGTGGGGC TGGGTGGGGC + ++1 0 0 1.50231e-08 3.906e-07 3.906e-07 10 TGGGTGGGGC TGGGTGTGGCTG - ++1 2 -1 2.36231e-06 6.14202e-05 4.09468e-05 6 TGGGTGGGGC GGGTGT + ++1 19 0 0.00066618 0.0173207 0.00866034 10 TGGGTGGGGC GGGGCGGGGT + ++1 20 -2 0.0019953 0.0518778 0.0207511 8 TGGGTGGGGC AGTGTGGCG + ++1 12 0 0.00296975 0.0772136 0.0232022 9 TGGGTGGGGC GGGGCGTGA + ++1 22 4 0.00312337 0.0812077 0.0232022 10 TGGGTGGGGC TAAAAAAGTGGGGT - ++1 16 2 0.0105415 0.27408 0.06852 8 TGGGTGGGGC AGGGGGCGGA + ++1 10 0 0.0120987 0.314567 0.0699037 8 TGGGTGGGGC GGGGTGTG - ++1 18 -4 0.0156194 0.406105 0.081221 6 TGGGTGGGGC TGTGGCG - ++2 2 0 2.2804e-08 5.92903e-07 1.18581e-06 6 GGGTGT GGGTGT + ++2 0 1 4.19566e-06 0.000109087 0.000109087 6 GGGTGT TGGGTGTGGCTG - ++2 1 1 9.0242e-06 0.000234629 0.000156419 6 GGGTGT TGGGTGGGGC + ++2 10 1 0.000683482 0.0177705 0.00888527 6 GGGTGT GGGGTGTG - ++2 12 1 0.00449063 0.116756 0.0467026 6 GGGTGT GGGGCGTGA + ++2 16 3 0.00602561 0.156666 0.0522219 6 GGGTGT AGGGGGCGGA + ++3 3 0 1.75041e-32 4.55107e-31 9.10215e-31 18 CTGGTGGGGACAGATAAG CTGGTGGGGACAGATAAG + ++3 4 -10 1.23323e-08 3.2064e-07 3.2064e-07 8 CTGGTGGGGACAGATAAG CAGATAAG + ++3 6 -9 2.98991e-05 0.000777375 0.000427733 9 CTGGTGGGGACAGATAAG ACAGATAAGAA + ++3 5 -11 3.29026e-05 0.000855466 0.000427733 6 CTGGTGGGGACAGATAAG AGATAA - ++3 7 -10 0.000259478 0.00674642 0.00269857 8 CTGGTGGGGACAGATAAG CCGATAAG + ++3 11 -12 0.000327148 0.00850585 0.00283528 5 CTGGTGGGGACAGATAAG GATAA + ++3 9 -11 0.000992882 0.0258149 0.00737569 7 CTGGTGGGGACAGATAAG CGATAAG + ++3 8 -11 0.00162683 0.0422975 0.0105744 7 CTGGTGGGGACAGATAAG TGATAAGA + ++3 13 -11 0.00232335 0.0604072 0.0134238 6 CTGGTGGGGACAGATAAG AGATAG + ++3 21 -11 0.00711477 0.184984 0.0369968 5 CTGGTGGGGACAGATAAG AGAAA + ++3 14 -11 0.00875087 0.227523 0.0413677 5 CTGGTGGGGACAGATAAG TGATA + ++4 4 0 5.80191e-12 1.5085e-10 3.017e-10 8 CAGATAAG CAGATAAG + ++4 6 1 1.04273e-09 2.71109e-08 2.71109e-08 8 CAGATAAG ACAGATAAGAA + ++4 3 10 8.90822e-09 2.31614e-07 1.54409e-07 8 CAGATAAG CTGGTGGGGACAGATAAG + ++4 5 -1 4.41881e-07 1.14889e-05 5.74446e-06 6 CAGATAAG AGATAA - ++4 7 0 0.000138828 0.00360953 0.00144381 8 CAGATAAG CCGATAAG + ++4 11 -2 0.000416822 0.0108374 0.00361245 5 CAGATAAG GATAA + ++4 8 -1 0.000515277 0.0133972 0.00382777 7 CAGATAAG TGATAAGA + ++4 9 -1 0.000914704 0.0237823 0.00594558 7 CAGATAAG CGATAAG + ++4 13 -1 0.00219144 0.0569776 0.0126617 6 CAGATAAG AGATAG + ++4 14 -1 0.00548732 0.14267 0.0285341 5 CAGATAAG TGATA + ++4 21 -1 0.00953818 0.247993 0.0450896 5 CAGATAAG AGAAA + ++4 24 -1 0.0161684 0.420379 0.0700632 6 CAGATAAG TGATAG - ++5 5 0 1.96751e-07 5.11552e-06 1.0231e-05 6 TTATCT TTATCT + ++5 4 1 5.90253e-07 1.53466e-05 1.53466e-05 6 TTATCT CTTATCTG - ++5 6 3 1.73346e-05 0.0004507 0.000263512 6 TTATCT TTCTTATCTGT - ++5 3 1 2.02701e-05 0.000527024 0.000263512 6 TTATCT CTTATCTGTCCCCACCAG - ++5 11 0 0.000418249 0.0108745 0.00434979 5 TTATCT TTATC - ++5 13 0 0.00122098 0.0317455 0.00995727 6 TTATCT CTATCT - ++5 8 2 0.0013404 0.0348505 0.00995727 6 TTATCT TCTTATCA - ++5 7 1 0.00183342 0.047669 0.0119172 6 TTATCT CTTATCGG - ++5 14 -1 0.00373257 0.0970469 0.0205532 5 TTATCT TATCA - ++5 9 1 0.00395254 0.102766 0.0205532 6 TTATCT CTTATCG - ++5 21 -1 0.00708829 0.184296 0.0335083 5 TTATCT TTTCT - ++5 24 0 0.0086155 0.224003 0.0373338 6 TTATCT CTATCA + ++5 23 0 0.0150575 0.391496 0.0602301 6 TTATCT GTATCA - ++6 6 0 1.55742e-18 4.04929e-17 8.09858e-17 11 ACAGATAAGAA ACAGATAAGAA + ++6 4 -1 1.77034e-08 4.6029e-07 4.6029e-07 8 ACAGATAAGAA CAGATAAG + ++6 3 9 1.5011e-05 0.000390285 0.00026019 9 ACAGATAAGAA CTGGTGGGGACAGATAAG + ++6 5 -2 3.92294e-05 0.00101996 0.000509982 6 ACAGATAAGAA AGATAA - ++6 8 -2 0.000213675 0.00555554 0.00222222 8 ACAGATAAGAA TGATAAGA + ++6 11 -3 0.000257135 0.00668551 0.0022285 5 ACAGATAAGAA GATAA + ++6 7 -1 0.000303049 0.00787927 0.00225122 8 ACAGATAAGAA CCGATAAG + ++6 9 -2 0.00121583 0.0316116 0.00790289 7 ACAGATAAGAA CGATAAG + ++6 13 -2 0.0030715 0.079859 0.0177465 6 ACAGATAAGAA AGATAG + ++6 21 -2 0.00742718 0.193107 0.0386213 5 ACAGATAAGAA AGAAA + ++6 14 -2 0.0108656 0.282506 0.0513648 5 ACAGATAAGAA TGATA + ++7 7 0 2.86751e-10 7.45553e-09 1.49111e-08 8 CCGATAAG CCGATAAG + ++7 9 -1 3.80128e-06 9.88333e-05 9.88333e-05 7 CCGATAAG CGATAAG + ++7 8 -1 8.12312e-05 0.00211201 0.00140801 7 CCGATAAG TGATAAGA + ++7 4 0 0.000184326 0.00479247 0.00239623 8 CCGATAAG CAGATAAG + ++7 6 1 0.000489834 0.0127357 0.00509427 8 CCGATAAG ACAGATAAGAA + ++7 11 -2 0.000663498 0.0172509 0.00575032 5 CCGATAAG GATAA + ++7 3 10 0.00131947 0.0343061 0.00980174 8 CCGATAAG CTGGTGGGGACAGATAAG + ++7 5 -1 0.00231158 0.0601012 0.0150253 6 CCGATAAG AGATAA - ++7 14 -1 0.00391816 0.101872 0.0226382 5 CCGATAAG TGATA + ++7 13 -1 0.0168059 0.436953 0.0873907 6 CCGATAAG AGATAG + ++8 8 0 9.49404e-13 2.46845e-11 4.9369e-11 8 TGATAAGA TGATAAGA + ++8 9 0 4.01757e-05 0.00104457 0.000761362 7 TGATAAGA CGATAAG + ++8 7 1 4.39247e-05 0.00114204 0.000761362 7 TGATAAGA CCGATAAG + ++8 6 2 0.000255406 0.00664056 0.00332028 8 TGATAAGA ACAGATAAGAA + ++8 11 -1 0.000494557 0.0128585 0.0051434 5 TGATAAGA GATAA + ++8 4 1 0.00082796 0.021527 0.00701691 7 TGATAAGA CAGATAAG + ++8 5 0 0.000944584 0.0245592 0.00701691 6 TGATAAGA AGATAA - ++8 14 0 0.00136048 0.0353724 0.0088431 5 TGATAAGA TGATA + ++8 3 11 0.00727323 0.189104 0.0420231 7 TGATAAGA CTGGTGGGGACAGATAAG + ++8 13 0 0.0111319 0.28943 0.057886 6 TGATAAGA AGATAG + ++8 24 0 0.014776 0.384176 0.0698501 6 TGATAAGA TGATAG - ++8 23 0 0.0207176 0.538657 0.0897762 6 TGATAAGA TGATAC + ++9 9 0 7.25658e-08 1.88671e-06 3.77342e-06 7 CGATAAG CGATAAG + ++9 7 1 3.93986e-05 0.00102436 0.00102436 7 CGATAAG CCGATAAG + ++9 8 0 0.000101575 0.00264095 0.00176063 7 CGATAAG TGATAAGA + ++9 11 -1 0.000802629 0.0208684 0.0104342 5 CGATAAG GATAA + ++9 4 1 0.00240956 0.0626485 0.0250594 7 CGATAAG CAGATAAG + ++9 6 2 0.00364004 0.0946409 0.031547 7 CGATAAG ACAGATAAGAA + ++9 5 0 0.00506296 0.131637 0.0376106 6 CGATAAG AGATAA - ++9 14 0 0.00790519 0.205535 0.0480066 5 CGATAAG TGATA + ++9 3 11 0.00830884 0.21603 0.0480066 7 CGATAAG CTGGTGGGGACAGATAAG + ++9 17 0 0.0163049 0.423927 0.0847854 5 CGATAAG GGATA + ++10 10 0 6.50805e-11 1.69209e-09 3.38419e-09 8 CACACCCC CACACCCC + ++10 2 -1 0.000644154 0.016748 0.016748 6 CACACCCC ACACCC - ++10 12 1 0.0032909 0.0855634 0.0570423 8 CACACCCC TCACGCCCC - ++10 0 4 0.00534559 0.138985 0.0694927 8 CACACCCC CAGCCACACCCA + ++11 11 0 1.45134e-07 3.77349e-06 7.54698e-06 5 GATAA GATAA + ++11 5 1 0.000242924 0.00631603 0.00394798 5 GATAA AGATAA - ++11 9 1 0.000364364 0.00947346 0.00394798 5 GATAA CGATAAG + ++11 6 3 0.000449391 0.0116842 0.00394798 5 GATAA ACAGATAAGAA + ++11 4 2 0.000485789 0.0126305 0.00394798 5 GATAA CAGATAAG + ++11 7 2 0.000485789 0.0126305 0.00394798 5 GATAA CCGATAAG + ++11 3 12 0.000531458 0.0138179 0.00394798 5 GATAA CTGGTGGGGACAGATAAG + ++11 8 1 0.0012031 0.0312807 0.00782018 5 GATAA TGATAAGA + ++11 13 1 0.00276896 0.071993 0.0159984 5 GATAA AGATAG + ++11 14 1 0.00487702 0.126803 0.0253605 4 GATAA TGATA + ++11 24 1 0.00545885 0.14193 0.0258055 5 GATAA TGATAG - ++11 17 1 0.00905451 0.235417 0.0392362 4 GATAA GGATA + ++12 12 0 3.72108e-10 9.67482e-09 1.93496e-08 9 GGGGCGTGA GGGGCGTGA + ++12 19 0 0.00146257 0.0380267 0.0380267 9 GGGGCGTGA GGGGCGGGGT + ++12 16 2 0.00258503 0.0672109 0.0393803 8 GGGGCGTGA AGGGGGCGGA + ++12 1 0 0.00302926 0.0787607 0.0393803 9 GGGGCGTGA TGGGTGGGGC + ++12 10 0 0.00431364 0.112155 0.0447639 8 GGGGCGTGA GGGGTGTG - ++12 2 -1 0.00516506 0.134292 0.0447639 6 GGGGCGTGA GGGTGT + ++13 13 0 7.8308e-10 2.03601e-08 4.07202e-08 6 AGATAG AGATAG + ++13 24 0 0.000328821 0.00854934 0.00854934 6 AGATAG TGATAG - ++13 5 0 0.00147137 0.0382556 0.0248907 6 AGATAG AGATAA - ++13 11 -1 0.00191467 0.0497814 0.0248907 5 AGATAG GATAA + ++13 4 1 0.00333561 0.0867258 0.0346903 6 AGATAG CAGATAAG + ++13 14 0 0.00410688 0.106779 0.035593 5 AGATAG TGATA + ++13 6 2 0.00481848 0.125281 0.0357945 6 AGATAG ACAGATAAGAA + ++13 3 11 0.00921011 0.239463 0.0598657 6 AGATAG CTGGTGGGGACAGATAAG + ++13 21 0 0.0110066 0.286171 0.0635936 5 AGATAG AGAAA + ++13 7 1 0.0132145 0.343576 0.0687153 6 AGATAG CCGATAAG + ++13 8 0 0.0149775 0.389415 0.0708027 6 AGATAG TGATAAGA + ++14 14 0 8.1275e-06 0.000211315 0.00042263 5 TGATA TGATA + ++14 24 0 0.000112391 0.00292217 0.00292217 5 TGATA TGATAG - ++14 23 0 0.00148416 0.0385882 0.0257255 5 TGATA TGATAC + ++14 8 0 0.00255923 0.0665401 0.0292729 5 TGATA TGATAAGA + ++14 5 0 0.00323248 0.0840444 0.0292729 5 TGATA AGATAA - ++14 7 1 0.00339056 0.0881546 0.0292729 5 TGATA CCGATAAG + ++14 13 0 0.00394059 0.102455 0.0292729 5 TGATA AGATAG + ++14 11 -1 0.00546179 0.142007 0.0355016 4 TGATA GATAA + ++14 4 1 0.00700393 0.182102 0.0404671 5 TGATA CAGATAAG + ++14 9 0 0.00783239 0.203642 0.0407284 5 TGATA CGATAAG + ++14 6 2 0.0208622 0.542416 0.0986212 5 TGATA ACAGATAAGAA + ++15 15 0 2.52234e-44 6.55808e-43 1.31162e-42 29 CTGCATCTCTTCAAGACACACCTAACTGC CTGCATCTCTTCAAGACACACCTAACTGC + ++16 16 0 6.92195e-17 1.79971e-15 3.59942e-15 10 AGGGGGCGGA AGGGGGCGGA + ++16 19 -2 0.00165394 0.0430024 0.0302797 8 AGGGGGCGGA GGGGCGGGGT + ++16 12 -2 0.0017469 0.0454195 0.0302797 8 AGGGGGCGGA GGGGCGTGA + ++16 2 -3 0.0049395 0.128427 0.0642135 6 AGGGGGCGGA GGGTGT + ++16 1 -2 0.00752186 0.195568 0.0782273 8 AGGGGGCGGA TGGGTGGGGC + ++17 17 0 3.65367e-08 9.49955e-07 1.89991e-06 5 GGATA GGATA + ++18 18 0 2.49084e-08 6.47619e-07 1.29524e-06 7 CGCCACA CGCCACA + ++18 20 0 3.0396e-06 7.90296e-05 7.90296e-05 7 CGCCACA CGCCACACT - ++18 0 1 0.00307992 0.080078 0.0533853 7 CGCCACA CAGCCACACCCA + ++19 19 0 2.5063e-17 6.51638e-16 1.30328e-15 10 GGGGCGGGGT GGGGCGGGGT + ++19 1 0 0.000724472 0.0188363 0.0188363 10 GGGGCGGGGT TGGGTGGGGC + ++19 12 0 0.00116392 0.0302619 0.0201746 9 GGGGCGGGGT GGGGCGTGA + ++19 16 2 0.00215904 0.0561351 0.0280676 8 GGGGCGGGGT AGGGGGCGGA + ++20 20 0 4.84473e-12 1.25963e-10 2.51926e-10 9 AGTGTGGCG AGTGTGGCG + ++20 18 -2 1.08192e-05 0.000281298 0.000281298 7 AGTGTGGCG TGTGGCG - ++20 1 2 0.00230347 0.0598903 0.0332151 8 AGTGTGGCG TGGGTGGGGC + ++20 0 2 0.00255501 0.0664303 0.0332151 9 AGTGTGGCG TGGGTGTGGCTG - ++21 21 0 6.09563e-06 0.000158486 0.000316973 5 AGAAA AGAAA + ++22 22 0 6.03496e-26 1.56909e-24 3.13818e-24 14 ACCCCACTTTTTTA ACCCCACTTTTTTA + ++22 1 0 0.00104883 0.0272695 0.0272695 10 ACCCCACTTTTTTA GCCCCACCCA - ++22 0 2 0.00675347 0.17559 0.0905738 10 ACCCCACTTTTTTA CAGCCACACCCA + ++22 19 0 0.00696721 0.181148 0.0905738 10 ACCCCACTTTTTTA ACCCCGCCCC - ++23 23 0 1.2453e-07 3.23779e-06 6.47557e-06 6 TGATAC TGATAC + ++23 14 0 0.000601788 0.0156465 0.0156465 5 TGATAC TGATA + ++23 24 0 0.00420327 0.109285 0.0728566 6 TGATAC TGATAG - ++24 24 0 6.78789e-06 0.000176485 0.000352971 6 CTATCA CTATCA + ++24 14 -1 0.00025015 0.0065039 0.0065039 5 CTATCA TATCA - ++24 13 0 0.000541953 0.0140908 0.00939385 6 CTATCA CTATCT - ++24 11 0 0.00617593 0.160574 0.0656781 5 CTATCA TTATC - ++24 23 0 0.00631521 0.164195 0.0656781 6 CTATCA GTATCA - ++24 5 0 0.0105508 0.274321 0.0914403 6 CTATCA TTATCT + ++25 25 0 3.13495e-24 8.15087e-23 1.63017e-22 11 AAGTAGTGTTC AAGTAGTGTTC + +diff -ruN a/doc/examples/memechip_example_output_files/progress_log.txt b/doc/examples/memechip_example_output_files/progress_log.txt +--- a/doc/examples/memechip_example_output_files/progress_log.txt 2014-05-13 08:35:42.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/progress_log.txt 2014-10-07 17:19:07.000000000 +1000 +@@ -1,102 +1,90 @@ + Invoking: + fasta-get-markov -nostatus -m 1 < memechip_example_output_files/sample-dna-Klf1.fa 1> memechip_example_output_files/background + Finished invoke: +- name: bg status: 0 time: 0.01086 ++ name: bg status: 0 time: 0.015515 + Invoking: + getsize memechip_example_output_files/sample-dna-Klf1.fa 1> $metrics + Finished invoke: +- name: count_seqs status: 0 time: 0.035918 ++ name: count_seqs status: 0 time: 0.019767 + Invoking: + fasta-most -min 50 < memechip_example_output_files/sample-dna-Klf1.fa 1> $metrics + Finished invoke: +- name: most_seqs status: 0 time: 0.052292 ++ name: most_seqs status: 0 time: 0.03889 + Invoking: + fasta-center -len 100 < memechip_example_output_files/sample-dna-Klf1.fa 1> memechip_example_output_files/seqs-centered + Finished invoke: +- name: center_seqs status: 0 time: 0.040839 ++ name: center_seqs status: 0 time: 0.026273 + Invoking: + fasta-dinucleotide-shuffle -f memechip_example_output_files/seqs-centered -t -dinuc 1> memechip_example_output_files/seqs-shuffled + Finished invoke: +- name: shuffle_seqs status: 0 time: 2.844394 ++ name: shuffle_seqs status: 0 time: 0.666054 + Invoking: + fasta-subsample memechip_example_output_files/seqs-centered 600 -rest memechip_example_output_files/seqs-discarded 1> memechip_example_output_files/seqs-sampled + Finished invoke: +- name: sample_seqs status: 0 time: 0.065115 ++ name: sample_seqs status: 0 time: 0.043721 + Invoking: + meme memechip_example_output_files/seqs-sampled -oc memechip_example_output_files/meme_out -dna -mod zoops -nmotifs 3 -minw 6 -maxw 30 -bfile memechip_example_output_files/background -p 6 -revcomp -nostatus + Finished invoke: +- name: meme status: 256 time: 0.004038 ++ name: meme status: 0 time: 504.485464 + Invoking: + dreme -v 1 -oc memechip_example_output_files/dreme_out -p memechip_example_output_files/seqs-centered -n memechip_example_output_files/seqs-shuffled -png + Finished invoke: +- name: dreme status: 0 time: 19.057875 ++ name: dreme status: 0 time: 17.122759 + Invoking: +- centrimo -seqlen 500 -verbosity 1 -oc memechip_example_output_files/centrimo_out -bgfile memechip_example_output_files/background memechip_example_output_files/sample-dna-Klf1.fa memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme ++ centrimo -seqlen 500 -verbosity 1 -oc memechip_example_output_files/centrimo_out -bgfile memechip_example_output_files/background memechip_example_output_files/sample-dna-Klf1.fa memechip_example_output_files/meme_out/meme.xml memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme + Finished invoke: +- name: centrimo status: 0 time: 15.819858 ++ name: centrimo status: 0 time: 14.716704 + Invoking: +- tomtom -verbosity 1 -oc memechip_example_output_files/dreme_tomtom_out -min-overlap 5 -dist pearson -evalue -thresh 1 -no-ssc -bfile memechip_example_output_files/background memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme ++ tomtom -verbosity 1 -oc memechip_example_output_files/meme_tomtom_out -min-overlap 5 -dist pearson -evalue -thresh 1 -no-ssc -bfile memechip_example_output_files/background memechip_example_output_files/meme_out/meme.xml JASPAR_CORE_2009.meme + Finished invoke: +- name: dreme_tomtom status: 0 time: 0.848902 ++ name: meme_tomtom status: 0 time: 18.602552 + Invoking: +- tomtom -verbosity 1 -text -thresh 0.1 memechip_example_output_files/combined.meme memechip_example_output_files/combined.meme 1> memechip_example_output_files/motif_alignment.txt +-Finished invoke: +- name: align status: 0 time: 0.866002 +-Invoking: +- spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_1 -bgfile memechip_example_output_files/background -primary GGGYGK memechip_example_output_files/sample-dna-Klf1.fa memechip_example_output_files/dreme_out/dreme.xml memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme ++ tomtom -verbosity 1 -oc memechip_example_output_files/dreme_tomtom_out -min-overlap 5 -dist pearson -evalue -thresh 1 -no-ssc -bfile memechip_example_output_files/background memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme + Finished invoke: +- name: spamo1 status: 0 time: 16.064009 ++ name: dreme_tomtom status: 0 time: 0.720525 + Invoking: +- spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_2 -bgfile memechip_example_output_files/background -primary TTATCW memechip_example_output_files/sample-dna-Klf1.fa memechip_example_output_files/dreme_out/dreme.xml memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme ++ tomtom -verbosity 1 -text -thresh 0.1 memechip_example_output_files/combined.meme memechip_example_output_files/combined.meme 1> memechip_example_output_files/motif_alignment.txt + Finished invoke: +- name: spamo2 status: 0 time: 11.312686 ++ name: align status: 0 time: 2.076766 + Invoking: +- spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_3 -bgfile memechip_example_output_files/background -primary MA0450.1 memechip_example_output_files/sample-dna-Klf1.fa JASPAR_CORE_2009.meme memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme ++ spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_1 -bgfile memechip_example_output_files/background -primary 1 memechip_example_output_files/sample-dna-Klf1.fa memechip_example_output_files/meme_out/meme.xml memechip_example_output_files/meme_out/meme.xml memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme + Finished invoke: +- name: spamo3 status: 0 time: 5.825866 ++ name: spamo1 status: 0 time: 14.137113 + Invoking: +- spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_4 -bgfile memechip_example_output_files/background -primary MA0036.1 memechip_example_output_files/sample-dna-Klf1.fa JASPAR_CORE_2009.meme memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme ++ spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_2 -bgfile memechip_example_output_files/background -primary 2 memechip_example_output_files/sample-dna-Klf1.fa memechip_example_output_files/meme_out/meme.xml memechip_example_output_files/meme_out/meme.xml memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme + Finished invoke: +- name: spamo4 status: 0 time: 0.572537 ++ name: spamo2 status: 0 time: 11.482534 + Invoking: +- spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_5 -bgfile memechip_example_output_files/background -primary MA0334.1 memechip_example_output_files/sample-dna-Klf1.fa JASPAR_CORE_2009.meme memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme ++ spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_3 -bgfile memechip_example_output_files/background -primary MA0450.1 memechip_example_output_files/sample-dna-Klf1.fa JASPAR_CORE_2009.meme memechip_example_output_files/meme_out/meme.xml memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme + Finished invoke: +- name: spamo5 status: 0 time: 12.322127 ++ name: spamo3 status: 0 time: 6.024557 + Invoking: +- spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_6 -bgfile memechip_example_output_files/background -primary MA0425.1 memechip_example_output_files/sample-dna-Klf1.fa JASPAR_CORE_2009.meme memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme ++ spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_4 -bgfile memechip_example_output_files/background -primary MA0036.1 memechip_example_output_files/sample-dna-Klf1.fa JASPAR_CORE_2009.meme memechip_example_output_files/meme_out/meme.xml memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme + Finished invoke: +- name: spamo6 status: 0 time: 9.530643 ++ name: spamo4 status: 0 time: 0.575319 + Invoking: +- spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_7 -bgfile memechip_example_output_files/background -primary MA0027.1 memechip_example_output_files/sample-dna-Klf1.fa JASPAR_CORE_2009.meme memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme ++ spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_5 -bgfile memechip_example_output_files/background -primary MA0204.1 memechip_example_output_files/sample-dna-Klf1.fa JASPAR_CORE_2009.meme memechip_example_output_files/meme_out/meme.xml memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme + Finished invoke: +- name: spamo7 status: 0 time: 9.712212 ++ name: spamo5 status: 0 time: 6.486124 + Invoking: +- fimo --parse-genomic-coord --verbosity 1 --oc memechip_example_output_files/fimo_out_1 --bgfile memechip_example_output_files/background --motif GGGYGK memechip_example_output_files/dreme_out/dreme.xml memechip_example_output_files/sample-dna-Klf1.fa ++ fimo --parse-genomic-coord --verbosity 1 --oc memechip_example_output_files/fimo_out_1 --bgfile memechip_example_output_files/background --motif 1 memechip_example_output_files/meme_out/meme.xml memechip_example_output_files/sample-dna-Klf1.fa + Finished invoke: +- name: fimo1 status: 0 time: 0.287648 ++ name: fimo1 status: 0 time: 0.461931 + Invoking: +- fimo --parse-genomic-coord --verbosity 1 --oc memechip_example_output_files/fimo_out_2 --bgfile memechip_example_output_files/background --motif TTATCW memechip_example_output_files/dreme_out/dreme.xml memechip_example_output_files/sample-dna-Klf1.fa ++ fimo --parse-genomic-coord --verbosity 1 --oc memechip_example_output_files/fimo_out_2 --bgfile memechip_example_output_files/background --motif 2 memechip_example_output_files/meme_out/meme.xml memechip_example_output_files/sample-dna-Klf1.fa + Finished invoke: +- name: fimo2 status: 0 time: 0.273133 ++ name: fimo2 status: 0 time: 0.312282 + Invoking: + fimo --parse-genomic-coord --verbosity 1 --oc memechip_example_output_files/fimo_out_3 --bgfile memechip_example_output_files/background --motif MA0450.1 JASPAR_CORE_2009.meme memechip_example_output_files/sample-dna-Klf1.fa + Finished invoke: +- name: fimo3 status: 0 time: 0.566197 ++ name: fimo3 status: 0 time: 0.410452 + Invoking: + fimo --parse-genomic-coord --verbosity 1 --oc memechip_example_output_files/fimo_out_4 --bgfile memechip_example_output_files/background --motif MA0036.1 JASPAR_CORE_2009.meme memechip_example_output_files/sample-dna-Klf1.fa + Finished invoke: +- name: fimo4 status: 0 time: 0.510907 +-Invoking: +- fimo --parse-genomic-coord --verbosity 1 --oc memechip_example_output_files/fimo_out_5 --bgfile memechip_example_output_files/background --motif MA0334.1 JASPAR_CORE_2009.meme memechip_example_output_files/sample-dna-Klf1.fa +-Finished invoke: +- name: fimo5 status: 0 time: 0.549286 +-Invoking: +- fimo --parse-genomic-coord --verbosity 1 --oc memechip_example_output_files/fimo_out_6 --bgfile memechip_example_output_files/background --motif MA0425.1 JASPAR_CORE_2009.meme memechip_example_output_files/sample-dna-Klf1.fa +-Finished invoke: +- name: fimo6 status: 0 time: 0.623338 ++ name: fimo4 status: 0 time: 0.356734 + Invoking: +- fimo --parse-genomic-coord --verbosity 1 --oc memechip_example_output_files/fimo_out_7 --bgfile memechip_example_output_files/background --motif MA0027.1 JASPAR_CORE_2009.meme memechip_example_output_files/sample-dna-Klf1.fa ++ fimo --parse-genomic-coord --verbosity 1 --oc memechip_example_output_files/fimo_out_5 --bgfile memechip_example_output_files/background --motif MA0204.1 JASPAR_CORE_2009.meme memechip_example_output_files/sample-dna-Klf1.fa + Finished invoke: +- name: fimo7 status: 0 time: 0.573607 ++ name: fimo5 status: 0 time: 0.367655 + Writing output + Done +diff -ruN a/doc/examples/memechip_example_output_files/spamo_out_1/spamo.html b/doc/examples/memechip_example_output_files/spamo_out_1/spamo.html +--- a/doc/examples/memechip_example_output_files/spamo_out_1/spamo.html 2014-05-13 08:34:49.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/spamo_out_1/spamo.html 2014-10-07 17:18:38.000000000 +1000 +@@ -3545,16 +3545,22 @@ + + store_motif( + "1", +- "GGGYGK", +- 0, ++ "1", ++ 2, + 0, +- "letter-probability matrix: alength= 4 w= 6 nsites= 549 E= 7.4e-58\n" + +- "4.66217e-05 4.44364e-05 0.999862 4.66217e-05\n" + +- "4.66217e-05 4.44364e-05 0.999862 4.66217e-05\n" + +- "4.66217e-05 4.44364e-05 0.999862 4.66217e-05\n" + +- "4.66217e-05 0.306 4.44364e-05 0.693909\n" + +- "4.66217e-05 4.44364e-05 0.999862 4.66217e-05\n" + +- "4.66217e-05 4.44364e-05 0.411627 0.588281\n" ++ "letter-probability matrix: alength= 4 w= 12 nsites= 225 E= 3e-225\n" + ++ "0.16118 0.39213 0.32105 0.12564\n" + ++ "0.352206 0.156679 0.329935 0.16118\n" + ++ "0.347763 0.0322901 0.600925 0.0190213\n" + ++ "0.0590036 0.800837 0.0767143 0.0634456\n" + ++ "0.0134408 0.897488 0.00455042 0.0845202\n" + ++ "0.684254 0.284426 0.0134355 0.0178838\n" + ++ "0.000113727 0.999664 0.000108396 0.000113727\n" + ++ "0.795316 0.000108396 0.191134 0.0134408\n" + ++ "0.00569325 0.991864 0.00119191 0.00125122\n" + ++ "0.0101363 0.974094 0.010077 0.00569325\n" + ++ "0.00125122 0.987421 0.00119191 0.0101363\n" + ++ "0.464405 0.100011 0.00227643 0.433308\n" + ); + + +@@ -3749,7 +3755,7 @@ +
    +
    + +

    +@@ -3785,10 +3791,10 @@ + + + +-GGGYGK (DREME) ++1 (MEME) + +

    +-GGGTGT ++CAGCCACACCCA +
    + + +-13 ++4 + +-MA0079.1 (SP1),  MA0289.1 (DAL80),  MA0309.1 (GZF3),  TTATCW (DREME),  MA0381.1 (SKN7),  MA0067.1 (Pax2),  MA0035.2 (Gata1),  MA0300.1 (GAT1),  MA0053.1 (MNB1A),  AGAWA (DREME),  MA0271.1 (ARG80),  MA0139.1 (CTCF),  MA0124.1 (NKX3-1) ++MA0309.1 (GZF3),  3 (MEME),  2 (MEME),  MA0207.1 (achi) + + +
    +@@ -3832,12 +3838,12 @@ + + + sample-dna-Klf1 +-Fri May 9 16:51:44 2014 ++Tue Oct 7 14:14:10 2014 + 904 + 0 +-346 +-71 +-487 ++439 ++50 ++415 + + + +@@ -3860,22 +3866,29 @@ + + + +- +- ++ ++ + + + + + ++ ++ ++ ++ ++ ++ ++ + +- ++ + +- +- ++ ++ + +
    dreme.xmlMon May 12 15:34:15 2014meme.xmlTue Oct 7 17:17:30 2014220
    dreme.xmlTue Oct 7 17:17:48 2014301
    JASPAR CORE 2009Tue Dec 4 23:04:00 2012Wed Dec 5 17:04:00 201247611125
    + +- ++ + +@@ -3883,9 +3896,9 @@ +
    +

    Spacings of "MA0079.1 (SP1)" relative to "GGGYGK (DREME)"

    Spacings of "MA0309.1 (GZF3)" relative to "1 (MEME)"

    + Previous Next Top +
    + +- +- + + + +- ++ + +
    Primary: GGGYGK (DREME) 
    ++
    Primary: 1 (MEME) 
    +
    Secondary: MA0079.1 (SP1) 
    ++
    Secondary: MA0309.1 (GZF3) 
    +
    + E-value
    +@@ -3894,7 +3907,7 @@ +
    +
    +-GGGTGT ++CAGCCACACCCA +
    + +
    +
    +-GGGGCGGGGT ++TGATAAGA +
    + +
    0.0050.0064
    + +@@ -3962,38 +3973,38 @@ + + + ++ ++ + ++ ++
    +- ++ + ++
    ++
    Same Strand
    ++
    Opposite Strand
    ++
    ++
    + + + +@@ -4013,25 +4111,238 @@ + + + +- +- +- ++ ++ ++ + + +
    P-valueGap 
    1.1e-05090.02615 
    +-
    ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    P-valueGap# 
    0.026155 
    8.6e-05247 
    +
    +
    +

    Total sequences with primary and secondary motif 
    +-

    352

    Motif Database 
    +-

    JASPAR CORE 2009
    ++219

    Alignment by most significant spacings 
    ++

    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Best Similar
    Secondary
    ++TGATAAGA ++
    This Similar
    Secondary
    ++CGATAAG ++
    ++ ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++
    Similar Secondary: MA0300.1 (GAT1) ++
    ++ ++ +
    ++
    Same Strand
    ++
    Opposite Strand
    ++
    ++
    ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    P-valueGap# 
    0.033155 
    0.0022246 
    ++
    ++
    ++

    Total sequences with primary and secondary motif 
    ++

    230

    Alignment by most significant spacings 
    ++

    ++ ++ ++ ++ ++ ++ ++ ++ + +
    Best Similar
    Secondary
     TGATAAGA ++
    This Similar
    Secondary
    ++CCGATAAG ++
    ++ ++
    ++ + + +- ++ + +@@ -4039,9 +4350,9 @@ +
    +

    Spacings of "MA0289.1 (DAL80)" relative to "GGGYGK (DREME)"

    Spacings of "3 (MEME)" relative to "1 (MEME)"

    + Previous Next Top +
    + +- +- + + + +- ++ + +
    Primary: GGGYGK (DREME) 
    ++
    Primary: 1 (MEME) 
    +
    Secondary: MA0289.1 (DAL80) 
    ++
    Secondary: 3 (MEME) 
    +
    + E-value
    +@@ -4050,7 +4361,7 @@ +
    +
    +-GGGTGT ++CAGCCACACCCA +
    + +
    +
    +-CGATAAG ++CTGCATCTCTTCAAGACACACCTAACTGC +
    + +
    0.110.0081
    + +@@ -4115,38 +4448,38 @@ + + + + +- ++ + +
    +- ++ + + +
    +-TGATAAGA ++CAGATAAG +
    + +
    0.280.13
    + +@@ -4269,38 +4602,38 @@ + + + +- +- +- +-
    +- ++ + +- +- +- +- +-

    Spacings of "TTATCW (DREME)" relative to "GGGYGK (DREME)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: GGGYGK (DREME) 
    +-
    Secondary: TTATCW (DREME) 
    +-
    +-E-value
    +-
    +-
    +-GGGTGT +-
    +- +-
    +-
    +-TTATCT +-
    +- +-
    0.31
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- ++
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    ++ + +- +@@ -4624,8 +4867,7 @@ + + +- +-
    Similar Secondary: MA0035.2 (Gata1) ++
    +- +- +
    +
    +
    +-
    +-
    ++
    + + + +@@ -4634,146 +4876,126 @@ + + + +- +- ++ ++ + + + + +- +- +- ++ ++ ++ + + + +
    P-valueGap
    0.00064180.001157 
    0.000642770.013246 
    ++
    +
    +

    Total sequences with primary and secondary motif 
    +-

    297

    Motif Database 
    +-

    dreme.xml
    +-
    +-
    +- +- +- +-

    Spacings of "MA0381.1 (SKN7)" relative to "GGGYGK (DREME)"

    +-Previous Next Top +-
    +-
    ++316

    Alignment by most significant spacings 
    ++

    + + +- +- +- ++ ++ + + +- ++ ++ ++
    Primary: GGGYGK (DREME) 
    +-
    Secondary: MA0381.1 (SKN7) 
    +-
    +-E-value
    +-
    Best Similar
    Secondary
     CAGATAAG ++
    +-
    +-GGGTGT +-
    ++
    This Similar
    Secondary
    ++ACAGATAAGAA ++
    + +-
    +-
    +-GGCCAT +-
    +- +
    0.61
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- + ++
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    ++
    ++ + +- +@@ -4790,917 +5012,149 @@ + + + ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Similar Secondary: MA0140.1 (Tal1::Gata1) ++
    +- +- + # 
    0.01336 
    0.013126 
    ++
    ++ ++ ++ ++ ++ ++ + +- +- ++ ++ + + + +
    P-valueGap# 
    0.001300.00157 
    +-
    +
    + + +

    Total sequences with primary and secondary motif 
    +-

    332

    Motif Database 
    +-

    JASPAR CORE 2009
    +- +- +- +- +- +- +- +-

    Spacings of "MA0067.1 (Pax2)" relative to "GGGYGK (DREME)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: GGGYGK (DREME) 
    +-
    Secondary: MA0067.1 (Pax2) 
    +-
    +-E-value
    +-
    +-
    +-GGGTGT +-
    +- +-
    +-
    +-AGTCACGC +-
    +- +-
    0.63
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.001336 
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    211

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0035.2 (Gata1)" relative to "GGGYGK (DREME)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: GGGYGK (DREME) 
    +-
    Secondary: MA0035.2 (Gata1) 
    +-
    +-E-value
    +-
    +-
    +-GGGTGT +-
    +- +-
    +-
    +-ACAGATAAGAA +-
    +- +-
    1.1
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.0024187 
    0.0024277 
    +-
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    361

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0300.1 (GAT1)" relative to "GGGYGK (DREME)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: GGGYGK (DREME) 
    +-
    Secondary: MA0300.1 (GAT1) 
    +-
    +-E-value
    +-
    +-
    +-GGGTGT +-
    +- +-
    +-
    +-CCGATAAG +-
    +- +-
    2.1
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.0044276 
    +-
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    260

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0053.1 (MNB1A)" relative to "GGGYGK (DREME)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: GGGYGK (DREME) 
    +-
    Secondary: MA0053.1 (MNB1A) 
    +-
    +-E-value
    +-
    +-
    +-GGGTGT +-
    +- +-
    +-
    +-AAAGC +-
    +- +-
    3.1
    ++298

    Alignment by most significant spacings 
    ++

    + + +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- ++ +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.006607 
    +-
    ++
    Best Similar
    Secondary
              CAGATAAG +
    +-

    Total sequences with primary and secondary motif 
    +-

    427

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "AGAWA (DREME)" relative to "GGGYGK (DREME)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: GGGYGK (DREME) 
    +-
    Secondary: AGAWA (DREME) 
    +-
    +-E-value
    +-
    +-
    +-GGGTGT +-
    +- +-
    +-
    +-AGAAA +-
    +- +-
    3.4
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- + + +- +- +- ++ +- + +
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.0072457 
    +-
    +-
    +-
    ++
    This Similar
    Secondary
    ++CTGGTGGGGACAGATAAG +
    +-

    Total sequences with primary and secondary motif 
    +-

    433

    Motif Database 
    +-

    dreme.xml
    +-
    +-
    +- +- +- +-

    Spacings of "MA0271.1 (ARG80)" relative to "GGGYGK (DREME)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: GGGYGK (DREME) 
    +-
    Secondary: MA0271.1 (ARG80) 
    +-
    +-E-value
    +-
    +-
    +-GGGTGT +-
    + +-
    +-
    +-AGACGC +-
    +- +
    3.7
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- + ++
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    ++
    ++ + +- +@@ -5710,208 +5164,103 @@ + + + +- +-
    Similar Secondary: MA0307.1 (GLN3) ++
    +- +- +
    +
    +-
    ++
    ++
    + + + + + + +- +- +- +- ++ ++ ++ ++ ++ + +- ++ ++ ++ ++ ++ ++ ++ ++ +
    P-valueGap# 
    0.007776
    0.0018167 
    0.0018257 
    +-
    +
    +
    +

    Total sequences with primary and secondary motif 
    +-

    289

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0139.1 (CTCF)" relative to "GGGYGK (DREME)"

    +-Previous Next Top +-
    +-
    ++350

    Alignment by most significant spacings 
    ++

    + + +- +- +- ++ ++ + + +- ++ ++ ++
    Primary: GGGYGK (DREME) 
    +-
    Secondary: MA0139.1 (CTCF) 
    +-
    +-E-value
    +-
    Best Similar
    Secondary
    ++CAGATAAG ++
    +-
    +-GGGTGT +-
    ++
    This Similar
    Secondary
      GATAA ++
    + +- +- +-
    +-TGGCCACCAGGGGGCGCTA +-
    +- + +-4.9 +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- + +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.0114 
    +-
    +-
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    82

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    ++
    ++ + +- +- ++

    Spacings of "MA0124.1 (NKX3-1)" relative to "GGGYGK (DREME)"

    ++ + +

    Spacings of "MA0207.1 (achi)" relative to "1 (MEME)"

    +-Previous Next Top ++Previous Next Top +
    +
    + + +- +- + + + + +- ++ + +
    Primary: GGGYGK (DREME) 
    ++
    Primary: 1 (MEME) 
    +
    Secondary: MA0124.1 (NKX3-1) 
    ++
    Secondary: MA0207.1 (achi) 
    +
    + E-value
    +@@ -5919,51 +5268,50 @@ +
    +-
    +-GGGTGT ++
    ++CAGCCACACCCA +
    + +
    +-
    +-ATACTTA ++
    ++TGACAG +
    + +
    8.55.9
    + +@@ -5985,38 +5333,38 @@ + + + + +- ++ + +- ++ + + +
    +- +- + +@@ -3749,7 +3751,7 @@ + +
    + +

    +@@ -3785,10 +3787,10 @@ + +

    TTATCW (DREME)2 (MEME) +
    +-TTATCT ++CAGATAAG +
    + +
    47 +-MA0039.2 (Klf4),  MA0268.1 (ADR1),  MA0431.1 (YML081W),  MA0270.1 (AFT2) ++MA0039.2 (Klf4),  3 (MEME),  MA0268.1 (ADR1),  MA0370.1 (RME1),  MA0137.1 (STAT1),  MA0436.1 (YPR022C),  MA0355.1 (PHD1) +
    +@@ -3832,12 +3834,12 @@ + + + sample-dna-Klf1 +-Fri May 9 16:51:44 2014 ++Tue Oct 7 14:14:10 2014 + 904 + 0 +-512 +-57 +-335 ++520 ++55 ++329 + + + +@@ -3860,22 +3862,29 @@ + + + +- +- ++ ++ + ++ ++ ++ ++ ++ ++ ++ + + + + + +- ++ + +- +- ++ ++ + +
    dreme.xmlMon May 12 15:34:15 2014meme.xmlTue Oct 7 17:17:30 2014211
    dreme.xmlTue Oct 7 17:17:48 2014301
    JASPAR CORE 2009Tue Dec 4 23:04:00 2012Wed Dec 5 17:04:00 20124764063
    + +- ++ + +@@ -3883,7 +3892,7 @@ +
    +

    Spacings of "MA0039.2 (Klf4)" relative to "TTATCW (DREME)"

    Spacings of "MA0039.2 (Klf4)" relative to "2 (MEME)"

    + Previous Next Top +
    + +- + +@@ -3894,7 +3903,7 @@ + + +@@ -3940,7 +3949,7 @@ + ); + + +- ++ + +
    Primary: TTATCW (DREME) 
    ++
    Primary: 2 (MEME) 
    +
    Secondary: MA0039.2 (Klf4) 
    +
    +
    +-TTATCT ++CAGATAAG +
    + +
    0.0150.014
    + +@@ -3962,38 +3971,38 @@ + + + +- +- +- +-
    +- ++ + +- +- +- +- +-

    Spacings of "MA0268.1 (ADR1)" relative to "TTATCW (DREME)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: TTATCW (DREME) 
    +-
    Secondary: MA0268.1 (ADR1) 
    +-
    +-E-value
    +-
    +-
    +-TTATCT +-
    +- +-
    +-
    +-ACCCCAC +-
    +- +-
    0.25
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- ++
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    ++ + +- +@@ -4295,8 +4237,7 @@ +
    Opposite Strand
    + + + +- +-
    Similar Secondary: GGGYGK (DREME)
    +- +- +
    +-
    +-
    ++
    + + + +@@ -4304,144 +4245,116 @@ + + + +- +- ++ ++ + + + +
    P-valueGap 
    0.00052250.0005277 
    ++
    +
    +
    +
    +

    Total sequences with primary and secondary motif 
    +-

    288

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0431.1 (YML081W)" relative to "TTATCW (DREME)"

    +-Previous Next Top +-
    +-
    ++286

    Alignment by most significant spacings 
    ++

    + + +- +- +- ++ ++ + + +- ++ ++ ++
    Primary: TTATCW (DREME) 
    +-
    Secondary: MA0431.1 (YML081W) 
    +-
    +-E-value
    +-
    Best Similar
    Secondary
    ++TGGGTGGGGC ++
    +-
    +-TTATCT +-
    ++
    This Similar
    Secondary
     GGGTGT ++
    + +-
    +-
    +-ACCCCGCAC +-
    +- +
    5.5
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- + ++
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    ++
    ++ + +- +@@ -4451,7 +4364,8 @@ + + + +- +-
    Similar Secondary: MA0425.1 (YGR067C) ++
    +- +- +
    +
    +-
    ++
    ++
    + + + +@@ -4459,88 +4373,1047 @@ + + + +- ++ + +- ++ + + +
    P-valueGap 
    0.0120.000562556 
    +-
    +
    +
    +

    Total sequences with primary and secondary motif 
    +-

    184

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0270.1 (AFT2)" relative to "TTATCW (DREME)"

    +-Previous Next Top +-
    +-
    ++183

    Alignment by most significant spacings 
    ++

    + + +- +- +- ++ ++ + + +- ++ ++
    Primary: TTATCW (DREME) 
    +-
    Secondary: MA0270.1 (AFT2) 
    +-
    +-E-value
    +-
    Best Similar
    Secondary
    ++GCCCCACCCA ++
    +-
    +-TTATCT +-
    +- ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++
    Similar Secondary: MA0337.1 (MIG1) ++
    ++ ++ ++
    ++
    Same Strand
    ++
    Opposite Strand
    ++
    ++
    ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    P-valueGap# 
    0.0017256 
    ++
    ++
    ++

    Total sequences with primary and secondary motif 
    ++

    221

    Alignment by most significant spacings 
    ++

    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Best Similar
    Secondary
    ++GCCCCACCCA ++
    This Similar
    Secondary
    ++CCCCCGC ++
    ++ ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++
    Similar Secondary: MA0339.1 (MIG3) ++
    ++ ++ ++
    ++
    Same Strand
    ++
    Opposite Strand
    ++
    ++
    ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    P-valueGap# 
    0.0017256 
    ++
    ++
    ++

    Total sequences with primary and secondary motif 
    ++

    221

    Alignment by most significant spacings 
    ++

    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Best Similar
    Secondary
    ++GCCCCACCCA ++
    This Similar
    Secondary
     CCCCGCA ++
    ++ ++
    ++ ++ ++ ++ ++ ++

    Spacings of "3 (MEME)" relative to "2 (MEME)"

    ++Previous Next Top ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Primary: 2 (MEME) 
    ++
    Secondary: 3 (MEME) 
    ++
    ++E-value
    ++
    ++
    ++CAGATAAG ++
    ++ ++
    ++
    ++CTGCATCTCTTCAAGACACACCTAACTGC ++
    ++ ++
    0.04
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Motif Spacing Histogram 
    ++
     Significant Motif Spacings (p<0.05) 
    ++
     
    UpstreamDownstream UpstreamDownstreamOther Details
    ++ ++ ++
    ++
    Same Strand
    ++
    Opposite Strand
    ++
    ++
    ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    P-valueGap# 
    8.4e-05273 
    ++
    ++
    ++

    Total sequences with primary and secondary motif 
    ++

    6

    Motif Database 
    ++

    meme.xml
    ++
    ++
    ++ ++ ++ ++

    Spacings of "MA0268.1 (ADR1)" relative to "2 (MEME)"

    ++Previous Next Top ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Primary: 2 (MEME) 
    ++
    Secondary: MA0268.1 (ADR1) 
    ++
    ++E-value
    ++
    ++
    ++CAGATAAG ++
    ++ ++
    ++
    ++ACCCCAC ++
    ++ ++
    3.3
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Motif Spacing Histogram 
    ++
     Significant Motif Spacings (p<0.05) 
    ++
     
    UpstreamDownstream UpstreamDownstreamOther Details
    ++ ++ ++
    ++
    Same Strand
    ++
    Opposite Strand
    ++
    ++
    ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    P-valueGap# 
    0.0068256 
    ++
    ++
    ++

    Total sequences with primary and secondary motif 
    ++

    283

    Motif Database 
    ++

    JASPAR CORE 2009
    ++
    ++
    ++ ++ ++ ++

    Spacings of "MA0370.1 (RME1)" relative to "2 (MEME)"

    ++Previous Next Top ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Primary: 2 (MEME) 
    ++
    Secondary: MA0370.1 (RME1) 
    ++
    ++E-value
    ++
    ++
    ++CAGATAAG ++
    ++ ++
    ++
    ++TCCAAAGGAA ++
    ++ ++
    4.8
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Motif Spacing Histogram 
    ++
     Significant Motif Spacings (p<0.05) 
    ++
     
    UpstreamDownstream UpstreamDownstreamOther Details
    ++ ++ ++
    ++
    Same Strand
    ++
    Opposite Strand
    ++
    ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    P-valueGap# 
    0.00991065 
    ++
    ++
    ++
    ++

    Total sequences with primary and secondary motif 
    ++

    175

    Motif Database 
    ++

    JASPAR CORE 2009
    ++
    ++
    ++ ++ ++ ++

    Spacings of "MA0137.1 (STAT1)" relative to "2 (MEME)"

    ++Previous Next Top ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++ + ++ ++ ++
    Primary: 2 (MEME) 
    ++
    Secondary: MA0137.1 (STAT1) 
    ++
    ++E-value
    ++
    ++
    ++CAGATAAG ++
    ++ +
    +-
    +-CACACCCC ++
    ++GGAAAATGAAACTG +
    + ++
    5
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Motif Spacing Histogram 
    ++
     Significant Motif Spacings (p<0.05) 
    ++
     
    UpstreamDownstream UpstreamDownstreamOther Details
    ++ ++ ++
    ++
    Same Strand
    ++
    Opposite Strand
    ++
    ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    P-valueGap# 
    0.0173 
    ++
    ++
    ++
    ++

    Total sequences with primary and secondary motif 
    ++

    28

    Motif Database 
    ++

    JASPAR CORE 2009
    ++
    ++
    ++ ++ ++ ++

    Spacings of "MA0436.1 (YPR022C)" relative to "2 (MEME)"

    ++Previous Next Top ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++ ++ +- ++ + +
    Primary: 2 (MEME) 
    ++
    Secondary: MA0436.1 (YPR022C) 
    ++
    ++E-value
    ++
    ++
    ++CAGATAAG ++
    ++ ++
    ++
    ++CCCCACG ++
    ++ +
    65.7
    + +@@ -4562,38 +5435,38 @@ + + + ++ ++ ++ ++
    +- +- ++ ++
    ++ACCTGCAGCA ++
    ++ ++
    7.9
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ + + +@@ -4635,7 +5664,7 @@ + PreviousTop + +
    +-
    SpaMo version
    4.10.0 (Release date: Tue May 06 16:46:04 2014 +1000) ++
    SpaMo version
    4.10.0 (Release date: Wed May 21 10:35:36 2014 +1000) +
    +
    +
    Reference
    +@@ -4647,7 +5676,7 @@ +
    +
    +
    Command line summary
    +-
    Result calculation took 11 seconds
    Note that the random number generator was initilized with a seed of 1 so you need ++
    Result calculation took 12 seconds
    Note that the random number generator was initilized with a seed of 1 so you need + "-numgen 1" in the list of arguments + to replicate the experiment. +
    +@@ -4667,8 +5696,8 @@ + motif_pseudocount = 0.1 + motif_trim = 0.25 + bin_max = 8 +-host = d-108-179-169-207.dhcp4.washington.edu +-when = Mon May 12 15:34:49 2014 ++host = IMB12-010665 ++when = Tue Oct 7 17:18:38 2014 + + + +diff -ruN a/doc/examples/memechip_example_output_files/spamo_out_2/spamo.xml b/doc/examples/memechip_example_output_files/spamo_out_2/spamo.xml +--- a/doc/examples/memechip_example_output_files/spamo_out_2/spamo.xml 2014-05-13 08:35:00.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/spamo_out_2/spamo.xml 2014-10-07 17:18:50.000000000 +1000 +@@ -63,9 +63,9 @@ + + + ]> +- ++ + +- spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_2 -bgfile memechip_example_output_files/background -primary TTATCW memechip_example_output_files/sample-dna-Klf1.fa memechip_example_output_files/dreme_out/dreme.xml memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme ++ spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_2 -bgfile memechip_example_output_files/background -primary 2 memechip_example_output_files/sample-dna-Klf1.fa memechip_example_output_files/meme_out/meme.xml memechip_example_output_files/meme_out/meme.xml memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme + 1 + 150 + 1 +@@ -79,33 +79,38 @@ + 0.1 + 0.25 + 8 +- d-108-179-169-207.dhcp4.washington.edu +- Mon May 12 15:34:49 2014 ++ IMB12-010665 ++ Tue Oct 7 17:18:38 2014 + + + +- ++ ++ +- +- + + +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ ++ ++ + +- +- +- +- ++ ++ ++ ++ ++ + + + +@@ -117,82 +122,82 @@ + + + +- ++ + + + +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ + +- +- ++ ++ + +- +- ++ ++ + +- +- +- +- +- ++ ++ ++ ++ ++ + + +- +- +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ ++ ++ + + + +- ++ + +- +- ++ ++ + +- +- +- +- ++ ++ ++ ++ + + +- +- ++ ++ + +- ++ + +- ++ + + +- +- +- +- ++ ++ ++ ++ + + +- ++ + + + +- +- ++ ++ + + + +- +- ++ ++ + +- +- ++ ++ + + + +@@ -202,43 +207,43 @@ + + + +- ++ + + +- ++ + + + +- ++ + + +- ++ + + + +- ++ + +- ++ + + + + + +- +- +- ++ ++ ++ + +- +- ++ ++ + +- ++ + +- ++ + +- ++ + + +- ++ + + + +@@ -246,7 +251,7 @@ + + + +- ++ + + + +@@ -263,88 +268,88 @@ + + + +- +- +- +- +- ++ ++ ++ ++ ++ + +- +- +- +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ + +- +- +- +- ++ ++ ++ ++ + +- ++ + +- +- ++ ++ + +- +- ++ ++ + + + +- ++ + + +- +- ++ ++ + +- +- +- ++ ++ ++ + + + +- ++ + + +- ++ + + +- ++ + +- +- ++ ++ + +- ++ + + +- ++ + + +- ++ + +- ++ + +- +- +- ++ ++ ++ + +- +- ++ ++ + + + +- +- ++ ++ + + + + + +- ++ + + + +@@ -353,52 +358,52 @@ + + + +- ++ + +- +- +- ++ ++ ++ + + +- ++ + +- ++ + + +- ++ + +- ++ + + + + + + +- ++ + + +- ++ + + + +- ++ + + + + + +- ++ + + + +- ++ + +- ++ + + + + +- ++ + + + +@@ -408,80 +413,80 @@ + + + +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ + +- +- ++ ++ + +- ++ + +- +- +- +- ++ ++ ++ ++ + + +- +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ ++ + +- +- ++ ++ + +- +- ++ ++ + +- +- +- +- ++ ++ ++ ++ + + +- ++ + + +- +- +- +- ++ ++ ++ ++ + + +- ++ + +- ++ + +- ++ + +- ++ + +- ++ + +- ++ + + +- ++ + +- ++ + + + + +- ++ + +- +- ++ ++ + +- ++ + + + +@@ -490,7 +495,7 @@ + + + +- ++ + + + +@@ -498,128 +503,128 @@ + + + +- ++ + + +- ++ + + + + +- +- ++ ++ + + +- ++ + +- ++ + + + + + +- +- +- ++ ++ ++ + +- +- ++ ++ + + +- ++ + + + + +- +- ++ ++ + + + + +- +- ++ ++ + + + + + +- ++ + + + + + + +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ + +- +- +- ++ ++ ++ + +- +- ++ ++ + +- +- ++ ++ + + +- ++ + +- +- +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ ++ ++ + +- +- +- ++ ++ ++ + +- +- +- +- +- ++ ++ ++ ++ ++ + + +- ++ + +- ++ + +- ++ + + +- +- ++ ++ + + +- +- +- +- ++ ++ ++ ++ + + +- ++ + + + +- +- ++ ++ + + + +- ++ + + + +@@ -632,54 +637,54 @@ + + + +- +- ++ ++ + +- +- ++ ++ + + + +- ++ + +- ++ + + + +- ++ + + +- ++ + + + + + + +- ++ + +- +- +- ++ ++ ++ + +- ++ + +- +- ++ ++ + + + +- ++ + + +- ++ + + + +- ++ + + +- ++ + + + +@@ -689,102 +694,108 @@ + + + +- +- ++ ++ + + + + + +- +- +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ + +- ++ + + + + + +- +- +- +- ++ ++ ++ ++ + +- +- +- +- ++ ++ ++ ++ + +- +- +- ++ ++ ++ + +- +- +- ++ ++ ++ + + +- ++ + +- ++ + + +- +- ++ ++ + +- +- ++ ++ + + + +- +- +- +- +- ++ ++ ++ ++ ++ + + + + +- +- ++ ++ + +- +- +- +- +- ++ ++ ++ ++ ++ + +- ++ + +- +- ++ ++ + + +- ++ + +- ++ + +- +- +- +- ++ ++ ++ ++ + +- ++ + + + + +- ++ + +- ++ + + + +@@ -794,36 +805,36 @@ + + + +- ++ + +- ++ + +- +- ++ ++ + + +- ++ + + + + +- +- ++ ++ + + +- +- ++ ++ + + +- ++ + + +- +- ++ ++ + + + +- ++ + + + +@@ -832,107 +843,103 @@ + + + +- ++ + +- +- ++ ++ + + +- +- ++ ++ + + + + +- ++ + + +- ++ + + +- +- +- +- + + +- +- +- ++ ++ ++ + +- +- +- ++ ++ ++ + +- +- +- +- ++ ++ ++ ++ + + +- +- ++ ++ + +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ + +- +- +- +- +- ++ ++ ++ ++ ++ + +- ++ + +- +- ++ ++ + +- ++ + +- ++ + +- ++ + + + + +- ++ + + +- ++ + + +- ++ + + + + +- +- ++ ++ + +- +- ++ ++ + +- ++ + +- +- ++ ++ + + + + + +- ++ + +- ++ + +- +- ++ ++ + + + +@@ -949,29 +956,29 @@ + + + +- +- +- ++ ++ ++ + + + + +- ++ + + +- ++ + +- ++ + + +- ++ + + +- ++ + + +- +- ++ ++ + + + +@@ -981,7 +988,7 @@ + + + +- ++ + + + +@@ -990,168 +997,318 @@ + + + +- ++ + + + + + + +- +- +- +- + + + + +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ + +- ++ + +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ + +- +- +- +- ++ ++ ++ ++ + +- ++ + +- ++ + +- +- +- +- +- ++ ++ ++ ++ ++ + +- +- +- +- +- ++ ++ ++ ++ ++ + + + + +- +- ++ ++ + +- +- +- +- ++ ++ ++ ++ + + +- ++ + +- ++ + +- +- ++ ++ + +- ++ + +- +- ++ ++ + +- +- ++ ++ + + + + +- ++ + +- ++ + + + +- ++ + +- ++ + + + +- ++ + +- ++ + + + + + + +- +- ++ ++ + + + + +- ++ + + +- ++ + + + + +- ++ + + +- ++ + + + + + +- ++ + +- ++ + +- ++ + + + + +- ++ + + + + + + +- ++ + + + +- +- +- +- + + ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ + + + +@@ -1160,30 +1317,30 @@ + + + +- ++ + + + + + + +- ++ + +- +- ++ ++ + + + + +- ++ + + +- +- +- +- ++ ++ ++ ++ + +- ++ + + + +@@ -1191,10 +1348,10 @@ + + + +- ++ + +- +- ++ ++ + + + +@@ -1211,10 +1368,10 @@ + + + +- ++ + +- +- ++ ++ + + + +@@ -1233,21 +1390,21 @@ + + + +- ++ + + + + + + +- ++ + +- ++ + +- ++ + + +- ++ + + + +@@ -1276,18 +1433,18 @@ + + + +- ++ + + + + + + +- ++ + + + +- ++ + + + +@@ -1297,251 +1454,4254 @@ + + + +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ + ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ + + + +- +- +- +- +- ++ ++ ++ ++ ++ + +- ++ + +- ++ + + + + + + +- ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ + + + + +- ++ + +- +- ++ ++ + + + +- +- ++ ++ + + + + + + +- ++ + + +- ++ + + + +- +- ++ ++ + + + + + +- ++ + + + +- +- ++ ++ + + + +- ++ + + +- +- +- ++ ++ ++ + + +- +- +- +- ++ ++ ++ ++ + + + + +- ++ + + + + +- ++ + + +- +- ++ ++ + + +- +- ++ ++ + + + +- +- +- +- +- +- +- + + + + +- +- +- +- ++ ++ ++ ++ + +- +- +- ++ ++ ++ + +- +- ++ ++ + + +- +- +- ++ ++ ++ + +- ++ + +- ++ + + +- +- ++ ++ + +- ++ + + +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ + + + +- ++ + +- +- +- +- ++ ++ ++ ++ + + + + +- ++ + + + +- ++ + + +- +- ++ ++ + + + + + +- +- ++ ++ + +- ++ + +- +- +- +- ++ ++ ++ ++ + + + + + +- ++ + + + +@@ -1550,38 +5710,38 @@ + + + +- +- ++ ++ + + +- ++ + +- +- ++ ++ + + + +- ++ + + + + + +- ++ + + +- +- ++ ++ + + +- +- +- ++ ++ ++ + + + + +- ++ + + + +@@ -1589,94 +5749,87 @@ + + + +- ++ + + + +- +- ++ ++ + +- ++ + + + + + +- +- +- +- +- +- +- + + + + + + +- ++ + + + +- ++ + +- +- ++ ++ + + + + + +- ++ + + +- ++ + + +- ++ + + + +- +- +- +- ++ ++ ++ ++ + + + + +- ++ + + +- +- +- ++ ++ ++ + +- ++ + + + + + +- +- +- ++ ++ ++ + + + + + +- ++ + + +- ++ + + + + +- +- ++ ++ + + + +@@ -1685,13 +5838,13 @@ + + + +- +- ++ ++ + + +- +- +- ++ ++ ++ + + + +@@ -1700,11 +5853,11 @@ + + + +- ++ + + + +- ++ + + + +@@ -1713,129 +5866,122 @@ + + + +- +- +- ++ ++ ++ + +- +- +- ++ ++ ++ + + + + + +- ++ + + + +- +- +- +- ++ ++ ++ ++ + + +- ++ + + +- +- ++ ++ + + + + + +- ++ + + + +- ++ + +- +- +- +- +- +- +- + + +- ++ + +- ++ + + +- ++ + + + + + + +- +- +- ++ ++ ++ + +- ++ + +- ++ + +- +- ++ ++ + +- ++ + + +- ++ + +- ++ + +- +- +- +- ++ ++ ++ ++ + + +- +- +- ++ ++ ++ + +- ++ + + + +- ++ + + + +- ++ + + +- +- +- ++ ++ ++ + +- +- ++ ++ + +- ++ + + +- ++ + + +- ++ + + + + +- ++ + + + +- ++ + +- ++ + + + +@@ -1847,7 +5993,7 @@ + + + +- ++ + + + +@@ -1855,148 +6001,139 @@ + + + +- +- ++ ++ + +- +- +- +- ++ ++ ++ ++ + + +- +- +- ++ ++ ++ + +- ++ + +- ++ + + + +- ++ + + + + + +- ++ + +- +- ++ ++ + + +- +- ++ ++ + +- +- ++ ++ + +- +- +- +- ++ ++ ++ ++ + + +- +- +- +- +- +- +- + + + + +- +- +- +- ++ ++ ++ ++ + + + +- +- +- +- +- ++ ++ ++ + +- ++ + + + + + +- +- ++ ++ + +- ++ + +- +- ++ ++ + + + + + +- +- ++ ++ + +- ++ + + + +- ++ + + +- ++ + +- ++ + +- ++ + +- +- +- +- +- ++ ++ ++ ++ ++ + + + +- +- ++ ++ + + +- ++ + + + +- ++ + + + +- ++ + + + + +- ++ + + + + +- ++ + + + + +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ + + + +@@ -2005,127 +6142,128 @@ + + + +- ++ + + +- ++ + + + +- +- ++ ++ + + + +- ++ + + + +- ++ + +- +- ++ ++ + +- +- ++ ++ + +- +- ++ ++ + +- +- +- +- ++ ++ ++ ++ + +- ++ + + +- ++ + + +- +- +- ++ ++ ++ + +- +- ++ ++ + +- +- ++ ++ + + +- ++ + + +- ++ + + + +- ++ + +- ++ + + + + + ++ + + + + + +- +- +- ++ ++ ++ + + + +- ++ + + +- ++ + +- ++ + +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ + +- ++ + +- ++ + + + + +- +- ++ ++ + + + +- +- ++ ++ + +- +- ++ ++ + + +- +- ++ ++ + + +- +- +- ++ ++ ++ + + + + +- +- ++ ++ + + + +@@ -2133,88 +6271,89 @@ + + + +- +- ++ ++ + + + + + +- ++ + +- ++ + +- +- ++ ++ + +- ++ + + +- ++ + +- +- ++ ++ + + + + + +- +- +- ++ ++ ++ + +- ++ + + + + +- ++ + + + +- ++ + + + + + + +- ++ + +- +- ++ ++ + + + +- ++ + + + +- +- ++ ++ + + + +- +- ++ ++ + + + +- ++ + + + + + +- ++ + + +- ++ + + + + + ++ + + + +@@ -2222,126 +6361,126 @@ + + + +- +- +- ++ ++ ++ + +- +- ++ ++ + + +- ++ + + + + + +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ + +- +- +- ++ ++ ++ + + +- +- +- ++ ++ ++ + +- +- ++ ++ + +- ++ + + +- ++ + +- +- +- ++ ++ ++ + + +- +- +- ++ ++ ++ + + + + + + +- ++ + + + +- ++ + +- ++ + + + + +- +- ++ ++ + +- ++ + + +- +- ++ ++ + + +- +- ++ ++ + + + +- ++ + +- ++ + + + +- ++ + + +- +- +- ++ ++ ++ + + + + +- ++ + + + +- +- +- +- ++ ++ ++ ++ + + + + + +- +- ++ ++ + + + + +- +- ++ ++ + +- +- ++ ++ + +- ++ + + + +@@ -2351,71 +6490,72 @@ + + + +- ++ + + +- ++ + +- ++ + +- ++ + + +- +- ++ ++ ++ + + + +- ++ + + +- +- +- ++ ++ ++ + + +- ++ + +- ++ + +- +- +- ++ ++ ++ + +- ++ + + + +- ++ + +- +- ++ ++ + +- ++ + + +- +- +- ++ ++ ++ + + +- +- +- ++ ++ ++ + + +- ++ + + + + +- +- ++ ++ + +- +- ++ ++ + +- ++ + + + +@@ -2424,16 +6564,16 @@ + + + +- +- ++ ++ + + + + +- ++ + + +- ++ + + + +@@ -2441,373 +6581,376 @@ + + + +- ++ + +- ++ + +- ++ + + +- ++ + + + +- ++ + +- ++ + +- ++ + + +- +- +- +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ + +- ++ + + + + +- ++ + +- ++ + +- ++ + + + +- ++ + +- +- +- ++ ++ ++ + + +- ++ + + + + +- +- ++ ++ + + + + + + +- ++ + + + + + ++ + + + + +- +- +- +- +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ + +- ++ + + + +- +- +- ++ ++ ++ + +- +- ++ ++ + + +- +- +- ++ ++ ++ + +- ++ + + +- +- ++ ++ + +- +- ++ ++ + +- +- +- ++ ++ ++ + + +- +- ++ ++ + +- +- +- ++ ++ ++ + +- ++ + + + +- +- ++ ++ + +- +- +- ++ ++ ++ + + + +- +- ++ ++ + +- +- +- ++ ++ ++ + + + +- ++ + + +- +- +- +- ++ ++ ++ ++ + +- +- +- ++ ++ ++ + + + +- +- +- ++ ++ ++ + +- +- ++ ++ + +- +- ++ ++ + +- ++ + +- +- ++ ++ + + + + +- ++ + +- ++ + + +- +- ++ ++ + + + + +- ++ + + +- +- +- +- +- ++ ++ ++ ++ ++ + +- ++ + +- ++ + +- ++ + + +- ++ + + +- ++ + + + + +- +- +- ++ ++ ++ + + + + +- ++ + + + + +- +- +- ++ ++ ++ + + +- ++ + + + + + + +- ++ + +- ++ + + + + +- ++ + + + + + + +- ++ + + +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ + +- +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ ++ + + + + +- ++ + +- ++ + +- ++ + + +- +- +- ++ ++ ++ + + +- +- ++ ++ + + +- ++ + + +- ++ + +- +- +- ++ ++ ++ + + +- +- ++ ++ + +- ++ + + + + + +- ++ + + +- ++ + +- ++ + + + + +- ++ + + + + +- +- ++ ++ + +- ++ + + + + + +- ++ + + + + + +- +- ++ ++ + + + +- +- ++ ++ + +- +- ++ ++ + +- ++ + + + + +- ++ + + + +- ++ + + + +- ++ + +- +- ++ ++ + +- +- ++ ++ + + + +@@ -2816,153 +6959,153 @@ + + + +- ++ + +- +- ++ ++ + + + + + +- ++ + +- ++ + +- +- ++ ++ + +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ + + +- +- ++ ++ + +- ++ + +- +- ++ ++ + + + +- ++ + + + +- ++ + + + +- ++ + +- ++ + + +- ++ + +- +- ++ ++ + +- +- +- +- ++ ++ ++ ++ + + +- ++ + + + +- ++ + + +- ++ + + + + +- ++ + +- ++ + + +- ++ + +- ++ + +- +- ++ ++ + +- ++ + +- +- ++ ++ + + +- ++ + +- ++ + + +- +- +- +- +- ++ ++ ++ ++ ++ + + + +- ++ + + +- ++ + + + + +- +- +- ++ ++ ++ + +- ++ + + + + + + +- +- +- ++ ++ ++ + + + +- ++ + +- ++ + + + +- +- ++ ++ + + +- ++ + +- ++ + +- ++ + +- ++ + + +- ++ + + + +@@ -2974,152 +7117,152 @@ + + + +- +- ++ ++ + + + + + + +- ++ + + +- +- +- ++ ++ ++ + + +- +- +- +- +- ++ ++ ++ ++ ++ + +- ++ + +- +- ++ ++ + + +- ++ + +- +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ ++ + +- ++ + + +- ++ + +- +- +- ++ ++ ++ + +- +- +- ++ ++ ++ + +- +- ++ ++ + + +- +- ++ ++ + +- ++ + + + +- ++ + + +- ++ + +- ++ + + + +- +- ++ ++ + +- +- ++ ++ + + + +- ++ + + + + + +- ++ + + + + + +- ++ + + + +- ++ + +- ++ + + + +- ++ + + + + +- ++ + + + + +- ++ + +- ++ + +- +- ++ ++ + +- ++ + + +- +- ++ ++ + + + +- ++ + + +- ++ + +- ++ + + + + +- ++ + + +- ++ + + + + + + +- ++ + +diff -ruN a/doc/examples/memechip_example_output_files/spamo_out_3/spamo.html b/doc/examples/memechip_example_output_files/spamo_out_3/spamo.html +--- a/doc/examples/memechip_example_output_files/spamo_out_3/spamo.html 2014-05-13 08:35:06.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/spamo_out_3/spamo.html 2014-10-07 17:18:56.000000000 +1000 +@@ -3752,7 +3752,7 @@ + +
    + +

    +@@ -3833,7 +3833,7 @@ + +

    + +- ++ + + + +@@ -3861,15 +3861,22 @@ + + + ++ ++ ++ ++ ++ ++ ++ + +- ++ + + + + + + +- ++ + + + +@@ -3960,7 +3967,7 @@ + + + + +- ++ + +- +- ++ ++ + +
    Motif Spacing Histogram 
    ++
     Significant Motif Spacings (p<0.05) 
    ++
     
    UpstreamDownstream UpstreamDownstreamOther Details
    ++ ++ ++
    ++
    Same Strand
    ++
    Opposite Strand
    ++
    ++
    ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++ ++ + + + +
    P-valueGap# 
    0.01655 
    +-
    +
    +
    +

    Total sequences with primary and secondary motif 
    +-

    188

    Motif Database 
    ++

    199

    Motif Database 
    +

    JASPAR CORE 2009
    +
    sample-dna-Klf1Fri May 9 16:51:44 2014Tue Oct 7 14:14:10 20149040748
    meme.xmlTue Oct 7 17:17:30 2014300
    dreme.xmlMon May 12 15:34:15 2014Tue Oct 7 17:17:48 2014300
    JASPAR CORE 2009Tue Dec 4 23:04:00 2012Wed Dec 5 17:04:00 201247512
    +- ++ + + +@@ -3750,7 +3749,7 @@ + +
    + +

    +@@ -3786,10 +3785,10 @@ + +

    MA0334.1 (MET32)MA0204.1 (Six4) +
    +-CGCCACA ++TGATAC +
    + +
    5 +-MA0079.2 (SP1),  MA0140.1 (Tal1::Gata1),  MA0067.1 (Pax2),  MA0080.1 (SPI1),  MA0047.1 (Foxa2) +-1MA0244.1 (slbo)
    + +@@ -3833,12 +3830,12 @@ + + + +- ++ + + +- +- +- ++ ++ ++ + +
    sample-dna-Klf1Fri May 9 16:51:44 2014Tue Oct 7 14:14:10 201490404935136070925170
    + +@@ -3861,32 +3858,39 @@ + + + ++ ++ ++ ++ ++ ++ ++ + +- ++ + + + + + + +- ++ + +- ++ + + +
    meme.xmlTue Oct 7 17:17:30 2014300
    dreme.xmlMon May 12 15:34:15 2014Tue Oct 7 17:17:48 2014300
    JASPAR CORE 2009Tue Dec 4 23:04:00 2012Wed Dec 5 17:04:00 2012475510
    +- +- ++

    Spacings of "MA0079.2 (SP1)" relative to "MA0334.1 (MET32)"

    ++ + +

    Spacings of "MA0244.1 (slbo)" relative to "MA0204.1 (Six4)"

    +-Previous Next Top ++Previous Next Top +
    +
    + + +- +- + + + +- ++ + +
    Primary: MA0334.1 (MET32) 
    ++
    Primary: MA0204.1 (Six4) 
    +
    Secondary: MA0079.2 (SP1) 
    ++
    Secondary: MA0244.1 (slbo) 
    +
    + E-value
    +@@ -3895,7 +3899,7 @@ +
    +
    +-CGCCACA ++TGATAC +
    + +
    +
    +-CCCCGCCCCC ++ATTGCAAA +
    + +
    0.000246.3
    + +@@ -3963,508 +3965,38 @@ + + + +- +- +- +- +-
    +- ++ + +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    5.1e-0709 
    +-
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    245

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0140.1 (Tal1::Gata1)" relative to "MA0334.1 (MET32)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: MA0334.1 (MET32) 
    +-
    Secondary: MA0140.1 (Tal1::Gata1) 
    +-
    +-E-value
    +-
    +-
    +-CGCCACA +-
    +- +-
    +-
    +-CTGGTGGGGACAGATAAG +-
    +- +-
    1.5
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.0031166 
    +-
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    231

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0067.1 (Pax2)" relative to "MA0334.1 (MET32)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: MA0334.1 (MET32) 
    +-
    Secondary: MA0067.1 (Pax2) 
    +-
    +-E-value
    +-
    +-
    +-CGCCACA +-
    +- +-
    +-
    +-AGTCACGC +-
    +- +-
    1.8
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.0038865 
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    146

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0080.1 (SPI1)" relative to "MA0334.1 (MET32)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: MA0334.1 (MET32) 
    +-
    Secondary: MA0080.1 (SPI1) 
    +-
    +-E-value
    +-
    +-
    +-CGCCACA +-
    +- +-
    +-
    +-CGGAAG +-
    +- +-
    3.6
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +- +-
    +-CAATATTTACTT +-
    +- +-
    8.7
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- + + +@@ -4664,7 +4038,7 @@ + PreviousTop + +
    +-
    SpaMo version
    4.10.0 (Release date: Tue May 06 16:46:04 2014 +1000) ++
    SpaMo version
    4.10.0 (Release date: Wed May 21 10:35:36 2014 +1000) +
    +
    +
    Reference
    +@@ -4676,7 +4050,7 @@ +
    +
    +
    Command line summary
    +-
    Result calculation took 12 seconds
    Note that the random number generator was initilized with a seed of 1 so you need ++
    Result calculation took 7 seconds
    Note that the random number generator was initilized with a seed of 1 so you need + "-numgen 1" in the list of arguments + to replicate the experiment. +
    +@@ -4695,9 +4069,9 @@ + redundant_joint = 0.5 + motif_pseudocount = 0.1 + motif_trim = 0.25 +-bin_max = 9 +-host = d-108-179-169-207.dhcp4.washington.edu +-when = Mon May 12 15:35:07 2014 ++bin_max = 4 ++host = IMB12-010665 ++when = Tue Oct 7 17:18:56 2014 + + + +diff -ruN a/doc/examples/memechip_example_output_files/spamo_out_5/spamo.xml b/doc/examples/memechip_example_output_files/spamo_out_5/spamo.xml +--- a/doc/examples/memechip_example_output_files/spamo_out_5/spamo.xml 2014-05-13 08:35:19.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/spamo_out_5/spamo.xml 2014-10-07 17:19:03.000000000 +1000 +@@ -63,9 +63,9 @@ + + + ]> +- ++ + +- spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_5 -bgfile memechip_example_output_files/background -primary MA0334.1 memechip_example_output_files/sample-dna-Klf1.fa JASPAR_CORE_2009.meme memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme ++ spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_5 -bgfile memechip_example_output_files/background -primary MA0204.1 memechip_example_output_files/sample-dna-Klf1.fa JASPAR_CORE_2009.meme memechip_example_output_files/meme_out/meme.xml memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme + 1 + 150 + 1 +@@ -78,2426 +78,45 @@ + 0.5 + 0.1 + 0.25 +- 9 +- d-108-179-169-207.dhcp4.washington.edu +- Mon May 12 15:35:07 2014 ++ 4 ++ IMB12-010665 ++ Tue Oct 7 17:18:56 2014 + + + +- +- ++ +- + + +- +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ + +- +- +- +- +- +- +- +- +- +- +- +- +- ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ + +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- ++ + + + +@@ -2505,10 +124,10 @@ + + + +- ++ + + +- ++ + + + +@@ -2518,93 +137,93 @@ + + + +- ++ + +- ++ + +- ++ + +- ++ + + + + + +- +- ++ ++ + + +- +- +- ++ ++ ++ + + + + + + +- ++ + + + + + + +- ++ + + + + + +- ++ + +- +- ++ ++ + + + + + + +- ++ + +- ++ + +- ++ + + + +- ++ + +- ++ + + +- +- ++ ++ + + + + +- ++ + + + + + + +- ++ + + +- ++ + +- ++ + +- +- +- +- ++ ++ ++ ++ + +- ++ + + + +@@ -2612,123 +231,127 @@ + + + +- +- ++ ++ + + + + + + +- +- ++ ++ + + + +- ++ + +- ++ + +- +- ++ ++ + +- ++ + + + + +- +- ++ ++ ++ ++ ++ ++ + + + + +- ++ + + +- ++ + +- +- ++ ++ + + +- ++ + +- +- +- ++ ++ ++ + + +- +- ++ ++ + +- ++ + + + +- ++ + +- +- ++ ++ + +- ++ + + + +- ++ + +- ++ + + + +- ++ + +- ++ + + + +- ++ + + + + +- +- ++ ++ + + + + +- ++ + + + +- +- ++ ++ + +- ++ + +- +- ++ ++ + +- ++ + + + + +- ++ + + + + + +- ++ + + +- ++ + + + +- ++ + + + +@@ -2736,17 +359,17 @@ + + + +- ++ + + + +- ++ + + + + +- +- ++ ++ + + + +@@ -2754,32 +377,36 @@ + + + +- ++ + + + + + + +- +- ++ ++ + + + + + + +- +- ++ ++ + + +- ++ + + + + + +- ++ ++ ++ ++ ++ + + + +@@ -2787,15 +414,15 @@ + + + +- +- ++ ++ + + +- ++ + + +- +- ++ ++ + + + +@@ -2805,31 +432,31 @@ + + + +- ++ + +- +- ++ ++ + +- ++ + + + + + +- ++ + +- ++ + + + + +- ++ + + + + + +- ++ + + + +@@ -2837,7 +464,7 @@ + + + +- ++ + + + +@@ -2858,36 +485,36 @@ + + + +- ++ + +- ++ + + + + + + +- ++ + + +- ++ + + + + + +- ++ + + + + +- ++ + + + + + +- ++ + + + +@@ -2895,9 +522,9 @@ + + + +- ++ + +- ++ + + + +@@ -2905,7 +532,7 @@ + + + +- ++ + + + +@@ -2918,92 +545,96 @@ + + + +- +- ++ ++ + + +- ++ ++ ++ ++ ++ + + + + +- ++ + +- ++ + +- ++ + + + + +- ++ + + + + +- ++ + + + + + +- ++ + + + + +- ++ + + + + + + +- ++ + + + + + + +- +- ++ ++ + + + + + + +- ++ + + + + + + +- +- ++ ++ + +- ++ + +- ++ + +- ++ + +- +- +- +- +- ++ ++ ++ ++ ++ + +- ++ + + + + +- ++ + +- ++ + + + +@@ -3013,25 +644,25 @@ + + + +- ++ + + +- ++ + + +- ++ + +- ++ + + + + + + +- ++ + + +- ++ + + + +@@ -3045,7 +676,7 @@ + + + +- ++ + + + +@@ -3053,8 +684,8 @@ + + + +- +- ++ ++ + + + +@@ -3064,10 +695,14 @@ + + + ++ ++ ++ ++ + + + + + +- ++ + +diff -ruN a/doc/examples/memechip_example_output_files/spamo_out_6/spamo.html b/doc/examples/memechip_example_output_files/spamo_out_6/spamo.html +--- a/doc/examples/memechip_example_output_files/spamo_out_6/spamo.html 2014-05-13 08:35:29.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/spamo_out_6/spamo.html 1970-01-01 10:00:00.000000000 +1000 +@@ -1,5977 +0,0 @@ +- +- +- +- +-SpaMo - Spaced Motif Analysis +- +- +- +- +-
    +-

    The name of the primary motif.

    +-
    [ +- close ]
    +-
    +-
    +-

    The logo of the primary motif.

    +-

    Sections of the motif with a gray background have been trimmed and +- were not used for scanning.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of secondary motifs found that had significant spacings in +- the tested region.

    +-
    [ +- close ]
    +-
    +-
    +-

    The list of secondary motifs found that had significant spacings in +- the tested region.

    +-
    [ +- close ]
    +-
    +-
    +-

    The name of the sequence database.

    +-
    [ +- close ]
    +-
    +-
    +-

    The last modified date of the sequence database.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of sequences in the sequence database.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of sequences in the sequence database which were excluded +- because they were shorter than twice the margin plus the primary motif +- length.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of sequences in the sequence database which were excluded +- because no match to the primary motif could be found at a distance to +- the edges larger than the margin.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of sequences in the sequence database which were excluded +- because they were largly identical to other sequences when aligned on +- the primary motif site.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of sequences which were scanned with the secondary +- motifs.

    +-
    [ +- close ]
    +-
    +-
    +-

    The name of the motif database derived from the file name.

    +-
    [ +- close ]
    +-
    +-
    +-

    The date that the motif database was last modified.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of motifs loaded from the motif database. Some motifs may +- have been excluded.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of motifs with significant E-values whose +- significant spacings were not considered too similar to those of another motif.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of motifs that while having significant spacings were less +- signficant than another motif that matched +- most of the same sites.

    +-
    [ +- close ]
    +-
    +-
    +-

    The primary motif is used as the reference point for all spacing +- calculation.

    +-

    Sections of the motif with a gray background have been trimmed and +- were not used for scanning.

    +-
    [ +- close ]
    +-
    +-
    +-

    The secondary motif occurs at the spacings relative to the primary +- shown in the histogram below.

    +-

    Sections of the motif with a gray background have been trimmed and +- were not used for scanning.

    +-
    [ +- close ]
    +-
    +-
    +-

    The E-value is the lowest p-value of any spacing of the +- secondary motif times the number of secondary motifs. +- It estimates the expected number of random secondary motifs that +- would have the observed minimum p-value or less. +-

    +-
    [ +- close ]
    +-
    +-
    +-

    The histogram below shows the frequency of spacings from the primary +- motif to the secondary motif. Red bars +- indicate that a spacing has occured a statistically significant number +- of times.

    +-
    +-
    Upstream
    +-
    These are sequences where the secondary motif occurs before the +- primary motif.
    +-
    Downstream
    +-
    These are sequences where the secondary motif occurs after the +- primary motif.
    +-
    Same Strand
    +-
    These are sequences where the secondary motif is on the same strand +- as the primary motif.
    +-
    Opposite Strand
    +-
    These are sequences where the secondary motif is on the opposite +- strand to the primary motif.
    +-
    +-
    [ +- close ]
    +-
    +-
    +-

    The details of the significant spacings are shown in the four +- quadrants as they relate to the quadrants of the graph.

    +-
    +-
    P-value
    +-
    is the probability of the observed number (or more) sequences +- having the observed spacing between the primary and secondary motif, +- adjusted for multiple tests. The number of multiple tests is the +- number of spacing bins (the number of bars in the histogram) +- tested for significance.
    +-
    Gap
    +-
    is the space between the primary and secondary motifs where a value +- of zero means there is no space between them.
    +-
    #
    +-
    is the number of sequences where that spacing was observed.
    +-
    +-
    [ +- close ]
    +-
    +-
    +-

    The total number of sequences that have a match for both the primary +- motif and this secondary motif.

    +-
    [ +- close ]
    +-
    +-
    +-

    The motif database which this secondary motif came from.

    +-
    [ +- close ]
    +-
    +-
    +-

    The list of secondary motifs which have been identified as possibly +- similar to this motif because their most significant spacings +- overlaped with the most significant spacing of this motif. Check the +- boxes to show the possibly similar secondary motifs.

    +-
    [ +- close ]
    +-
    +-
    +-

    This shows the first secondary motif aligned with the current +- secondary motif by the most significant spacing.

    +-

    Sections of the motif with a gray background have been trimmed and +- were not used for scanning.

    +-
    [ +- close ]
    +-
    +-
    +- +-

    +- For further information on how to interpret these results or to get a +- copy of the MEME software please access +- http://meme.nbcr.net. +-

    +-

    +- If you use SpaMo in your research please cite the following paper:
    +- Tom Whitington, Martin C. Frith, James Johnson and Timothy L. Bailey, +- "Inferring transcription factor complexes from ChIP-seq data", +- Nucleic Acids Research, 39(15):e98, 2011. +- [full text]

    +-
    +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    ++
    + + + +@@ -4642,18 +4015,19 @@ + + + +- +- ++ ++ + + + +
    P-valueGap 
    0.018280.013804 
    ++
    +
    +
    +
    +

    Total sequences with primary and secondary motif 
    +-

    98

    Motif Database 
    ++

    92

    Motif Database 
    +

    JASPAR CORE 2009
    +
    +- +- +-

    Primary Motif

    +-Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    Name 
    +-
    Preview 
    +-
    Significant Secondaries 
    +-
    List 
    +-
    MA0425.1 (YGR067C) +-
    +-ACCCCACTTTTTTA +-
    +- +-
    9 +-MA0309.1 (GZF3),  MA0039.1 (Klf4),  MA0338.1 (MIG2),  MA0448.1 (H2.0),  MA0337.1 (MIG1),  MA0453.1 (nub),  MA0375.1 (RSC30),  MA0079.1 (SP1),  MA0166.1 (Antp) +-
    +- +- +- +-

    Sequence Database

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Name 
    +-
    Last Modified 
    +-
    Loaded 
    +-
    Too Short 
    +-
    No Primary 
    +-
    Too Similar 
    +-
    Used 
    +-
    sample-dna-Klf1Fri May 9 16:51:44 2014904061326265
    +- +- +- +-

    Secondary Databases

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Name 
    +-
    Last Modified 
    +-
    Number of Motifs 
    +-
    Motifs Significant 
    +-
    Motifs Redundant 
    +-
    dreme.xmlMon May 12 15:34:15 2014301
    JASPAR CORE 2009Tue Dec 4 23:04:00 201247594
    +- +- +- +-

    Spacings of "MA0309.1 (GZF3)" relative to "MA0425.1 (YGR067C)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: MA0425.1 (YGR067C) 
    +-
    Secondary: MA0309.1 (GZF3) 
    +-
    +-E-value
    +-
    +-
    +-ACCCCACTTTTTTA +-
    +- +-
    +-
    +-TGATAAGA +-
    +- +-
    0.0037
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    7.8e-06257 
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    154

    Motif Database 
    +-

    JASPAR CORE 2009
    +-

    Secondary motifs with similar spacings 
    +-

    +-
    +- +-
    +-
    +-
    +-
    +- +- +- +- +- +- +- +-
    Similar Secondary: MA0300.1 (GAT1) +-
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.00012256 
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    139

    Alignment by most significant spacings 
    +-

    +- +- +- +- +- +- +- +- +- +-
    Best Similar
    Secondary
     TGATAAGA +-
    This Similar
    Secondary
    +-CCGATAAG +-
    +- +-
    +-
    +- +- +- +- +- +- +- +-
    Similar Secondary: TTATCW (DREME)
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.00021256 
    +-
    +-
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    155

    Alignment by most significant spacings 
    +-

    +- +- +- +- +- +- +- +- +- +-
    Best Similar
    Secondary
    +-TCTTATCA +-
    This Similar
    Secondary
      TTATCT +-
    +- +-
    +-
    +- +- +- +- +- +- +- +-
    Similar Secondary: MA0140.1 (Tal1::Gata1) +-
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.00057156 
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    172

    Alignment by most significant spacings 
    +-

    +- +- +- +- +- +- +- +- +- +-
    Best Similar
    Secondary
               TGATAAGA +-
    This Similar
    Secondary
    +-CTGGTGGGGACAGATAAG +-
    +- +-
    +-
    +- +- +- +- +- +- +- +-
    Similar Secondary: MA0289.1 (DAL80) +-
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.0024255 
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    133

    Alignment by most significant spacings 
    +-

    +- +- +- +- +- +- +- +- +- +-
    Best Similar
    Secondary
    +-TGATAAGA +-
    This Similar
    Secondary
    +-CGATAAG +-
    +- +-
    +-
    +- +- +- +- +- +- +- +-
    Similar Secondary: MA0035.2 (Gata1) +-
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.014255 
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    190

    Alignment by most significant spacings 
    +-

    +- +- +- +- +- +- +- +- +- +-
    Best Similar
    Secondary
      TGATAAGA +-
    This Similar
    Secondary
    +-ACAGATAAGAA +-
    +- +-
    +- +-
    +- +- +- +-

    Spacings of "MA0039.1 (Klf4)" relative to "MA0425.1 (YGR067C)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: MA0425.1 (YGR067C) 
    +-
    Secondary: MA0039.1 (Klf4) 
    +-
    +-E-value
    +-
    +-
    +-ACCCCACTTTTTTA +-
    +- +-
    +-
    +-TAAAGGAAGG +-
    +- +-
    0.72
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.001506 
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    212

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0338.1 (MIG2)" relative to "MA0425.1 (YGR067C)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: MA0425.1 (YGR067C) 
    +-
    Secondary: MA0338.1 (MIG2) 
    +-
    +-E-value
    +-
    +-
    +-ACCCCACTTTTTTA +-
    +- +-
    +-
    +-CCCCGCA +-
    +- +-
    2.4
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.005105 
    +-
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    156

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0448.1 (H2.0)" relative to "MA0425.1 (YGR067C)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: MA0425.1 (YGR067C) 
    +-
    Secondary: MA0448.1 (H2.0) 
    +-
    +-E-value
    +-
    +-
    +-ACCCCACTTTTTTA +-
    +- +-
    +-
    +-TTAATTA +-
    +- +-
    3.4
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.0071994 
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    79

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0337.1 (MIG1)" relative to "MA0425.1 (YGR067C)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: MA0425.1 (YGR067C) 
    +-
    Secondary: MA0337.1 (MIG1) 
    +-
    +-E-value
    +-
    +-
    +-ACCCCACTTTTTTA +-
    +- +-
    +-
    +-CCCCCGC +-
    +- +-
    3.7
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.007705 
    +-
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    170

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0453.1 (nub)" relative to "MA0425.1 (YGR067C)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: MA0425.1 (YGR067C) 
    +-
    Secondary: MA0453.1 (nub) 
    +-
    +-E-value
    +-
    +-
    +-ACCCCACTTTTTTA +-
    +- +-
    +-
    +-TATGCAAATTAG +-
    +- +-
    6.6
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.01453 
    +-
    +-
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    31

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0375.1 (RSC30)" relative to "MA0425.1 (YGR067C)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: MA0425.1 (YGR067C) 
    +-
    Secondary: MA0375.1 (RSC30) 
    +-
    +-E-value
    +-
    +-
    +-ACCCCACTTTTTTA +-
    +- +-
    +-
    +-CGCGCGCG +-
    +- +-
    9
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.019373 
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    35

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0079.1 (SP1)" relative to "MA0425.1 (YGR067C)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: MA0425.1 (YGR067C) 
    +-
    Secondary: MA0079.1 (SP1) 
    +-
    +-E-value
    +-
    +-
    +-ACCCCACTTTTTTA +-
    +- +-
    +-
    +-GGGGCGGGGT +-
    +- +-
    9.3
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.0191205 
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    204

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0166.1 (Antp)" relative to "MA0425.1 (YGR067C)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: MA0425.1 (YGR067C) 
    +-
    Secondary: MA0166.1 (Antp) 
    +-
    +-E-value
    +-
    +-
    +-ACCCCACTTTTTTA +-
    +- +-
    +-
    +-TTAATGA +-
    +- +-
    9.8
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.02993 
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    36

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +-
    +- +-
    +-
    SpaMo version
    4.10.0 (Release date: Tue May 06 16:46:04 2014 +1000) +-
    +-
    +-
    Reference
    +- +- Tom Whitington, Martin C. Frith, James Johnson and Timothy L. Bailey, +- "Inferring transcription factor complexes from ChIP-seq data", +- Nucleic Acids Research, 39(15):e98, 2011. +- +-
    +-
    +-
    Command line summary
    +-
    Result calculation took 9 seconds
    Note that the random number generator was initilized with a seed of 1 so you need +- "-numgen 1" in the list of arguments +- to replicate the experiment. +-
    +-show model parameters... +- +-
    +-




















































    +- +- +diff -ruN a/doc/examples/memechip_example_output_files/spamo_out_6/spamo.xml b/doc/examples/memechip_example_output_files/spamo_out_6/spamo.xml +--- a/doc/examples/memechip_example_output_files/spamo_out_6/spamo.xml 2014-05-13 08:35:28.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/spamo_out_6/spamo.xml 1970-01-01 10:00:00.000000000 +1000 +@@ -1,8509 +0,0 @@ +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-]> +- +- +- spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_6 -bgfile memechip_example_output_files/background -primary MA0425.1 memechip_example_output_files/sample-dna-Klf1.fa JASPAR_CORE_2009.meme memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme +- 1 +- 150 +- 1 +- 150 +- 0.05 +- 10 +- 0.5 +- 7 +- 2 +- 0.5 +- 0.1 +- 0.25 +- 7 +- d-108-179-169-207.dhcp4.washington.edu +- Mon May 12 15:35:19 2014 +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +diff -ruN a/doc/examples/memechip_example_output_files/spamo_out_7/spamo.html b/doc/examples/memechip_example_output_files/spamo_out_7/spamo.html +--- a/doc/examples/memechip_example_output_files/spamo_out_7/spamo.html 2014-05-13 08:35:38.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/spamo_out_7/spamo.html 1970-01-01 10:00:00.000000000 +1000 +@@ -1,4698 +0,0 @@ +- +- +- +- +-SpaMo - Spaced Motif Analysis +- +- +- +- +-
    +-

    The name of the primary motif.

    +-
    [ +- close ]
    +-
    +-
    +-

    The logo of the primary motif.

    +-

    Sections of the motif with a gray background have been trimmed and +- were not used for scanning.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of secondary motifs found that had significant spacings in +- the tested region.

    +-
    [ +- close ]
    +-
    +-
    +-

    The list of secondary motifs found that had significant spacings in +- the tested region.

    +-
    [ +- close ]
    +-
    +-
    +-

    The name of the sequence database.

    +-
    [ +- close ]
    +-
    +-
    +-

    The last modified date of the sequence database.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of sequences in the sequence database.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of sequences in the sequence database which were excluded +- because they were shorter than twice the margin plus the primary motif +- length.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of sequences in the sequence database which were excluded +- because no match to the primary motif could be found at a distance to +- the edges larger than the margin.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of sequences in the sequence database which were excluded +- because they were largly identical to other sequences when aligned on +- the primary motif site.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of sequences which were scanned with the secondary +- motifs.

    +-
    [ +- close ]
    +-
    +-
    +-

    The name of the motif database derived from the file name.

    +-
    [ +- close ]
    +-
    +-
    +-

    The date that the motif database was last modified.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of motifs loaded from the motif database. Some motifs may +- have been excluded.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of motifs with significant E-values whose +- significant spacings were not considered too similar to those of another motif.

    +-
    [ +- close ]
    +-
    +-
    +-

    The number of motifs that while having significant spacings were less +- signficant than another motif that matched +- most of the same sites.

    +-
    [ +- close ]
    +-
    +-
    +-

    The primary motif is used as the reference point for all spacing +- calculation.

    +-

    Sections of the motif with a gray background have been trimmed and +- were not used for scanning.

    +-
    [ +- close ]
    +-
    +-
    +-

    The secondary motif occurs at the spacings relative to the primary +- shown in the histogram below.

    +-

    Sections of the motif with a gray background have been trimmed and +- were not used for scanning.

    +-
    [ +- close ]
    +-
    +-
    +-

    The E-value is the lowest p-value of any spacing of the +- secondary motif times the number of secondary motifs. +- It estimates the expected number of random secondary motifs that +- would have the observed minimum p-value or less. +-

    +-
    [ +- close ]
    +-
    +-
    +-

    The histogram below shows the frequency of spacings from the primary +- motif to the secondary motif. Red bars +- indicate that a spacing has occured a statistically significant number +- of times.

    +-
    +-
    Upstream
    +-
    These are sequences where the secondary motif occurs before the +- primary motif.
    +-
    Downstream
    +-
    These are sequences where the secondary motif occurs after the +- primary motif.
    +-
    Same Strand
    +-
    These are sequences where the secondary motif is on the same strand +- as the primary motif.
    +-
    Opposite Strand
    +-
    These are sequences where the secondary motif is on the opposite +- strand to the primary motif.
    +-
    +-
    [ +- close ]
    +-
    +-
    +-

    The details of the significant spacings are shown in the four +- quadrants as they relate to the quadrants of the graph.

    +-
    +-
    P-value
    +-
    is the probability of the observed number (or more) sequences +- having the observed spacing between the primary and secondary motif, +- adjusted for multiple tests. The number of multiple tests is the +- number of spacing bins (the number of bars in the histogram) +- tested for significance.
    +-
    Gap
    +-
    is the space between the primary and secondary motifs where a value +- of zero means there is no space between them.
    +-
    #
    +-
    is the number of sequences where that spacing was observed.
    +-
    +-
    [ +- close ]
    +-
    +-
    +-

    The total number of sequences that have a match for both the primary +- motif and this secondary motif.

    +-
    [ +- close ]
    +-
    +-
    +-

    The motif database which this secondary motif came from.

    +-
    [ +- close ]
    +-
    +-
    +-

    The list of secondary motifs which have been identified as possibly +- similar to this motif because their most significant spacings +- overlaped with the most significant spacing of this motif. Check the +- boxes to show the possibly similar secondary motifs.

    +-
    [ +- close ]
    +-
    +-
    +-

    This shows the first secondary motif aligned with the current +- secondary motif by the most significant spacing.

    +-

    Sections of the motif with a gray background have been trimmed and +- were not used for scanning.

    +-
    [ +- close ]
    +-
    +-
    +- +-

    +- For further information on how to interpret these results or to get a +- copy of the MEME software please access +- http://meme.nbcr.net. +-

    +-

    +- If you use SpaMo in your research please cite the following paper:
    +- Tom Whitington, Martin C. Frith, James Johnson and Timothy L. Bailey, +- "Inferring transcription factor complexes from ChIP-seq data", +- Nucleic Acids Research, 39(15):e98, 2011. +- [full text]

    +-
    +- +- +- +- +-

    Primary Motif

    +-Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    Name 
    +-
    Preview 
    +-
    Significant Secondaries 
    +-
    List 
    +-
    MA0027.1 (En1) +-
    +-AAGTAGTGTTC +-
    +- +-
    5 +-MA0212.1 (bcd),  MA0079.2 (SP1),  MA0035.2 (Gata1),  MA0201.1 (Ptx1),  MA0214.1 (bsh) +-
    +- +- +- +-

    Sequence Database

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Name 
    +-
    Last Modified 
    +-
    Loaded 
    +-
    Too Short 
    +-
    No Primary 
    +-
    Too Similar 
    +-
    Used 
    +-
    sample-dna-Klf1Fri May 9 16:51:44 2014904059034280
    +- +- +- +-

    Secondary Databases

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Name 
    +-
    Last Modified 
    +-
    Number of Motifs 
    +-
    Motifs Significant 
    +-
    Motifs Redundant 
    +-
    dreme.xmlMon May 12 15:34:15 2014300
    JASPAR CORE 2009Tue Dec 4 23:04:00 201247550
    +- +- +- +-

    Spacings of "MA0212.1 (bcd)" relative to "MA0027.1 (En1)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: MA0027.1 (En1) 
    +-
    Secondary: MA0212.1 (bcd) 
    +-
    +-E-value
    +-
    +-
    +-AAGTAGTGTTC +-
    +- +-
    +-
    +-TAATCC +-
    +- +-
    0.22
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.00045255 
    +-
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    95

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0079.2 (SP1)" relative to "MA0027.1 (En1)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: MA0027.1 (En1) 
    +-
    Secondary: MA0079.2 (SP1) 
    +-
    +-E-value
    +-
    +-
    +-AAGTAGTGTTC +-
    +- +-
    +-
    +-CCCCGCCCCC +-
    +- +-
    5
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.0115 
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    177

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0035.2 (Gata1)" relative to "MA0027.1 (En1)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: MA0027.1 (En1) 
    +-
    Secondary: MA0035.2 (Gata1) 
    +-
    +-E-value
    +-
    +-
    +-AAGTAGTGTTC +-
    +- +-
    +-
    +-ACAGATAAGAA +-
    +- +-
    7
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.01585 
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    193

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0201.1 (Ptx1)" relative to "MA0027.1 (En1)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: MA0027.1 (En1) 
    +-
    Secondary: MA0201.1 (Ptx1) 
    +-
    +-E-value
    +-
    +-
    +-AAGTAGTGTTC +-
    +- +-
    +-
    +-TTAATCC +-
    +- +-
    7.5
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.016243 
    +-
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    33

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +- +- +- +-

    Spacings of "MA0214.1 (bsh)" relative to "MA0027.1 (En1)"

    +-Previous Next Top +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +-
    Primary: MA0027.1 (En1) 
    +-
    Secondary: MA0214.1 (bsh) 
    +-
    +-E-value
    +-
    +-
    +-AAGTAGTGTTC +-
    +- +-
    +-
    +-TTAATTG +-
    +- +-
    9.5
    +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-
    Motif Spacing Histogram 
    +-
     Significant Motif Spacings (p<0.05) 
    +-
     
    UpstreamDownstream UpstreamDownstreamOther Details
    +- +- +-
    +-
    Same Strand
    +-
    Opposite Strand
    +-
    +-
    +- +- +- +- +- +- +- +- +- +- +- +- +-
    P-valueGap# 
    0.02734 
    +-
    +-
    +-
    +-
    +-

    Total sequences with primary and secondary motif 
    +-

    103

    Motif Database 
    +-

    JASPAR CORE 2009
    +-
    +-
    +-
    +- +-
    +-
    SpaMo version
    4.10.0 (Release date: Tue May 06 16:46:04 2014 +1000) +-
    +-
    +-
    Reference
    +- +- Tom Whitington, Martin C. Frith, James Johnson and Timothy L. Bailey, +- "Inferring transcription factor complexes from ChIP-seq data", +- Nucleic Acids Research, 39(15):e98, 2011. +- +-
    +-
    +-
    Command line summary
    +-
    Result calculation took 9 seconds
    Note that the random number generator was initilized with a seed of 1 so you need +- "-numgen 1" in the list of arguments +- to replicate the experiment. +-
    +-show model parameters... +- +-
    +-




















































    +- +- +diff -ruN a/doc/examples/memechip_example_output_files/spamo_out_7/spamo.xml b/doc/examples/memechip_example_output_files/spamo_out_7/spamo.xml +--- a/doc/examples/memechip_example_output_files/spamo_out_7/spamo.xml 2014-05-13 08:35:38.000000000 +1000 ++++ b/doc/examples/memechip_example_output_files/spamo_out_7/spamo.xml 1970-01-01 10:00:00.000000000 +1000 +@@ -1,3120 +0,0 @@ +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +-]> +- +- +- spamo -verbosity 1 -oc memechip_example_output_files/spamo_out_7 -bgfile memechip_example_output_files/background -primary MA0027.1 memechip_example_output_files/sample-dna-Klf1.fa JASPAR_CORE_2009.meme memechip_example_output_files/dreme_out/dreme.xml JASPAR_CORE_2009.meme +- 1 +- 150 +- 1 +- 150 +- 0.05 +- 10 +- 0.5 +- 7 +- 2 +- 0.5 +- 0.1 +- 0.25 +- 5 +- d-108-179-169-207.dhcp4.washington.edu +- Mon May 12 15:35:29 2014 +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +- +diff -ruN a/doc/examples/meme_example_output_files/logo1.eps b/doc/examples/meme_example_output_files/logo1.eps +--- a/doc/examples/meme_example_output_files/logo1.eps 2014-05-13 08:33:43.000000000 +1000 ++++ b/doc/examples/meme_example_output_files/logo1.eps 2014-10-07 16:20:13.000000000 +1000 +@@ -1,7 +1,7 @@ + %!PS-Adobe-3.0 EPSF-3.0 + %%Title: Sequence Logo : + %%Creator: Ceqlogo +-%%CreationDate: 12.05.14 15:33:43 ++%%CreationDate: 07.10.14 16:20:13 + %%BoundingBox: 0 0 566 212 + %%Pages: 0 + %%DocumentFonts: +@@ -64,7 +64,7 @@ + /showEnds (false) def + + /showFineprint true def +-/fineprint (MEME (no SSC) 12.05.14 15:33) def ++/fineprint (MEME (no SSC) 07.10.14 16:20) def + + /charsPerLine 18 def + +Binary files a/doc/examples/meme_example_output_files/logo1.png and b/doc/examples/meme_example_output_files/logo1.png differ +diff -ruN a/doc/examples/meme_example_output_files/logo2.eps b/doc/examples/meme_example_output_files/logo2.eps +--- a/doc/examples/meme_example_output_files/logo2.eps 2014-05-13 08:33:44.000000000 +1000 ++++ b/doc/examples/meme_example_output_files/logo2.eps 2014-10-07 16:20:14.000000000 +1000 +@@ -1,7 +1,7 @@ + %!PS-Adobe-3.0 EPSF-3.0 + %%Title: Sequence Logo : + %%Creator: Ceqlogo +-%%CreationDate: 12.05.14 15:33:44 ++%%CreationDate: 07.10.14 16:20:14 + %%BoundingBox: 0 0 283 212 + %%Pages: 0 + %%DocumentFonts: +@@ -64,7 +64,7 @@ + /showEnds (false) def + + /showFineprint true def +-/fineprint (MEME (no SSC) 12.05.14 15:33) def ++/fineprint (MEME (no SSC) 07.10.14 16:20) def + + /charsPerLine 8 def + +Binary files a/doc/examples/meme_example_output_files/logo2.png and b/doc/examples/meme_example_output_files/logo2.png differ +diff -ruN a/doc/examples/meme_example_output_files/logo3.eps b/doc/examples/meme_example_output_files/logo3.eps +--- a/doc/examples/meme_example_output_files/logo3.eps 2014-05-13 08:33:45.000000000 +1000 ++++ b/doc/examples/meme_example_output_files/logo3.eps 2014-10-07 16:20:15.000000000 +1000 +@@ -1,7 +1,7 @@ + %!PS-Adobe-3.0 EPSF-3.0 + %%Title: Sequence Logo : + %%Creator: Ceqlogo +-%%CreationDate: 12.05.14 15:33:45 ++%%CreationDate: 07.10.14 16:20:15 + %%BoundingBox: 0 0 368 212 + %%Pages: 0 + %%DocumentFonts: +@@ -64,7 +64,7 @@ + /showEnds (false) def + + /showFineprint true def +-/fineprint (MEME (no SSC) 12.05.14 15:33) def ++/fineprint (MEME (no SSC) 07.10.14 16:20) def + + /charsPerLine 11 def + +Binary files a/doc/examples/meme_example_output_files/logo3.png and b/doc/examples/meme_example_output_files/logo3.png differ +diff -ruN a/doc/examples/meme_example_output_files/logo_rc1.eps b/doc/examples/meme_example_output_files/logo_rc1.eps +--- a/doc/examples/meme_example_output_files/logo_rc1.eps 2014-05-13 08:33:43.000000000 +1000 ++++ b/doc/examples/meme_example_output_files/logo_rc1.eps 2014-10-07 16:20:13.000000000 +1000 +@@ -1,7 +1,7 @@ + %!PS-Adobe-3.0 EPSF-3.0 + %%Title: Sequence Logo : + %%Creator: Ceqlogo +-%%CreationDate: 12.05.14 15:33:43 ++%%CreationDate: 07.10.14 16:20:13 + %%BoundingBox: 0 0 566 212 + %%Pages: 0 + %%DocumentFonts: +@@ -64,7 +64,7 @@ + /showEnds (false) def + + /showFineprint true def +-/fineprint (MEME (no SSC) 12.05.14 15:33) def ++/fineprint (MEME (no SSC) 07.10.14 16:20) def + + /charsPerLine 18 def + +Binary files a/doc/examples/meme_example_output_files/logo_rc1.png and b/doc/examples/meme_example_output_files/logo_rc1.png differ +diff -ruN a/doc/examples/meme_example_output_files/logo_rc2.eps b/doc/examples/meme_example_output_files/logo_rc2.eps +--- a/doc/examples/meme_example_output_files/logo_rc2.eps 2014-05-13 08:33:44.000000000 +1000 ++++ b/doc/examples/meme_example_output_files/logo_rc2.eps 2014-10-07 16:20:14.000000000 +1000 +@@ -1,7 +1,7 @@ + %!PS-Adobe-3.0 EPSF-3.0 + %%Title: Sequence Logo : + %%Creator: Ceqlogo +-%%CreationDate: 12.05.14 15:33:44 ++%%CreationDate: 07.10.14 16:20:14 + %%BoundingBox: 0 0 283 212 + %%Pages: 0 + %%DocumentFonts: +@@ -64,7 +64,7 @@ + /showEnds (false) def + + /showFineprint true def +-/fineprint (MEME (no SSC) 12.05.14 15:33) def ++/fineprint (MEME (no SSC) 07.10.14 16:20) def + + /charsPerLine 8 def + +Binary files a/doc/examples/meme_example_output_files/logo_rc2.png and b/doc/examples/meme_example_output_files/logo_rc2.png differ +diff -ruN a/doc/examples/meme_example_output_files/logo_rc3.eps b/doc/examples/meme_example_output_files/logo_rc3.eps +--- a/doc/examples/meme_example_output_files/logo_rc3.eps 2014-05-13 08:33:45.000000000 +1000 ++++ b/doc/examples/meme_example_output_files/logo_rc3.eps 2014-10-07 16:20:16.000000000 +1000 +@@ -1,7 +1,7 @@ + %!PS-Adobe-3.0 EPSF-3.0 + %%Title: Sequence Logo : + %%Creator: Ceqlogo +-%%CreationDate: 12.05.14 15:33:45 ++%%CreationDate: 07.10.14 16:20:16 + %%BoundingBox: 0 0 368 212 + %%Pages: 0 + %%DocumentFonts: +@@ -64,7 +64,7 @@ + /showEnds (false) def + + /showFineprint true def +-/fineprint (MEME (no SSC) 12.05.14 15:33) def ++/fineprint (MEME (no SSC) 07.10.14 16:20) def + + /charsPerLine 11 def + +Binary files a/doc/examples/meme_example_output_files/logo_rc3.png and b/doc/examples/meme_example_output_files/logo_rc3.png differ +diff -ruN a/doc/examples/meme_example_output_files/meme.html b/doc/examples/meme_example_output_files/meme.html +--- a/doc/examples/meme_example_output_files/meme.html 2014-05-13 08:33:46.000000000 +1000 ++++ b/doc/examples/meme_example_output_files/meme.html 2014-10-07 16:20:16.000000000 +1000 +@@ -8,7 +8,7 @@ + var data = { + "program": "MEME", + "version": "4.10.0", +- "release": "Tue May 06 16:46:04 2014 +1000", ++ "release": "Wed May 21 10:35:36 2014 +1000", + "cmd": [ + "meme", "crp0.s", "-oc", "meme_example_output_files", "-dna", + "-mod", "zoops", "-nmotifs", "3", "-revcomp" +@@ -115,7 +115,7 @@ + "re": 14.4, + "llr": 180, + "bt": 6.57872, +- "time": 1.222580, ++ "time": 1.277818, + "psm": [ + [101, -1081, -182, 13], [87, -1081, -82, 13], + [-45, -23, 18, 35], [-1081, -82, -1081, 155], +@@ -305,7 +305,7 @@ + "re": 17.5, + "llr": 24, + "bt": 9.783, +- "time": 2.064601, ++ "time": 2.138241, + "psm": [ + [-765, 235, -765, -765], [-765, -765, 235, -765], + [-765, -765, 235, -765], [-765, 135, -765, 71], +@@ -352,7 +352,7 @@ + "re": 22.3, + "llr": 31, + "bt": 9.73809, +- "time": 2.899839, ++ "time": 2.996712, + "psm": [ + [-765, 235, -765, -765], [-765, 235, -765, -765], + [-765, -765, -765, 171], [-765, -765, 235, -765], +@@ -601,7 +601,7 @@ + }; + + + + +-9 ++10 + +-MA0309.1 (GZF3),  MA0289.1 (DAL80),  MA0300.1 (GAT1),  MA0307.1 (GLN3),  MA0140.1 (Tal1::Gata1),  MA0037.1 (GATA3),  MA0429.1 (YLL054C),  MA0013.1 (br Z4),  MA0217.1 (caup) ++MA0309.1 (GZF3),  MA0289.1 (DAL80),  MA0300.1 (GAT1),  MA0307.1 (GLN3),  MA0140.1 (Tal1::Gata1),  MA0037.1 (GATA3),  MA0429.1 (YLL054C),  MA0013.1 (br Z4),  MA0217.1 (caup),  MA0087.1 (Sox5) + + +
    +@@ -3836,7 +3836,7 @@ + + + sample-dna-Klf1 +-Fri May 9 16:51:44 2014 ++Tue Oct 7 14:14:10 2014 + 904 + 0 + 392 +@@ -3865,9 +3865,9 @@ + + + JASPAR CORE 2009 +-Tue Dec 4 23:04:00 2012 ++Wed Dec 5 17:04:00 2012 + 475 +-9 ++10 + 1 + + +@@ -3969,15 +3969,15 @@ + "0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + + "0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + + "% Same Right\n" + +- "0 1 0 1 0 1 3 1 2 1 0 1 3 1 0 1 0 1 0 1 1 1 1 1 2 1 0 1 2 1 6 0.0063 2 1 3 1 2 1 1 1 0 1 1 1 2 1 0 1 10 5.8e-08 0 1 5 0.077 2 1 2 1 2 1 1 1 1 1 0 1 0 1 2 1 0 1 1 1 2 1 2 1 2 1\n" + ++ "0 1 0 1 0 1 3 1 2 1 0 1 3 1 0 1 0 1 0 1 1 1 1 1 2 1 0 1 2 1 6 0.0063 2 1 3 1 2 1 1 1 1 1 1 1 2 1 0 1 10 5.8e-08 0 1 5 0.077 2 1 2 1 2 1 1 1 1 1 0 1 0 1 2 1 0 1 1 1 2 1 1 1 2 1\n" + + "2 1 1 1 2 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 1 1 1 1 2 1 1 1 1 1 0 1 0 1 0 1 2 1 0 1 1 1 0 1 2 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 2 1\n" + + "0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1\n" + + "0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + + "% Opposite Left\n" + +- "0 1 0 1 1 1 1 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 2 1 4 0.58 2 1 1 1 0 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 0 1 0 1 1 1 3 1 1 1 2 1 1 1 0 1 1 1 2 1 1 1 1 1 0 1 1 1 0 1\n" + ++ "0 1 0 1 1 1 1 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 2 1 4 0.58 2 1 1 1 0 1 1 1 2 1 0 1 1 1 1 1 1 1 1 1 1 1 0 1 0 1 1 1 3 1 1 1 2 1 1 1 0 1 1 1 2 1 1 1 1 1 0 1 1 1 0 1\n" + + "1 1 0 1 0 1 0 1 1 1 2 1 1 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 1 1 1 1 2 1 0 1 0 1 1 1 0 1 2 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1\n" + +- "0 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 2 1 0 1 0 1 0 1 0 1 1 1 2 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1\n" + +- "0 1 1 1 0 1 1 1 2 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + ++ "0 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 2 1 0 1 0 1 0 1 0 1 1 1 2 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1\n" + ++ "0 1 1 1 0 1 0 1 2 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + + "% Opposite Right\n" + + "1 1 5 0.077 0 1 1 1 0 1 1 1 1 1 0 1 0 1 1 1 1 1 1 1 2 1 3 1 1 1 0 1 1 1 1 1 2 1 2 1 0 1 1 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 1 1 0 1 1 1 1 1 0 1 3 1 1 1\n" + + "0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 2 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1\n" + +@@ -4130,14 +4130,14 @@ + "0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + + "0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + + "% Same Right\n" + +- "0 1 0 1 0 1 3 0.99 2 1 0 1 3 0.99 0 1 0 1 0 1 0 1 1 1 2 1 0 1 1 1 5 0.04 2 1 2 1 2 1 1 1 0 1 1 1 2 1 0 1 9 3.5e-07 0 1 2 1 1 1 1 1 2 1 1 1 1 1 0 1 0 1 2 1 0 1 1 1 2 1 2 1 2 1\n" + +- "2 1 0 1 1 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 2 1 1 1 2 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 2 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 2 1\n" + ++ "0 1 0 1 0 1 3 0.99 2 1 0 1 3 0.99 0 1 0 1 0 1 0 1 1 1 2 1 0 1 2 1 5 0.04 3 0.99 2 1 2 1 1 1 1 1 1 1 2 1 0 1 9 3.5e-07 0 1 2 1 1 1 1 1 2 1 1 1 1 1 0 1 0 1 2 1 0 1 1 1 2 1 1 1 2 1\n" + ++ "2 1 0 1 1 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 2 1 1 1 1 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 2 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 2 1\n" + + "0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1\n" + +- "0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + ++ "0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + + "% Opposite Left\n" + +- "0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 1 1 4 0.39 2 1 1 1 0 1 1 1 1 1 0 1 1 1 0 1 1 1 1 1 1 1 0 1 0 1 3 0.99 3 0.99 1 1 2 1 1 1 0 1 0 1 2 1 0 1 1 1 0 1 1 1 0 1\n" + ++ "0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 1 4 0.39 2 1 1 1 0 1 1 1 0 1 0 1 1 1 0 1 1 1 1 1 1 1 0 1 0 1 3 0.99 3 0.99 1 1 2 1 1 1 0 1 0 1 2 1 0 1 1 1 0 1 1 1 0 1\n" + + "1 1 0 1 0 1 1 1 1 1 2 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 1 1 1 1 2 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1\n" + +- "0 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 2 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1\n" + ++ "0 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 2 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1\n" + + "0 1 0 1 0 1 1 1 2 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + + "% Opposite Right\n" + + "1 1 5 0.04 0 1 1 1 0 1 1 1 1 1 0 1 0 1 1 1 1 1 1 1 2 1 3 0.99 1 1 0 1 1 1 1 1 2 1 2 1 0 1 1 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 2 1 2 1\n" + +@@ -4305,17 +4305,17 @@ + "0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + + "0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + + "% Same Right\n" + +- "0 1 0 1 0 1 3 1 2 1 0 1 2 1 0 1 0 1 0 1 0 1 1 1 2 1 0 1 1 1 5 0.049 2 1 2 1 2 1 1 1 0 1 1 1 2 1 0 1 8 1.1e-05 0 1 3 1 1 1 1 1 3 1 1 1 1 1 0 1 0 1 3 1 0 1 1 1 2 1 2 1 2 1\n" + ++ "0 1 0 1 0 1 3 1 2 1 0 1 2 1 0 1 0 1 0 1 0 1 1 1 2 1 0 1 1 1 5 0.049 2 1 2 1 2 1 1 1 1 1 1 1 2 1 0 1 8 1.1e-05 0 1 3 1 1 1 1 1 3 1 1 1 1 1 0 1 0 1 3 1 0 1 1 1 2 1 1 1 2 1\n" + + "2 1 0 1 2 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 2 1 1 1 1 1 0 1 0 1 1 1 3 1 0 1 1 1 0 1 2 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 2 1\n" + + "0 1 0 1 0 1 0 1 0 1 1 1 1 1 1 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1\n" + + "0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + + "% Opposite Left\n" + +- "0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 2 1 5 0.049 2 1 1 1 0 1 1 1 1 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 0 1 2 1 3 1 1 1 2 1 1 1 0 1 0 1 2 1 1 1 1 1 0 1 1 1 0 1\n" + ++ "0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 2 1 5 0.049 2 1 1 1 0 1 1 1 2 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 2 1 3 1 1 1 2 1 1 1 0 1 0 1 2 1 1 1 1 1 0 1 1 1 0 1\n" + + "0 1 0 1 0 1 0 1 1 1 2 1 1 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 1 1 1 2 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1\n" + +- "0 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 2 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1\n" + +- "0 1 1 1 0 1 1 1 2 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + ++ "0 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 2 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1\n" + ++ "0 1 1 1 0 1 0 1 2 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + + "% Opposite Right\n" + +- "1 1 3 1 0 1 1 1 0 1 1 1 1 1 0 1 0 1 1 1 1 1 1 1 2 1 3 1 1 1 0 1 1 1 1 1 2 1 2 1 0 1 1 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 3 1 1 1\n" + ++ "1 1 3 1 0 1 1 1 0 1 1 1 1 1 0 1 0 1 1 1 1 1 1 1 2 1 3 1 1 1 1 1 1 1 1 1 2 1 2 1 0 1 1 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 3 1 1 1\n" + + "0 1 0 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1\n" + + "2 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 3 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1\n" + + "0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" +@@ -4472,24 +4472,24 @@ + "% Input Data\n" + + "150 margin 5 motif-length 1 bin-size 10 bin-max 378 sequences 0.05 threshold\n\n" + + "% Same Left\n" + +- "1 1 0 1 5 0.27 1 1 1 1 1 1 0 1 0 1 2 1 1 1 3 1 1 1 2 1 1 1 2 1 1 1 1 1 1 1 0 1 1 1 1 1 3 1 2 1 1 1 0 1 0 1 0 1 0 1 1 1 2 1 1 1 1 1 0 1 1 1 1 1 1 1 0 1 0 1 1 1 1 1\n" + +- "1 1 2 1 0 1 2 1 0 1 0 1 1 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 0 1 2 1 0 1 1 1 1 1 1 1 0 1 0 1\n" + +- "0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 1 1 0 1 0 1 1 1 0 1 0 1 2 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + +- "2 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1\n\n" + ++ "1 1 0 1 5 0.27 1 1 1 1 1 1 0 1 0 1 2 1 1 1 3 1 1 1 2 1 1 1 2 1 0 1 0 1 1 1 0 1 1 1 1 1 4 0.92 2 1 1 1 0 1 0 1 0 1 0 1 1 1 2 1 1 1 1 1 0 1 1 1 1 1 1 1 0 1 0 1 1 1 1 1\n" + ++ "1 1 2 1 0 1 2 1 0 1 0 1 1 1 1 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 0 1 2 1 0 1 1 1 1 1 1 1 0 1 0 1\n" + ++ "0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 1 1 0 1 0 1 1 1 0 1 0 1 2 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + ++ "2 1 0 1 2 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1\n\n" + + "% Same Right\n" + +- "0 1 0 1 1 1 1 1 2 1 1 1 1 1 2 1 0 1 1 1 2 1 0 1 1 1 2 1 0 1 2 1 7 0.003 2 1 2 1 2 1 1 1 0 1 1 1 4 0.92 3 1 9 1.7e-05 3 1 4 0.92 2 1 2 1 5 0.27 2 1 1 1 1 1 2 1 3 1 1 1 0 1 3 1 3 1\n" + +- "2 1 3 1 0 1 3 1 0 1 1 1 2 1 1 1 0 1 1 1 0 1 2 1 1 1 1 1 2 1 2 1 1 1 0 1 0 1 0 1 2 1 0 1 1 1 0 1 2 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1\n" + +- "0 1 0 1 0 1 0 1 0 1 1 1 1 1 1 1 1 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 1 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 2 1 0 1 0 1\n" + +- "1 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1\n\n" + ++ "0 1 0 1 1 1 1 1 2 1 2 1 1 1 2 1 0 1 1 1 2 1 0 1 1 1 2 1 0 1 2 1 7 0.003 2 1 2 1 3 1 1 1 1 1 1 1 4 0.92 3 1 9 1.7e-05 3 1 4 0.92 1 1 2 1 4 0.92 2 1 1 1 2 1 2 1 3 1 1 1 1 1 3 1 2 1\n" + ++ "3 1 3 1 1 1 3 1 0 1 1 1 2 1 1 1 0 1 1 1 0 1 2 1 1 1 0 1 2 1 2 1 1 1 0 1 0 1 0 1 2 1 0 1 1 1 0 1 2 1 1 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1\n" + ++ "1 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 1 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 2 1 0 1 0 1 2 1 0 1 0 1\n" + ++ "1 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + + "% Opposite Left\n" + +- "1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 2 1 2 1 4 0.92 2 1 4 0.92 0 1 1 1 2 1 1 1 1 1 3 1 1 1 1 1 2 1 1 1 0 1 3 1 3 1 1 1 2 1 1 1 1 1 0 1 2 1 3 1 1 1 0 1 1 1\n" + +- "0 1 0 1 1 1 0 1 0 1 1 1 2 1 0 1 1 1 1 1 0 1 1 1 0 1 0 1 1 1 0 1 1 1 1 1 2 1 0 1 0 1 1 1 2 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1\n" + +- "0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 3 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 2 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 2 1 1 1 0 1\n" + +- "0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1\n\n" + ++ "1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 3 1 2 1 3 1 2 1 3 1 0 1 1 1 1 1 1 1 1 1 3 1 1 1 1 1 1 1 1 1 0 1 2 1 3 1 1 1 2 1 1 1 1 1 0 1 2 1 3 1 2 1 0 1 1 1\n" + ++ "0 1 0 1 1 1 0 1 0 1 1 1 2 1 1 1 1 1 1 1 0 1 1 1 0 1 0 1 1 1 0 1 1 1 1 1 2 1 0 1 0 1 1 1 2 1 0 1 1 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 1 1 0 1 0 1\n" + ++ "0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 3 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 2 1 1 1 0 1\n" + ++ "0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 2 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1\n\n" + + "% Opposite Right\n" + +- "0 1 1 1 3 1 1 1 1 1 2 1 3 1 3 1 0 1 2 1 2 1 1 1 1 1 2 1 2 1 1 1 0 1 0 1 1 1 2 1 1 1 0 1 1 1 0 1 1 1 1 1 1 1 0 1 0 1 2 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 3 1\n" + +- "0 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 2 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 3 1 1 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1\n" + +- "0 1 3 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 2 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1\n" + ++ "0 1 2 1 3 1 1 1 1 1 1 1 3 1 3 1 0 1 2 1 1 1 0 1 1 1 1 1 2 1 1 1 0 1 0 1 1 1 2 1 2 1 0 1 1 1 0 1 1 1 1 1 1 1 0 1 0 1 2 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 3 1\n" + ++ "0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 2 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 3 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 1\n" + ++ "0 1 3 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 3 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 2 1 0 1 1 1\n" + + "0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + ); + ready_graph( +@@ -4557,21 +4557,21 @@ + "150 margin 7 motif-length 1 bin-size 10 bin-max 344 sequences 0.05 threshold\n\n" + + "% Same Left\n" + + "1 1 4 0.85 2 1 4 0.85 0 1 0 1 0 1 2 1 1 1 3 1 0 1 1 1 1 1 2 1 1 1 0 1 0 1 0 1 1 1 1 1 4 0.85 1 1 2 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 1 1 1 1\n" + +- "2 1 0 1 3 1 0 1 0 1 1 1 1 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 1 1 1 1 0 1 1 1 0 1 1 1 1 1 1 1 0 1 0 1 0 1\n" + ++ "2 1 0 1 4 0.85 0 1 0 1 1 1 1 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 1 1 1 1 0 1 1 1 0 1 1 1 1 1 1 1 0 1 0 1 0 1\n" + + "0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 2 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 2 1\n" + + "0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1\n\n" + + "% Same Right\n" + +- "0 1 1 1 1 1 4 0.85 2 1 1 1 1 1 0 1 1 1 1 1 0 1 1 1 2 1 0 1 3 1 7 0.0017 3 1 2 1 2 1 1 1 0 1 1 1 4 0.85 2 1 8 0.00013 3 1 4 0.85 2 1 1 1 3 1 2 1 1 1 2 1 1 1 3 1 1 1 2 1 2 1 3 1 1 1\n" + +- "3 1 0 1 3 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 2 1 1 1 2 1 2 1 2 1 1 1 0 1 0 1 0 1 2 1 0 1 1 1 0 1 1 1 1 1 0 1 2 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + ++ "0 1 1 1 1 1 4 0.85 2 1 1 1 1 1 0 1 1 1 1 1 0 1 1 1 2 1 0 1 3 1 7 0.0017 2 1 2 1 2 1 1 1 1 1 1 1 4 0.85 2 1 8 0.00013 3 1 4 0.85 2 1 1 1 3 1 2 1 1 1 2 1 1 1 3 1 1 1 2 1 2 1 2 1 1 1\n" + ++ "3 1 0 1 3 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 2 1 1 1 1 1 2 1 2 1 1 1 0 1 0 1 0 1 2 1 0 1 1 1 0 1 1 1 1 1 0 1 2 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + + "1 1 0 1 0 1 0 1 1 1 1 1 1 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1\n" + +- "1 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1\n\n" + ++ "1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1\n\n" + + "% Opposite Left\n" + +- "0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 1 1 2 1 4 0.85 2 1 1 1 0 1 1 1 2 1 1 1 1 1 2 1 4 0.85 1 1 1 1 1 1 0 1 3 1 3 1 1 1 2 1 1 1 0 1 0 1 2 1 1 1 1 1 0 1 0 1 0 1\n" + ++ "0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 2 1 4 0.85 2 1 1 1 0 1 1 1 3 1 1 1 1 1 2 1 4 0.85 1 1 2 1 1 1 0 1 3 1 3 1 1 1 2 1 1 1 0 1 0 1 2 1 1 1 1 1 0 1 0 1 0 1\n" + + "0 1 0 1 1 1 0 1 1 1 1 1 1 1 1 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 2 1 0 1 2 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1\n" + +- "0 1 0 1 1 1 2 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 3 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 3 1 0 1 1 1 1 1 0 1 0 1\n" + +- "0 1 1 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + ++ "0 1 0 1 1 1 2 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 3 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 3 1 0 1 1 1 1 1 0 1 0 1\n" + ++ "0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + + "% Opposite Right\n" + +- "1 1 3 1 1 1 1 1 1 1 3 1 2 1 0 1 1 1 2 1 2 1 1 1 1 1 3 1 0 1 1 1 0 1 1 1 3 1 2 1 0 1 1 1 0 1 1 1 1 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 3 1 1 1\n" + ++ "1 1 3 1 1 1 1 1 1 1 3 1 2 1 0 1 1 1 2 1 2 1 1 1 1 1 3 1 0 1 0 1 0 1 1 1 3 1 2 1 0 1 1 1 0 1 1 1 1 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 3 1 1 1\n" + + "1 1 0 1 0 1 1 1 0 1 1 1 1 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 1 1 1 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + + "1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 1 0 1 1 1 2 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 2 1 0 1 1 1 0 1\n" + + "0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 2 1 1 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" +@@ -4793,9 +4793,9 @@ + "0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1\n" + + "0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + + "% Same Right\n" + +- "0 1 1 1 2 1 0 1 2 1 7 0.0016 4 0.83 1 1 1 1 1 1 1 1 0 1 3 1 2 1 6 0.02 3 1 3 1 1 1 1 1 3 1 3 1 1 1 2 1 1 1 2 1 1 1 0 1 3 1 3 1 1 1 4 0.83 1 1 3 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1\n" + +- "2 1 3 1 3 1 3 1 2 1 1 1 0 1 0 1 0 1 2 1 0 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 2 1 2 1 1 1 3 1 0 1 1 1\n" + +- "1 1 0 1 0 1 2 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + ++ "0 1 1 1 2 1 0 1 2 1 7 0.0016 4 0.83 1 1 1 1 1 1 2 1 0 1 3 1 2 1 6 0.02 3 1 3 1 1 1 1 1 3 1 3 1 1 1 2 1 1 1 2 1 1 1 0 1 3 1 2 1 1 1 4 0.83 1 1 3 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1\n" + ++ "2 1 3 1 3 1 3 1 2 1 1 1 0 1 0 1 0 1 2 1 0 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 2 1 2 1 1 1 3 1 0 1 1 1\n" + ++ "1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + + "0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1\n\n" + + "% Opposite Left\n" + + "1 1 0 1 1 1 6 0.02 1 1 1 1 0 1 1 1 3 1 0 1 2 1 2 1 6 0.02 2 1 1 1 1 1 0 1 3 1 3 1 1 1 1 1 1 1 0 1 1 1 1 1 2 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 2 1 0 1 1 1 0 1 0 1\n" + +@@ -4967,27 +4967,27 @@ + store_graph( + "s_1_6_hist", + "% Input Data\n" + +- "150 margin 5 motif-length 1 bin-size 10 bin-max 261 sequences 0.05 threshold\n\n" + ++ "150 margin 5 motif-length 1 bin-size 10 bin-max 262 sequences 0.05 threshold\n\n" + + "% Same Left\n" + +- "0 1 0 1 2 1 0 1 1 1 2 1 0 1 1 1 0 1 1 1 0 1 3 1 0 1 0 1 1 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 3 1 2 1 1 1 0 1 0 1 0 1 1 1 1 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1\n" + +- "0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 1 1 1 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 1 1 1 1 3 1 3 1 1 1 0 1\n" + +- "0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1\n" + +- "1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + ++ "0 1 0 1 2 1 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 1 4 0.49 0 1 1 1 1 1 1 1 0 1 1 1 0 1 0 1 1 1 0 1 2 1 2 1 1 1 0 1 0 1 0 1 0 1 1 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1\n" + ++ "0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 1 1 1 1 3 1 3 1 1 1 0 1\n" + ++ "0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1\n" + ++ "1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + + "% Same Right\n" + +- "0 1 2 1 2 1 0 1 1 1 3 1 0 1 0 1 1 1 1 1 3 1 1 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 1 1 2 1 0 1 6 0.0042 1 1 1 1 0 1 0 1 2 1 3 1 2 1 1 1 0 1 0 1 0 1 1 1 1 1\n" + +- "1 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 2 1 1 1 0 1 0 1 0 1 1 1 3 1 1 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 3 1 1 1 0 1 1 1 2 1 1 1 0 1 0 1 1 1 1 1 0 1 0 1 1 1\n" + +- "1 1 0 1 0 1 1 1 1 1 1 1 1 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 3 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1\n" + ++ "0 1 2 1 2 1 0 1 1 1 2 1 0 1 0 1 1 1 1 1 3 1 1 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 1 1 0 1 6 0.0043 1 1 1 1 0 1 0 1 2 1 3 1 3 1 1 1 0 1 0 1 0 1 1 1 1 1\n" + ++ "0 1 2 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 2 1 1 1 0 1 0 1 1 1 1 1 2 1 1 1 1 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 3 1 1 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 1 1\n" + ++ "1 1 0 1 0 1 1 1 1 1 1 1 1 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 3 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 1 1 1 1 1 1 0 1 0 1\n" + + "0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1\n\n" + + "% Opposite Left\n" + + "2 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 2 1 0 1 0 1 0 1 0 1 0 1 3 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 1 1 2 1\n" + + "1 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 2 1 0 1 0 1 1 1 2 1 1 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1\n" + +- "0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 2 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 2 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1\n" + ++ "0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 2 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 2 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1\n" + + "0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 2 1\n\n" + + "% Opposite Right\n" + +- "2 1 1 1 0 1 0 1 1 1 0 1 0 1 3 1 0 1 2 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 2 1 2 1 0 1 1 1\n" + +- "0 1 2 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 2 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 1 1 1 2 1 0 1 0 1 1 1 2 1 0 1\n" + +- "0 1 0 1 1 1 0 1 0 1 0 1 0 1 2 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 0 1 0 1 1 1 0 1 0 1\n" + +- "1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 2 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" ++ "2 1 1 1 0 1 0 1 1 1 0 1 0 1 3 1 0 1 2 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 2 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 1 1 0 1 2 1 2 1 0 1 1 1\n" + ++ "0 1 2 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 2 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 1 1 1 1 2 1 0 1 0 1 1 1 2 1 0 1\n" + ++ "0 1 0 1 1 1 0 1 0 1 0 1 0 1 2 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 0 1 0 1 1 1 0 1 0 1\n" + ++ "1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + ); + ready_graph( + "s_1_6_hist", +@@ -5013,7 +5013,7 @@ +   + + +-0.0042 ++0.0043 + 26 + 6 +   +@@ -5024,7 +5024,7 @@ + + +

    Total sequences with primary and secondary motif 
    +-

    261

    Motif Database 
    ++

    262

    Motif Database 
    +

    JASPAR CORE 2009
    + + +@@ -5093,7 +5093,7 @@ + ); + + +-2.9 ++2.7 + + + +@@ -5120,12 +5120,12 @@ + store_graph( + "s_1_7_hist", + "% Input Data\n" + +- "150 margin 7 motif-length 1 bin-size 10 bin-max 76 sequences 0.05 threshold\n\n" + ++ "150 margin 7 motif-length 1 bin-size 10 bin-max 75 sequences 0.05 threshold\n\n" + + "% Same Left\n" + + "0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + + "1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + +- "0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 3 0.18 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + +- "0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + ++ "0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 3 0.17 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + ++ "0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + + "% Same Right\n" + + "0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + + "0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 2 0.99 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + +@@ -5133,9 +5133,9 @@ + "0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n\n" + + "% Opposite Left\n" + + "0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1\n" + +- "0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 4 0.0061 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + +- "0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 2 0.99 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 2 0.99 1 1 0 1 0 1 3 0.18 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 0 1 0 1 1 1\n" + +- "0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1\n\n" + ++ "0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 4 0.0057 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + ++ "0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 2 0.99 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 2 0.99 1 1 0 1 0 1 3 0.17 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 0 1 0 1 1 1\n" + ++ "0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1\n\n" + + "% Opposite Right\n" + + "0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + + "0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1\n" + +@@ -5167,7 +5167,7 @@ + + + +- ++ + + + +@@ -5177,7 +5177,7 @@ + + + +@@ -5250,7 +5250,7 @@ + ); + + +- ++ + +
     
    0.00610.0057564  +

    Total sequences with primary and secondary motif 
    +-

    76

    Motif Database 
    ++

    75

    Motif Database 
    +

    JASPAR CORE 2009
    +
    66.1
    + +@@ -5277,7 +5277,7 @@ + store_graph( + "s_1_8_hist", + "% Input Data\n" + +- "150 margin 11 motif-length 1 bin-size 10 bin-max 183 sequences 0.05 threshold\n\n" + ++ "150 margin 11 motif-length 1 bin-size 10 bin-max 184 sequences 0.05 threshold\n\n" + + "% Same Left\n" + + "0 1 0 1 0 1 0 1 0 1 0 1 5 0.013 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 2 1 0 1 0 1 0 1 1 1 0 1 2 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 2 1\n" + + "0 1 1 1 0 1 0 1 0 1 2 1 1 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 2 1 1 1 1 1 0 1 0 1 1 1 1 1 0 1 0 1\n" + +@@ -5287,7 +5287,7 @@ + "0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 2 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + + "1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 1 1 0 1 3 0.92 0 1 1 1 1 1 1 1 0 1 0 1 2 1 0 1 0 1 0 1 0 1\n" + + "1 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 1 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 2 1 0 1 2 1 0 1 0 1 0 1 0 1\n" + +- "1 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 2 1 1 1 0 1 0 1 2 1 0 1 0 1 0 1\n\n" + ++ "1 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 2 1 1 1 0 1 0 1 2 1 1 1 0 1 0 1\n\n" + + "% Opposite Left\n" + + "0 1 0 1 2 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 2 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 1 1 1 1\n" + + "0 1 2 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1\n" + +@@ -5334,16 +5334,16 @@ + + + +
    +

    Total sequences with primary and secondary motif 
    +-

    183

    Motif Database 
    ++

    184

    Motif Database 
    +

    JASPAR CORE 2009
    +
    + +- ++
    + + +

    Spacings of "MA0217.1 (caup)" relative to "MA0039.2 (Klf4)"

    +-Previous Next Top ++Previous Next Top +
    +
    +@@ -5430,25 +5430,25 @@ + "% Input Data\n" + + "150 margin 5 motif-length 1 bin-size 10 bin-max 325 sequences 0.05 threshold\n\n" + + "% Same Left\n" + +- "0 1 0 1 0 1 0 1 0 1 1 1 2 1 2 1 6 0.014 1 1 2 1 0 1 0 1 2 1 2 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 2 1 1 1 1 1 0 1 0 1 0 1 2 1 0 1 0 1 1 1 0 1 0 1\n" + +- "1 1 1 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 2 1 1 1 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 1 2 1 0 1 0 1 2 1 0 1 3 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 2 1\n" + +- "1 1 0 1 1 1 0 1 1 1 2 1 1 1 1 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 2 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 3 1 1 1 2 1 1 1 0 1 1 1 1 1 0 1 0 1 1 1 0 1 1 1\n" + +- "1 1 0 1 1 1 1 1 0 1 0 1 1 1 1 1 1 1 2 1 0 1 0 1 2 1 0 1 0 1 1 1 0 1 0 1 1 1 1 1 1 1 0 1 0 1 0 1 1 1 1 1\n\n" + ++ "0 1 0 1 0 1 0 1 0 1 1 1 2 1 2 1 6 0.014 1 1 2 1 0 1 0 1 1 1 2 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 2 1 1 1 1 1 0 1 0 1 1 1 2 1 0 1 0 1 1 1 0 1 0 1\n" + ++ "1 1 1 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 1 2 1 0 1 0 1 1 1 0 1 3 1 0 1 0 1 1 1 1 1 0 1 0 1 1 1 2 1\n" + ++ "1 1 0 1 1 1 0 1 1 1 2 1 1 1 1 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 2 1 1 1 0 1 2 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 3 1 1 1 2 1 1 1 0 1 1 1 1 1 0 1 0 1 1 1 0 1 1 1\n" + ++ "2 1 0 1 1 1 1 1 0 1 0 1 1 1 0 1 1 1 2 1 0 1 0 1 2 1 0 1 0 1 1 1 0 1 0 1 1 1 2 1 1 1 0 1 0 1 0 1 1 1 1 1\n\n" + + "% Same Right\n" + +- "0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 2 1 0 1 0 1 0 1 0 1 0 1 0 1 2 1 0 1 0 1 0 1 2 1 0 1 0 1 1 1 2 1 0 1 2 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1\n" + +- "0 1 1 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 1 1 1 1 1 1 0 1 0 1 0 1 2 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 2 1 1 1 1 1 0 1 2 1 2 1 1 1 1 1 0 1 0 1\n" + +- "1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 2 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 2 1 0 1 1 1 0 1 0 1 0 1 1 1 1 1 1 1 0 1 1 1 0 1 1 1\n" + ++ "0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1 2 1 1 1 0 1 0 1 2 1 0 1 0 1 1 1 2 1 0 1 2 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1\n" + ++ "0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 1 1 1 1 2 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 1 1 1 1 0 1 2 1 2 1 1 1 0 1 0 1 0 1\n" + ++ "1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 1 1 1 1 1 1 0 1 0 1 1 1 1 1 0 1 2 1 0 1 1 1 0 1 0 1 1 1 1 1 1 1 1 1 0 1 1 1 0 1 1 1\n" + + "0 1 1 1 0 1 0 1 0 1 0 1 1 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 1 1 2 1 1 1 0 1 1 1 0 1 1 1 2 1 0 1 0 1 0 1 1 1\n\n" + + "% Opposite Left\n" + +- "1 1 1 1 0 1 2 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 1 1 1 1 0 1 0 1 1 1 1 1 1 1 0 1 0 1 1 1 1 1 1 1 3 1 1 1 2 1 1 1 0 1 1 1 0 1 1 1 0 1\n" + +- "0 1 1 1 1 1 1 1 1 1 1 1 0 1 0 1 0 1 3 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 1 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 2 1 0 1 1 1 0 1 0 1\n" + +- "0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 1 1 0 1 1 1 1 1 0 1 0 1 1 1 0 1 3 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 1 1 2 1 1 1 0 1\n" + +- "2 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 1 1 2 1 0 1 2 1 0 1 0 1 1 1 0 1 1 1 1 1 2 1 2 1 0 1 1 1 1 1\n\n" + ++ "1 1 1 1 0 1 2 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 1 0 1 1 1 1 1 1 1 0 1 0 1 1 1 1 1 1 1 2 1 1 1 2 1 1 1 1 1 1 1 0 1 1 1 0 1\n" + ++ "0 1 1 1 2 1 1 1 1 1 1 1 0 1 0 1 0 1 3 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 3 1 0 1 1 1 0 1 0 1\n" + ++ "1 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 2 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 2 1 2 1 2 1 1 1 0 1\n" + ++ "2 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 2 1 0 1 2 1 1 1 1 1 1 1 0 1 1 1 1 1 2 1 2 1 0 1 2 1 0 1\n\n" + + "% Opposite Right\n" + +- "0 1 0 1 0 1 1 1 0 1 2 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 2 1 0 1 0 1 1 1 2 1 0 1 0 1 2 1 0 1 1 1 3 1 0 1 0 1 0 1 1 1 2 1 0 1 0 1 0 1 1 1 1 1 0 1\n" + +- "0 1 1 1 1 1 0 1 1 1 0 1 1 1 1 1 1 1 0 1 2 1 1 1 1 1 1 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 2 1 0 1 2 1 0 1 0 1 2 1 0 1 0 1 2 1 1 1\n" + +- "0 1 0 1 0 1 0 1 0 1 1 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 2 1 2 1 0 1 2 1 0 1 2 1 0 1 2 1 1 1 2 1 1 1 0 1 2 1 0 1 1 1 2 1 3 1 2 1 0 1 0 1 2 1 0 1\n" + +- "1 1 0 1 0 1 0 1 0 1 0 1 2 1 0 1 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1\n\n" ++ "0 1 0 1 0 1 1 1 0 1 2 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 2 1 0 1 0 1 1 1 1 1 0 1 0 1 2 1 0 1 1 1 3 1 0 1 0 1 0 1 1 1 2 1 0 1 0 1 0 1 1 1 0 1 0 1\n" + ++ "0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 1 1 1 1 1 1 0 1 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 2 1 0 1 2 1 0 1 0 1 2 1 0 1 0 1 2 1 1 1\n" + ++ "0 1 0 1 0 1 0 1 0 1 3 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 1 1 0 1 2 1 2 1 1 1 1 1 0 1 2 1 0 1 1 1 1 1 2 1 2 1 0 1 1 1 0 1 1 1 2 1 2 1 2 1 0 1 0 1 2 1 0 1\n" + ++ "1 1 0 1 0 1 0 1 0 1 0 1 2 1 0 1 1 1 0 1 1 1 0 1 0 1 1 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 1 0 1 1 1 0 1 0 1\n\n" + ); + ready_graph( + "s_1_9_hist", +@@ -5491,12 +5491,165 @@ + + +
    ++ ++ ++ ++

    Spacings of "MA0087.1 (Sox5)" relative to "MA0039.2 (Klf4)"

    ++Previous Next Top ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Primary: MA0039.2 (Klf4) 
    ++
    Secondary: MA0087.1 (Sox5) 
    ++
    ++E-value
    ++
    ++
    ++TGGGTGGGGC ++
    ++ ++
    ++
    ++TAACAAT ++
    ++ ++
    9
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    Motif Spacing Histogram 
    ++
     Significant Motif Spacings (p<0.05) 
    ++
     
    UpstreamDownstream UpstreamDownstreamOther Details
    ++ ++ ++
    ++
    Same Strand
    ++
    Opposite Strand
    ++
    ++
    ++
    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    P-valueGap# 
    0.019855 
    ++
    ++
    ++
    ++

    Total sequences with primary and secondary motif 
    ++

    205

    Motif Database 
    ++

    JASPAR CORE 2009
    ++
    ++
    +
    + +
    +-
    SpaMo version
    4.10.0 (Release date: Tue May 06 16:46:04 2014 +1000) ++
    SpaMo version
    4.10.0 (Release date: Wed May 21 10:35:36 2014 +1000) +
    +
    +
    Reference
    +@@ -5508,7 +5661,7 @@ +
    +
    +
    Command line summary
    +-
    Result calculation took 16 seconds
    Note that the random number generator was initilized with a seed of 1 so you need ++
    Result calculation took 17 seconds
    Note that the random number generator was initilized with a seed of 1 so you need + "-numgen 1" in the list of arguments + to replicate the experiment. +
    +@@ -5528,8 +5681,8 @@ + motif_pseudocount = 0.1 + motif_trim = 0.25 + bin_max = 10 +-host = d-108-179-169-207.dhcp4.washington.edu +-when = Mon May 12 15:35:44 2014 ++host = IMB12-010665 ++when = Tue Oct 7 16:30:29 2014 + +
    + +diff -ruN a/doc/examples/spamo_example_output_files/spamo.xml b/doc/examples/spamo_example_output_files/spamo.xml +--- a/doc/examples/spamo_example_output_files/spamo.xml 2014-05-13 08:36:00.000000000 +1000 ++++ b/doc/examples/spamo_example_output_files/spamo.xml 2014-10-07 16:30:46.000000000 +1000 +@@ -63,7 +63,7 @@ + + + ]> +- ++ + + spamo -oc spamo_example_output_files -png -primary MA0039.2 sample-dna-Klf1.fa JASPAR_CORE_2009.meme JASPAR_CORE_2009.meme + 1 +@@ -79,16 +79,16 @@ + 0.1 + 0.25 + 10 +- d-108-179-169-207.dhcp4.washington.edu +- Mon May 12 15:35:44 2014 ++ IMB12-010665 ++ Tue Oct 7 16:30:29 2014 + + + +- +- + + +@@ -286,7 +286,7 @@ + + + +- ++ + + + +@@ -304,7 +304,7 @@ + + + +- ++ + + + +@@ -425,14 +425,14 @@ + + + +- ++ + + + + + + +- ++ + + + +@@ -506,7 +506,7 @@ + + + +- ++ + + + +@@ -537,7 +537,7 @@ + + + +- ++ + + + +@@ -884,13 +884,13 @@ + + + +- ++ + +- ++ + + + +- ++ + + + +@@ -908,7 +908,7 @@ + + + +- ++ + + + +@@ -925,7 +925,7 @@ + + + +- ++ + + + +@@ -1002,7 +1002,7 @@ + + + +- ++ + + + +@@ -1029,14 +1029,14 @@ + + + +- ++ + + + + + + +- ++ + + + +@@ -1110,7 +1110,7 @@ + + + +- ++ + + + +@@ -1123,7 +1123,7 @@ + + + +- ++ + + + +@@ -1495,7 +1495,7 @@ + + + +- ++ + + + +@@ -1513,7 +1513,7 @@ + + + +- ++ + + + +@@ -1634,20 +1634,20 @@ + + + +- ++ + + + + + + +- ++ + + + + + +- ++ + + + +@@ -1715,7 +1715,7 @@ + + + +- ++ + + + +@@ -1746,7 +1746,7 @@ + + + +- ++ + + + +@@ -1784,7 +1784,7 @@ + + + +- ++ + + + +@@ -1945,13 +1945,13 @@ + + + +- +- ++ ++ + + + + +- ++ + + + +@@ -1983,8 +1983,8 @@ + + + +- +- ++ ++ + + + +@@ -1993,7 +1993,7 @@ + + + +- ++ + + + +@@ -2043,7 +2043,7 @@ + + + +- ++ + + + +@@ -2052,8 +2052,8 @@ + + + +- +- ++ ++ + + + +@@ -2083,7 +2083,7 @@ + + + +- ++ + + + +@@ -2097,30 +2097,30 @@ + + + +- ++ + +- ++ + + + + + + +- ++ + +- ++ + + +- ++ + + + +- ++ + +- +- ++ ++ + +- ++ + + + +@@ -2131,7 +2131,7 @@ + + + +- ++ + + + +@@ -2148,7 +2148,7 @@ + + + +- ++ + + + +@@ -2158,14 +2158,14 @@ + + + +- ++ + + + + + + +- ++ + + + +@@ -2192,7 +2192,7 @@ + + + +- ++ + + + +@@ -2200,7 +2200,7 @@ + + + +- ++ + + + +@@ -2220,7 +2220,7 @@ + + + +- ++ + + + +@@ -2240,23 +2240,23 @@ + + + +- ++ + +- ++ + +- ++ + + +- ++ + + + + + +- ++ + + +- ++ + + + +@@ -2265,7 +2265,7 @@ + + + +- ++ + + + +@@ -2275,7 +2275,7 @@ + + + +- ++ + + + +@@ -2294,7 +2294,7 @@ + + + +- ++ + + + +@@ -2303,16 +2303,16 @@ + + + +- ++ + +- ++ + + + + + + +- ++ + + + +@@ -2320,8 +2320,8 @@ + + + +- +- ++ ++ + + + +@@ -2331,10 +2331,10 @@ + + + +- ++ + + +- ++ + + + +@@ -2352,7 +2352,7 @@ + + + +- ++ + + + +@@ -2365,7 +2365,7 @@ + + + +- ++ + + + +@@ -2377,26 +2377,26 @@ + + + +- ++ + + + +- ++ + + + + +- +- ++ ++ + +- ++ + + + + + + +- ++ + + + +@@ -2420,7 +2420,7 @@ + + + +- ++ + + + +@@ -2442,16 +2442,16 @@ + + + +- ++ + +- ++ + +- ++ + + + + +- ++ + + + +@@ -2485,7 +2485,7 @@ + + + +- ++ + + + +@@ -2493,7 +2493,7 @@ + + + +- ++ + + + +@@ -2587,7 +2587,7 @@ + + + +- ++ + + + +@@ -2605,7 +2605,7 @@ + + + +- ++ + + + +@@ -2707,11 +2707,11 @@ + + + +- ++ + + + +- ++ + + + +@@ -2729,21 +2729,21 @@ + + + +- ++ + + + + + + +- ++ + + + + + + +- ++ + + + +@@ -2760,7 +2760,7 @@ + + + +- ++ + + + +@@ -2812,7 +2812,7 @@ + + + +- ++ + + + +@@ -2823,7 +2823,7 @@ + + + +- ++ + + + +@@ -2850,20 +2850,20 @@ + + + +- ++ + + + + + + +- ++ + + + + + +- ++ + + + +@@ -2931,7 +2931,7 @@ + + + +- ++ + + + +@@ -2962,7 +2962,7 @@ + + + +- ++ + + + +@@ -3000,7 +3000,7 @@ + + + +- ++ + + + +@@ -3309,7 +3309,7 @@ + + + +- ++ + + + +@@ -3327,7 +3327,7 @@ + + + +- ++ + + + +@@ -3358,7 +3358,7 @@ + + + +- ++ + + + +@@ -3382,7 +3382,7 @@ + + + +- ++ + + + +@@ -3400,7 +3400,7 @@ + + + +- ++ + + + +@@ -3410,7 +3410,7 @@ + + + +- ++ + + + +@@ -3712,7 +3712,7 @@ + + + +- ++ + + + +@@ -3721,7 +3721,7 @@ + + + +- ++ + + + +@@ -3729,37 +3729,37 @@ + + + +- ++ + + + + + +- ++ + +- ++ + + +- +- ++ ++ + + + + +- ++ + + + + + +- ++ + + + + + + +- ++ + + + +@@ -3767,7 +3767,7 @@ + + + +- ++ + + + +@@ -3785,7 +3785,7 @@ + + + +- ++ + + + +@@ -3807,7 +3807,7 @@ + + + +- ++ + + + +@@ -3834,7 +3834,7 @@ + + + +- ++ + + + +@@ -3862,7 +3862,7 @@ + + + +- ++ + + + +@@ -3877,7 +3877,7 @@ + + + +- ++ + + + +@@ -3887,33 +3887,33 @@ + + + +- ++ + + + +- ++ + +- +- ++ ++ + +- ++ + +- ++ + + + + + + +- ++ + + + + + + +- +- ++ ++ + + + +@@ -3925,15 +3925,15 @@ + + + +- ++ + +- ++ + + + + + +- ++ + + + +@@ -3943,8 +3943,8 @@ + + + +- +- ++ ++ + + + +@@ -3988,8 +3988,8 @@ + + + +- +- ++ ++ + + + +@@ -4104,7 +4104,7 @@ + + + +- ++ + + + +@@ -4196,7 +4196,7 @@ + + + +- ++ + + + +@@ -4204,7 +4204,7 @@ + + + +- ++ + + + +@@ -4241,7 +4241,7 @@ + + + +- ++ + + + +@@ -4271,7 +4271,7 @@ + + + +- ++ + + + +@@ -4299,7 +4299,7 @@ + + + +- ++ + + + +@@ -4320,8 +4320,8 @@ + + + +- +- ++ ++ + + + +@@ -4331,7 +4331,7 @@ + + + +- ++ + + + +@@ -4426,11 +4426,11 @@ + + + +- ++ + + + +- ++ + + + +@@ -4460,7 +4460,7 @@ + + + +- ++ + + + +@@ -4684,7 +4684,7 @@ + + + +- ++ + + + +@@ -4734,7 +4734,7 @@ + + + +- ++ + + + +@@ -4755,7 +4755,7 @@ + + + +- ++ + + + +@@ -4922,7 +4922,7 @@ + + + +- ++ + + + +@@ -4937,7 +4937,7 @@ + + + +- ++ + + + +@@ -5219,7 +5219,7 @@ + + + +- ++ + + + +@@ -5537,7 +5537,7 @@ + + + +- ++ + + + +@@ -5549,7 +5549,7 @@ + + + +- ++ + + + +@@ -5557,7 +5557,7 @@ + + + +- ++ + + + +@@ -5580,7 +5580,7 @@ + + + +- ++ + + + +@@ -5593,12 +5593,12 @@ + + + +- ++ + + + + +- ++ + + + +@@ -5619,7 +5619,7 @@ + + + +- ++ + + + +@@ -5631,7 +5631,7 @@ + + + +- ++ + + + +@@ -5644,14 +5644,14 @@ + + + +- ++ + + + + + + +- ++ + + + +@@ -5663,7 +5663,7 @@ + + + +- ++ + + + +@@ -5687,15 +5687,15 @@ + + + +- ++ + + + +- ++ + + + +- ++ + + + +@@ -5713,7 +5713,7 @@ + + + +- ++ + + + +@@ -5726,11 +5726,11 @@ + + + +- ++ + + + +- ++ + + + +@@ -5740,16 +5740,16 @@ + + + +- ++ + +- ++ + + + + + + +- ++ + + + +@@ -5764,15 +5764,15 @@ + + + +- +- ++ ++ + + + + + + +- ++ + + + +@@ -5784,7 +5784,7 @@ + + + +- ++ + + + +@@ -5841,7 +5841,7 @@ + + + +- ++ + + + +@@ -5853,18 +5853,18 @@ + + + +- ++ + + + +- ++ + + + + + + +- ++ + + + +@@ -5889,7 +5889,7 @@ + + + +- ++ + + + +@@ -5897,12 +5897,12 @@ + + + +- ++ + + + + +- ++ + + + +@@ -5911,24 +5911,24 @@ + + + +- ++ + + + +- ++ + + + +- ++ + + +- ++ + +- ++ + + + +- ++ + + + +@@ -5937,8 +5937,8 @@ + + + +- +- ++ ++ + + + +@@ -5948,17 +5948,17 @@ + + + +- +- ++ ++ + + + +- ++ + + + +- +- ++ ++ + + + +@@ -5966,8 +5966,8 @@ + + + +- +- ++ ++ + + + +@@ -5979,7 +5979,7 @@ + + + +- ++ + + + +@@ -5992,7 +5992,7 @@ + + + +- ++ + + + +@@ -6008,7 +6008,7 @@ + + + +- ++ + + + +@@ -6017,10 +6017,10 @@ + + + +- ++ + + +- ++ + + + +@@ -6036,7 +6036,7 @@ + + + +- ++ + + + +@@ -6055,7 +6055,7 @@ + + + +- ++ + + + +@@ -6070,21 +6070,21 @@ + + + +- +- ++ ++ + + + +- ++ + + +- ++ + +- ++ + + + +- ++ + + + +@@ -6100,6 +6100,170 @@ + + + ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ + + + +@@ -6112,14 +6276,456 @@ + + + +- ++ + + +- ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ + + + + + +- ++ + +diff -ruN a/doc/examples/tomtom_example_output_files/tomtom.html b/doc/examples/tomtom_example_output_files/tomtom.html +--- a/doc/examples/tomtom_example_output_files/tomtom.html 2014-05-13 08:36:04.000000000 +1000 ++++ b/doc/examples/tomtom_example_output_files/tomtom.html 2014-10-07 16:30:47.000000000 +1000 +@@ -250,7 +250,7 @@ + + + + + + + + +@@ -208,50 +377,36 @@ + +

    Sequence Databases

    +
    +- +-

    Categories

    +- +-

    Databases

    +-
    +- +-

    A Category

    +-
    +- +-
    +-

    A Listing

    +-
    +-

    A description of the listing will go here. It +- will be about two or three sentences long.

    +-
    +-
    Versions:
    +- +- +-
    Version Name
    +-
    +- This is a description of the DNA version.
    +-
    +- This is a description of the RNA version.
    +-
    +- This is a description of the protein version.
    +-
    +- +-
      Alphabets:
    +- +-
    DNA
    +-
    RNA
    +-
    Protein
    +-
    +-
    +-
    +-
    +-
    +- ++

    Click a category to show its available databases. Within a category click a database to see details.

    ++ ++
    ++
    ++

    A Category

    ++   ++ ++ +
    +- ++
    Loading...
    +
    +- ++ ++ +
    +
    + diff --git a/tools/meme-suite/sources/patch_4.10.1_2 b/tools/meme-suite/sources/patch_4.10.1_2 new file mode 100644 index 0000000000000000000000000000000000000000..e39efef63659c89d90701568dd5b115f7c2d95f4 --- /dev/null +++ b/tools/meme-suite/sources/patch_4.10.1_2 @@ -0,0 +1,3915 @@ +diff -rNu a/Makefile.in b/Makefile.in +--- a/Makefile.in 2015-03-25 11:42:44.000000000 +1000 ++++ b/Makefile.in 2015-04-21 17:09:42.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +@@ -84,7 +84,7 @@ + COPYING config/compile config/config.guess config/config.sub \ + config/depcomp config/install-sh config/missing \ + config/mkinstalldirs config/ltmain.sh \ +- $(top_srcdir)/config/config.guess \ ++ $(top_srcdir)/config/compile $(top_srcdir)/config/config.guess \ + $(top_srcdir)/config/config.sub \ + $(top_srcdir)/config/install-sh $(top_srcdir)/config/ltmain.sh \ + $(top_srcdir)/config/missing +@@ -652,8 +652,8 @@ + $(am__aclocal_m4_deps): + + config.h: stamp-h1 +- @if test ! -f $@; then rm -f stamp-h1; else :; fi +- @if test ! -f $@; then $(MAKE) $(AM_MAKEFLAGS) stamp-h1; else :; fi ++ @test -f $@ || rm -f stamp-h1 ++ @test -f $@ || $(MAKE) $(AM_MAKEFLAGS) stamp-h1 + + stamp-h1: $(srcdir)/config.h.in $(top_builddir)/config.status + @rm -f stamp-h1 +@@ -865,10 +865,16 @@ + $(am__post_remove_distdir) + + dist-tarZ: distdir ++ @echo WARNING: "Support for shar distribution archives is" \ ++ "deprecated." >&2 ++ @echo WARNING: "It will be removed altogether in Automake 2.0" >&2 + tardir=$(distdir) && $(am__tar) | compress -c >$(distdir).tar.Z + $(am__post_remove_distdir) + + dist-shar: distdir ++ @echo WARNING: "Support for distribution archives compressed with" \ ++ "legacy program 'compress' is deprecated." >&2 ++ @echo WARNING: "It will be removed altogether in Automake 2.0" >&2 + shar $(distdir) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).shar.gz + $(am__post_remove_distdir) + +diff -rNu a/aclocal.m4 b/aclocal.m4 +--- a/aclocal.m4 2015-03-25 11:42:43.000000000 +1000 ++++ b/aclocal.m4 2015-04-21 17:09:40.000000000 +1000 +@@ -1,4 +1,4 @@ +-# generated automatically by aclocal 1.13.3 -*- Autoconf -*- ++# generated automatically by aclocal 1.14 -*- Autoconf -*- + + # Copyright (C) 1996-2013 Free Software Foundation, Inc. + +@@ -32,10 +32,10 @@ + # generated from the m4 files accompanying Automake X.Y. + # (This private macro should not be called outside this file.) + AC_DEFUN([AM_AUTOMAKE_VERSION], +-[am__api_version='1.13' ++[am__api_version='1.14' + dnl Some users find AM_AUTOMAKE_VERSION and mistake it for a way to + dnl require some minimum version. Point them to the right macro. +-m4_if([$1], [1.13.3], [], ++m4_if([$1], [1.14], [], + [AC_FATAL([Do not call $0, use AM_INIT_AUTOMAKE([$1]).])])dnl + ]) + +@@ -51,7 +51,7 @@ + # Call AM_AUTOMAKE_VERSION and AM_AUTOMAKE_VERSION so they can be traced. + # This function is AC_REQUIREd by AM_INIT_AUTOMAKE. + AC_DEFUN([AM_SET_CURRENT_AUTOMAKE_VERSION], +-[AM_AUTOMAKE_VERSION([1.13.3])dnl ++[AM_AUTOMAKE_VERSION([1.14])dnl + m4_ifndef([AC_AUTOCONF_VERSION], + [m4_copy([m4_PACKAGE_VERSION], [AC_AUTOCONF_VERSION])])dnl + _AM_AUTOCONF_VERSION(m4_defn([AC_AUTOCONF_VERSION]))]) +@@ -418,6 +418,12 @@ + # This macro actually does too much. Some checks are only needed if + # your package does certain things. But this isn't really a big deal. + ++dnl Redefine AC_PROG_CC to automatically invoke _AM_PROG_CC_C_O. ++m4_define([AC_PROG_CC], ++m4_defn([AC_PROG_CC]) ++[_AM_PROG_CC_C_O ++]) ++ + # AM_INIT_AUTOMAKE(PACKAGE, VERSION, [NO-DEFINE]) + # AM_INIT_AUTOMAKE([OPTIONS]) + # ----------------------------------------------- +@@ -526,7 +532,48 @@ + AC_CONFIG_COMMANDS_PRE(dnl + [m4_provide_if([_AM_COMPILER_EXEEXT], + [AM_CONDITIONAL([am__EXEEXT], [test -n "$EXEEXT"])])])dnl +-]) ++ ++# POSIX will say in a future version that running "rm -f" with no argument ++# is OK; and we want to be able to make that assumption in our Makefile ++# recipes. So use an aggressive probe to check that the usage we want is ++# actually supported "in the wild" to an acceptable degree. ++# See automake bug#10828. ++# To make any issue more visible, cause the running configure to be aborted ++# by default if the 'rm' program in use doesn't match our expectations; the ++# user can still override this though. ++if rm -f && rm -fr && rm -rf; then : OK; else ++ cat >&2 <<'END' ++Oops! ++ ++Your 'rm' program seems unable to run without file operands specified ++on the command line, even when the '-f' option is present. This is contrary ++to the behaviour of most rm programs out there, and not conforming with ++the upcoming POSIX standard: ++ ++Please tell bug-automake@gnu.org about your system, including the value ++of your $PATH and any error possibly output before this message. This ++can help us improve future automake versions. ++ ++END ++ if test x"$ACCEPT_INFERIOR_RM_PROGRAM" = x"yes"; then ++ echo 'Configuration will proceed anyway, since you have set the' >&2 ++ echo 'ACCEPT_INFERIOR_RM_PROGRAM variable to "yes"' >&2 ++ echo >&2 ++ else ++ cat >&2 <<'END' ++Aborting the configuration process, to ensure you take notice of the issue. ++ ++You can download and install GNU coreutils to get an 'rm' implementation ++that behaves properly: . ++ ++If you want to complete the configuration process using your problematic ++'rm' anyway, export the environment variable ACCEPT_INFERIOR_RM_PROGRAM ++to "yes", and re-run configure. ++ ++END ++ AC_MSG_ERROR([Your 'rm' program is bad, sorry.]) ++ fi ++fi]) + + dnl Hook into '_AC_COMPILER_EXEEXT' early to learn its expansion. Do not + dnl add the conditional right here, as _AC_COMPILER_EXEEXT may be further +@@ -534,7 +581,6 @@ + m4_define([_AC_COMPILER_EXEEXT], + m4_defn([_AC_COMPILER_EXEEXT])[m4_provide([_AM_COMPILER_EXEEXT])]) + +- + # When config.status generates a header, we must update the stamp-h file. + # This file resides in the same directory as the config header + # that is generated. The stamp files are numbered to have different names. +@@ -716,6 +762,70 @@ + AC_DEFUN([_AM_IF_OPTION], + [m4_ifset(_AM_MANGLE_OPTION([$1]), [$2], [$3])]) + ++# Copyright (C) 1999-2013 Free Software Foundation, Inc. ++# ++# This file is free software; the Free Software Foundation ++# gives unlimited permission to copy and/or distribute it, ++# with or without modifications, as long as this notice is preserved. ++ ++# _AM_PROG_CC_C_O ++# --------------- ++# Like AC_PROG_CC_C_O, but changed for automake. We rewrite AC_PROG_CC ++# to automatically call this. ++AC_DEFUN([_AM_PROG_CC_C_O], ++[AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl ++AC_REQUIRE_AUX_FILE([compile])dnl ++AC_LANG_PUSH([C])dnl ++AC_CACHE_CHECK( ++ [whether $CC understands -c and -o together], ++ [am_cv_prog_cc_c_o], ++ [AC_LANG_CONFTEST([AC_LANG_PROGRAM([])]) ++ # Make sure it works both with $CC and with simple cc. ++ # Following AC_PROG_CC_C_O, we do the test twice because some ++ # compilers refuse to overwrite an existing .o file with -o, ++ # though they will create one. ++ am_cv_prog_cc_c_o=yes ++ for am_i in 1 2; do ++ if AM_RUN_LOG([$CC -c conftest.$ac_ext -o conftest2.$ac_objext]) \ ++ && test -f conftest2.$ac_objext; then ++ : OK ++ else ++ am_cv_prog_cc_c_o=no ++ break ++ fi ++ done ++ rm -f core conftest* ++ unset am_i]) ++if test "$am_cv_prog_cc_c_o" != yes; then ++ # Losing compiler, so override with the script. ++ # FIXME: It is wrong to rewrite CC. ++ # But if we don't then we get into trouble of one sort or another. ++ # A longer-term fix would be to have automake use am__CC in this case, ++ # and then we could set am__CC="\$(top_srcdir)/compile \$(CC)" ++ CC="$am_aux_dir/compile $CC" ++fi ++AC_LANG_POP([C])]) ++ ++# For backward compatibility. ++AC_DEFUN_ONCE([AM_PROG_CC_C_O], [AC_REQUIRE([AC_PROG_CC])]) ++ ++# Copyright (C) 2001-2013 Free Software Foundation, Inc. ++# ++# This file is free software; the Free Software Foundation ++# gives unlimited permission to copy and/or distribute it, ++# with or without modifications, as long as this notice is preserved. ++ ++# AM_RUN_LOG(COMMAND) ++# ------------------- ++# Run COMMAND, save the exit status in ac_status, and log it. ++# (This has been adapted from Autoconf's _AC_RUN_LOG macro.) ++AC_DEFUN([AM_RUN_LOG], ++[{ echo "$as_me:$LINENO: $1" >&AS_MESSAGE_LOG_FD ++ ($1) >&AS_MESSAGE_LOG_FD 2>&AS_MESSAGE_LOG_FD ++ ac_status=$? ++ echo "$as_me:$LINENO: \$? = $ac_status" >&AS_MESSAGE_LOG_FD ++ (exit $ac_status); }]) ++ + # Check to make sure that the build environment is sane. -*- Autoconf -*- + + # Copyright (C) 1996-2013 Free Software Foundation, Inc. +diff -rNu a/config/config.guess b/config/config.guess +--- a/config/config.guess 2013-08-11 21:49:21.000000000 +1000 ++++ b/config/config.guess 2012-09-09 04:16:41.000000000 +1000 +@@ -1,12 +1,14 @@ + #! /bin/sh + # Attempt to guess a canonical system name. +-# Copyright 1992-2013 Free Software Foundation, Inc. ++# Copyright (C) 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, ++# 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, ++# 2011 Free Software Foundation, Inc. + +-timestamp='2013-06-10' ++timestamp='2011-10-01' + + # This file is free software; you can redistribute it and/or modify it + # under the terms of the GNU General Public License as published by +-# the Free Software Foundation; either version 3 of the License, or ++# the Free Software Foundation; either version 2 of the License, or + # (at your option) any later version. + # + # This program is distributed in the hope that it will be useful, but +@@ -15,22 +17,26 @@ + # General Public License for more details. + # + # You should have received a copy of the GNU General Public License +-# along with this program; if not, see . ++# along with this program; if not, write to the Free Software ++# Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA ++# 02110-1301, USA. + # + # As a special exception to the GNU General Public License, if you + # distribute this file as part of a program that contains a + # configuration script generated by Autoconf, you may include it under +-# the same distribution terms that you use for the rest of that +-# program. This Exception is an additional permission under section 7 +-# of the GNU General Public License, version 3 ("GPLv3"). ++# the same distribution terms that you use for the rest of that program. ++ ++ ++# Originally written by Per Bothner. Please send patches (context ++# diff format) to and include a ChangeLog ++# entry. + # +-# Originally written by Per Bothner. ++# This script attempts to guess a canonical system name similar to ++# config.sub. If it succeeds, it prints the system name on stdout, and ++# exits with 0. Otherwise, it exits with 1. + # + # You can get the latest version of this script from: + # http://git.savannah.gnu.org/gitweb/?p=config.git;a=blob_plain;f=config.guess;hb=HEAD +-# +-# Please send patches with a ChangeLog entry to config-patches@gnu.org. +- + + me=`echo "$0" | sed -e 's,.*/,,'` + +@@ -50,7 +56,9 @@ + GNU config.guess ($timestamp) + + Originally written by Per Bothner. +-Copyright 1992-2013 Free Software Foundation, Inc. ++Copyright (C) 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, 2000, ++2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011 Free ++Software Foundation, Inc. + + This is free software; see the source for copying conditions. There is NO + warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE." +@@ -132,33 +140,12 @@ + UNAME_SYSTEM=`(uname -s) 2>/dev/null` || UNAME_SYSTEM=unknown + UNAME_VERSION=`(uname -v) 2>/dev/null` || UNAME_VERSION=unknown + +-case "${UNAME_SYSTEM}" in +-Linux|GNU|GNU/*) +- # If the system lacks a compiler, then just pick glibc. +- # We could probably try harder. +- LIBC=gnu +- +- eval $set_cc_for_build +- cat <<-EOF > $dummy.c +- #include +- #if defined(__UCLIBC__) +- LIBC=uclibc +- #elif defined(__dietlibc__) +- LIBC=dietlibc +- #else +- LIBC=gnu +- #endif +- EOF +- eval `$CC_FOR_BUILD -E $dummy.c 2>/dev/null | grep '^LIBC'` +- ;; +-esac +- + # Note: order is significant - the case branches are not exclusive. + + case "${UNAME_MACHINE}:${UNAME_SYSTEM}:${UNAME_RELEASE}:${UNAME_VERSION}" in + *:NetBSD:*:*) + # NetBSD (nbsd) targets should (where applicable) match one or +- # more of the tuples: *-*-netbsdelf*, *-*-netbsdaout*, ++ # more of the tupples: *-*-netbsdelf*, *-*-netbsdaout*, + # *-*-netbsdecoff* and *-*-netbsd*. For targets that recently + # switched to ELF, *-*-netbsd* would select the old + # object file format. This provides both forward +@@ -215,10 +202,6 @@ + # CPU_TYPE-MANUFACTURER-OPERATING_SYSTEM is used. + echo "${machine}-${os}${release}" + exit ;; +- *:Bitrig:*:*) +- UNAME_MACHINE_ARCH=`arch | sed 's/Bitrig.//'` +- echo ${UNAME_MACHINE_ARCH}-unknown-bitrig${UNAME_RELEASE} +- exit ;; + *:OpenBSD:*:*) + UNAME_MACHINE_ARCH=`arch | sed 's/OpenBSD.//'` + echo ${UNAME_MACHINE_ARCH}-unknown-openbsd${UNAME_RELEASE} +@@ -321,7 +304,7 @@ + arm:RISC*:1.[012]*:*|arm:riscix:1.[012]*:*) + echo arm-acorn-riscix${UNAME_RELEASE} + exit ;; +- arm*:riscos:*:*|arm*:RISCOS:*:*) ++ arm:riscos:*:*|arm:RISCOS:*:*) + echo arm-unknown-riscos + exit ;; + SR2?01:HI-UX/MPP:*:* | SR8000:HI-UX/MPP:*:*) +@@ -820,15 +803,9 @@ + i*:CYGWIN*:*) + echo ${UNAME_MACHINE}-pc-cygwin + exit ;; +- *:MINGW64*:*) +- echo ${UNAME_MACHINE}-pc-mingw64 +- exit ;; + *:MINGW*:*) + echo ${UNAME_MACHINE}-pc-mingw32 + exit ;; +- i*:MSYS*:*) +- echo ${UNAME_MACHINE}-pc-msys +- exit ;; + i*:windows32*:*) + # uname -m includes "-pc" on this system. + echo ${UNAME_MACHINE}-mingw32 +@@ -874,22 +851,15 @@ + exit ;; + *:GNU:*:*) + # the GNU system +- echo `echo ${UNAME_MACHINE}|sed -e 's,[-/].*$,,'`-unknown-${LIBC}`echo ${UNAME_RELEASE}|sed -e 's,/.*$,,'` ++ echo `echo ${UNAME_MACHINE}|sed -e 's,[-/].*$,,'`-unknown-gnu`echo ${UNAME_RELEASE}|sed -e 's,/.*$,,'` + exit ;; + *:GNU/*:*:*) + # other systems with GNU libc and userland +- echo ${UNAME_MACHINE}-unknown-`echo ${UNAME_SYSTEM} | sed 's,^[^/]*/,,' | tr '[A-Z]' '[a-z]'``echo ${UNAME_RELEASE}|sed -e 's/[-(].*//'`-${LIBC} ++ echo ${UNAME_MACHINE}-unknown-`echo ${UNAME_SYSTEM} | sed 's,^[^/]*/,,' | tr '[A-Z]' '[a-z]'``echo ${UNAME_RELEASE}|sed -e 's/[-(].*//'`-gnu + exit ;; + i*86:Minix:*:*) + echo ${UNAME_MACHINE}-pc-minix + exit ;; +- aarch64:Linux:*:*) +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} +- exit ;; +- aarch64_be:Linux:*:*) +- UNAME_MACHINE=aarch64_be +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} +- exit ;; + alpha:Linux:*:*) + case `sed -n '/^cpu model/s/^.*: \(.*\)/\1/p' < /proc/cpuinfo` in + EV5) UNAME_MACHINE=alphaev5 ;; +@@ -901,54 +871,59 @@ + EV68*) UNAME_MACHINE=alphaev68 ;; + esac + objdump --private-headers /bin/sh | grep -q ld.so.1 +- if test "$?" = 0 ; then LIBC="gnulibc1" ; fi +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} +- exit ;; +- arc:Linux:*:* | arceb:Linux:*:*) +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} ++ if test "$?" = 0 ; then LIBC="libc1" ; else LIBC="" ; fi ++ echo ${UNAME_MACHINE}-unknown-linux-gnu${LIBC} + exit ;; + arm*:Linux:*:*) + eval $set_cc_for_build + if echo __ARM_EABI__ | $CC_FOR_BUILD -E - 2>/dev/null \ + | grep -q __ARM_EABI__ + then +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} ++ echo ${UNAME_MACHINE}-unknown-linux-gnu + else + if echo __ARM_PCS_VFP | $CC_FOR_BUILD -E - 2>/dev/null \ + | grep -q __ARM_PCS_VFP + then +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC}eabi ++ echo ${UNAME_MACHINE}-unknown-linux-gnueabi + else +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC}eabihf ++ echo ${UNAME_MACHINE}-unknown-linux-gnueabihf + fi + fi + exit ;; + avr32*:Linux:*:*) +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} ++ echo ${UNAME_MACHINE}-unknown-linux-gnu + exit ;; + cris:Linux:*:*) +- echo ${UNAME_MACHINE}-axis-linux-${LIBC} ++ echo cris-axis-linux-gnu + exit ;; + crisv32:Linux:*:*) +- echo ${UNAME_MACHINE}-axis-linux-${LIBC} ++ echo crisv32-axis-linux-gnu + exit ;; + frv:Linux:*:*) +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} ++ echo frv-unknown-linux-gnu + exit ;; + hexagon:Linux:*:*) +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} ++ echo hexagon-unknown-linux-gnu + exit ;; + i*86:Linux:*:*) +- echo ${UNAME_MACHINE}-pc-linux-${LIBC} ++ LIBC=gnu ++ eval $set_cc_for_build ++ sed 's/^ //' << EOF >$dummy.c ++ #ifdef __dietlibc__ ++ LIBC=dietlibc ++ #endif ++EOF ++ eval `$CC_FOR_BUILD -E $dummy.c 2>/dev/null | grep '^LIBC'` ++ echo "${UNAME_MACHINE}-pc-linux-${LIBC}" + exit ;; + ia64:Linux:*:*) +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} ++ echo ${UNAME_MACHINE}-unknown-linux-gnu + exit ;; + m32r*:Linux:*:*) +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} ++ echo ${UNAME_MACHINE}-unknown-linux-gnu + exit ;; + m68*:Linux:*:*) +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} ++ echo ${UNAME_MACHINE}-unknown-linux-gnu + exit ;; + mips:Linux:*:* | mips64:Linux:*:*) + eval $set_cc_for_build +@@ -967,63 +942,54 @@ + #endif + EOF + eval `$CC_FOR_BUILD -E $dummy.c 2>/dev/null | grep '^CPU'` +- test x"${CPU}" != x && { echo "${CPU}-unknown-linux-${LIBC}"; exit; } ++ test x"${CPU}" != x && { echo "${CPU}-unknown-linux-gnu"; exit; } + ;; +- or1k:Linux:*:*) +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} +- exit ;; + or32:Linux:*:*) +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} ++ echo or32-unknown-linux-gnu + exit ;; + padre:Linux:*:*) +- echo sparc-unknown-linux-${LIBC} ++ echo sparc-unknown-linux-gnu + exit ;; + parisc64:Linux:*:* | hppa64:Linux:*:*) +- echo hppa64-unknown-linux-${LIBC} ++ echo hppa64-unknown-linux-gnu + exit ;; + parisc:Linux:*:* | hppa:Linux:*:*) + # Look for CPU level + case `grep '^cpu[^a-z]*:' /proc/cpuinfo 2>/dev/null | cut -d' ' -f2` in +- PA7*) echo hppa1.1-unknown-linux-${LIBC} ;; +- PA8*) echo hppa2.0-unknown-linux-${LIBC} ;; +- *) echo hppa-unknown-linux-${LIBC} ;; ++ PA7*) echo hppa1.1-unknown-linux-gnu ;; ++ PA8*) echo hppa2.0-unknown-linux-gnu ;; ++ *) echo hppa-unknown-linux-gnu ;; + esac + exit ;; + ppc64:Linux:*:*) +- echo powerpc64-unknown-linux-${LIBC} ++ echo powerpc64-unknown-linux-gnu + exit ;; + ppc:Linux:*:*) +- echo powerpc-unknown-linux-${LIBC} +- exit ;; +- ppc64le:Linux:*:*) +- echo powerpc64le-unknown-linux-${LIBC} +- exit ;; +- ppcle:Linux:*:*) +- echo powerpcle-unknown-linux-${LIBC} ++ echo powerpc-unknown-linux-gnu + exit ;; + s390:Linux:*:* | s390x:Linux:*:*) +- echo ${UNAME_MACHINE}-ibm-linux-${LIBC} ++ echo ${UNAME_MACHINE}-ibm-linux + exit ;; + sh64*:Linux:*:*) +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} ++ echo ${UNAME_MACHINE}-unknown-linux-gnu + exit ;; + sh*:Linux:*:*) +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} ++ echo ${UNAME_MACHINE}-unknown-linux-gnu + exit ;; + sparc:Linux:*:* | sparc64:Linux:*:*) +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} ++ echo ${UNAME_MACHINE}-unknown-linux-gnu + exit ;; + tile*:Linux:*:*) +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} ++ echo ${UNAME_MACHINE}-unknown-linux-gnu + exit ;; + vax:Linux:*:*) +- echo ${UNAME_MACHINE}-dec-linux-${LIBC} ++ echo ${UNAME_MACHINE}-dec-linux-gnu + exit ;; + x86_64:Linux:*:*) +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} ++ echo x86_64-unknown-linux-gnu + exit ;; + xtensa*:Linux:*:*) +- echo ${UNAME_MACHINE}-unknown-linux-${LIBC} ++ echo ${UNAME_MACHINE}-unknown-linux-gnu + exit ;; + i*86:DYNIX/ptx:4*:*) + # ptx 4.0 does uname -s correctly, with DYNIX/ptx in there. +@@ -1227,9 +1193,6 @@ + BePC:Haiku:*:*) # Haiku running on Intel PC compatible. + echo i586-pc-haiku + exit ;; +- x86_64:Haiku:*:*) +- echo x86_64-unknown-haiku +- exit ;; + SX-4:SUPER-UX:*:*) + echo sx4-nec-superux${UNAME_RELEASE} + exit ;; +@@ -1256,21 +1219,19 @@ + exit ;; + *:Darwin:*:*) + UNAME_PROCESSOR=`uname -p` || UNAME_PROCESSOR=unknown +- eval $set_cc_for_build +- if test "$UNAME_PROCESSOR" = unknown ; then +- UNAME_PROCESSOR=powerpc +- fi +- if [ "$CC_FOR_BUILD" != 'no_compiler_found' ]; then +- if (echo '#ifdef __LP64__'; echo IS_64BIT_ARCH; echo '#endif') | \ +- (CCOPTS= $CC_FOR_BUILD -E - 2>/dev/null) | \ +- grep IS_64BIT_ARCH >/dev/null +- then +- case $UNAME_PROCESSOR in +- i386) UNAME_PROCESSOR=x86_64 ;; +- powerpc) UNAME_PROCESSOR=powerpc64 ;; +- esac +- fi +- fi ++ case $UNAME_PROCESSOR in ++ i386) ++ eval $set_cc_for_build ++ if [ "$CC_FOR_BUILD" != 'no_compiler_found' ]; then ++ if (echo '#ifdef __LP64__'; echo IS_64BIT_ARCH; echo '#endif') | \ ++ (CCOPTS= $CC_FOR_BUILD -E - 2>/dev/null) | \ ++ grep IS_64BIT_ARCH >/dev/null ++ then ++ UNAME_PROCESSOR="x86_64" ++ fi ++ fi ;; ++ unknown) UNAME_PROCESSOR=powerpc ;; ++ esac + echo ${UNAME_PROCESSOR}-apple-darwin${UNAME_RELEASE} + exit ;; + *:procnto*:*:* | *:QNX:[0123456789]*:*) +@@ -1287,7 +1248,7 @@ + NEO-?:NONSTOP_KERNEL:*:*) + echo neo-tandem-nsk${UNAME_RELEASE} + exit ;; +- NSE-*:NONSTOP_KERNEL:*:*) ++ NSE-?:NONSTOP_KERNEL:*:*) + echo nse-tandem-nsk${UNAME_RELEASE} + exit ;; + NSR-?:NONSTOP_KERNEL:*:*) +@@ -1356,11 +1317,11 @@ + i*86:AROS:*:*) + echo ${UNAME_MACHINE}-pc-aros + exit ;; +- x86_64:VMkernel:*:*) +- echo ${UNAME_MACHINE}-unknown-esx +- exit ;; + esac + ++#echo '(No uname command or uname output not recognized.)' 1>&2 ++#echo "${UNAME_MACHINE}:${UNAME_SYSTEM}:${UNAME_RELEASE}:${UNAME_VERSION}" 1>&2 ++ + eval $set_cc_for_build + cat >$dummy.c <. ++# along with this program; if not, write to the Free Software ++# Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA ++# 02110-1301, USA. + # + # As a special exception to the GNU General Public License, if you + # distribute this file as part of a program that contains a + # configuration script generated by Autoconf, you may include it under +-# the same distribution terms that you use for the rest of that +-# program. This Exception is an additional permission under section 7 +-# of the GNU General Public License, version 3 ("GPLv3"). ++# the same distribution terms that you use for the rest of that program. + + +-# Please send patches with a ChangeLog entry to config-patches@gnu.org. ++# Please send patches to . Submit a context ++# diff and a properly formatted GNU ChangeLog entry. + # + # Configuration subroutine to validate and canonicalize a configuration type. + # Supply the specified configuration type as an argument. +@@ -68,7 +75,9 @@ + version="\ + GNU config.sub ($timestamp) + +-Copyright 1992-2013 Free Software Foundation, Inc. ++Copyright (C) 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, 2000, ++2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011 Free ++Software Foundation, Inc. + + This is free software; see the source for copying conditions. There is NO + warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE." +@@ -116,17 +125,13 @@ + maybe_os=`echo $1 | sed 's/^\(.*\)-\([^-]*-[^-]*\)$/\2/'` + case $maybe_os in + nto-qnx* | linux-gnu* | linux-android* | linux-dietlibc | linux-newlib* | \ +- linux-musl* | linux-uclibc* | uclinux-uclibc* | uclinux-gnu* | kfreebsd*-gnu* | \ ++ linux-uclibc* | uclinux-uclibc* | uclinux-gnu* | kfreebsd*-gnu* | \ + knetbsd*-gnu* | netbsd*-gnu* | \ + kopensolaris*-gnu* | \ + storm-chaos* | os2-emx* | rtmk-nova*) + os=-$maybe_os + basic_machine=`echo $1 | sed 's/^\(.*\)-\([^-]*-[^-]*\)$/\1/'` + ;; +- android-linux) +- os=-linux-android +- basic_machine=`echo $1 | sed 's/^\(.*\)-\([^-]*-[^-]*\)$/\1/'`-unknown +- ;; + *) + basic_machine=`echo $1 | sed 's/-[^-]*$//'` + if [ $basic_machine != $1 ] +@@ -149,7 +154,7 @@ + -convergent* | -ncr* | -news | -32* | -3600* | -3100* | -hitachi* |\ + -c[123]* | -convex* | -sun | -crds | -omron* | -dg | -ultra | -tti* | \ + -harris | -dolphin | -highlevel | -gould | -cbm | -ns | -masscomp | \ +- -apple | -axis | -knuth | -cray | -microblaze*) ++ -apple | -axis | -knuth | -cray | -microblaze) + os= + basic_machine=$1 + ;; +@@ -218,12 +223,6 @@ + -isc*) + basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` + ;; +- -lynx*178) +- os=-lynxos178 +- ;; +- -lynx*5) +- os=-lynxos5 +- ;; + -lynx*) + os=-lynxos + ;; +@@ -248,16 +247,13 @@ + # Some are omitted here because they have special meanings below. + 1750a | 580 \ + | a29k \ +- | aarch64 | aarch64_be \ + | alpha | alphaev[4-8] | alphaev56 | alphaev6[78] | alphapca5[67] \ + | alpha64 | alpha64ev[4-8] | alpha64ev56 | alpha64ev6[78] | alpha64pca5[67] \ + | am33_2.0 \ +- | arc | arceb \ +- | arm | arm[bl]e | arme[lb] | armv[2-8] | armv[3-8][lb] | armv7[arm] \ +- | avr | avr32 \ +- | be32 | be64 \ ++ | arc | arm | arm[bl]e | arme[lb] | armv[2345] | armv[345][lb] | avr | avr32 \ ++ | be32 | be64 \ + | bfin \ +- | c4x | c8051 | clipper \ ++ | c4x | clipper \ + | d10v | d30v | dlx | dsp16xx \ + | epiphany \ + | fido | fr30 | frv \ +@@ -268,7 +264,7 @@ + | le32 | le64 \ + | lm32 \ + | m32c | m32r | m32rle | m68000 | m68k | m88k \ +- | maxq | mb | microblaze | microblazeel | mcore | mep | metag \ ++ | maxq | mb | microblaze | mcore | mep | metag \ + | mips | mipsbe | mipseb | mipsel | mipsle \ + | mips16 \ + | mips64 | mips64el \ +@@ -286,21 +282,20 @@ + | mipsisa64r2 | mipsisa64r2el \ + | mipsisa64sb1 | mipsisa64sb1el \ + | mipsisa64sr71k | mipsisa64sr71kel \ +- | mipsr5900 | mipsr5900el \ + | mipstx39 | mipstx39el \ + | mn10200 | mn10300 \ + | moxie \ + | mt \ + | msp430 \ + | nds32 | nds32le | nds32be \ +- | nios | nios2 | nios2eb | nios2el \ ++ | nios | nios2 \ + | ns16k | ns32k \ + | open8 \ +- | or1k | or32 \ ++ | or32 \ + | pdp10 | pdp11 | pj | pjl \ + | powerpc | powerpc64 | powerpc64le | powerpcle \ + | pyramid \ +- | rl78 | rx \ ++ | rx \ + | score \ + | sh | sh[1234] | sh[24]a | sh[24]aeb | sh[23]e | sh[34]eb | sheb | shbe | shle | sh[1234]le | sh3ele \ + | sh64 | sh64le \ +@@ -324,7 +319,8 @@ + c6x) + basic_machine=tic6x-unknown + ;; +- m6811 | m68hc11 | m6812 | m68hc12 | m68hcs12x | picochip) ++ m6811 | m68hc11 | m6812 | m68hc12 | picochip) ++ # Motorola 68HC11/12. + basic_machine=$basic_machine-unknown + os=-none + ;; +@@ -337,10 +333,7 @@ + strongarm | thumb | xscale) + basic_machine=arm-unknown + ;; +- xgate) +- basic_machine=$basic_machine-unknown +- os=-none +- ;; ++ + xscaleeb) + basic_machine=armeb-unknown + ;; +@@ -363,16 +356,15 @@ + # Recognize the basic CPU types with company name. + 580-* \ + | a29k-* \ +- | aarch64-* | aarch64_be-* \ + | alpha-* | alphaev[4-8]-* | alphaev56-* | alphaev6[78]-* \ + | alpha64-* | alpha64ev[4-8]-* | alpha64ev56-* | alpha64ev6[78]-* \ +- | alphapca5[67]-* | alpha64pca5[67]-* | arc-* | arceb-* \ ++ | alphapca5[67]-* | alpha64pca5[67]-* | arc-* \ + | arm-* | armbe-* | armle-* | armeb-* | armv*-* \ + | avr-* | avr32-* \ + | be32-* | be64-* \ + | bfin-* | bs2000-* \ + | c[123]* | c30-* | [cjt]90-* | c4x-* \ +- | c8051-* | clipper-* | craynv-* | cydra-* \ ++ | clipper-* | craynv-* | cydra-* \ + | d10v-* | d30v-* | dlx-* \ + | elxsi-* \ + | f30[01]-* | f700-* | fido-* | fr30-* | frv-* | fx80-* \ +@@ -385,8 +377,7 @@ + | lm32-* \ + | m32c-* | m32r-* | m32rle-* \ + | m68000-* | m680[012346]0-* | m68360-* | m683?2-* | m68k-* \ +- | m88110-* | m88k-* | maxq-* | mcore-* | metag-* \ +- | microblaze-* | microblazeel-* \ ++ | m88110-* | m88k-* | maxq-* | mcore-* | metag-* | microblaze-* \ + | mips-* | mipsbe-* | mipseb-* | mipsel-* | mipsle-* \ + | mips16-* \ + | mips64-* | mips64el-* \ +@@ -404,20 +395,19 @@ + | mipsisa64r2-* | mipsisa64r2el-* \ + | mipsisa64sb1-* | mipsisa64sb1el-* \ + | mipsisa64sr71k-* | mipsisa64sr71kel-* \ +- | mipsr5900-* | mipsr5900el-* \ + | mipstx39-* | mipstx39el-* \ + | mmix-* \ + | mt-* \ + | msp430-* \ + | nds32-* | nds32le-* | nds32be-* \ +- | nios-* | nios2-* | nios2eb-* | nios2el-* \ ++ | nios-* | nios2-* \ + | none-* | np1-* | ns16k-* | ns32k-* \ + | open8-* \ + | orion-* \ + | pdp10-* | pdp11-* | pj-* | pjl-* | pn-* | power-* \ + | powerpc-* | powerpc64-* | powerpc64le-* | powerpcle-* \ + | pyramid-* \ +- | rl78-* | romp-* | rs6000-* | rx-* \ ++ | romp-* | rs6000-* | rx-* \ + | sh-* | sh[1234]-* | sh[24]a-* | sh[24]aeb-* | sh[23]e-* | sh[34]eb-* | sheb-* | shbe-* \ + | shle-* | sh[1234]le-* | sh3ele-* | sh64-* | sh64le-* \ + | sparc-* | sparc64-* | sparc64b-* | sparc64v-* | sparc86x-* | sparclet-* \ +@@ -729,6 +719,7 @@ + i370-ibm* | ibm*) + basic_machine=i370-ibm + ;; ++# I'm not sure what "Sysv32" means. Should this be sysv3.2? + i*86v32) + basic_machine=`echo $1 | sed -e 's/86.*/86-pc/'` + os=-sysv32 +@@ -786,15 +777,11 @@ + basic_machine=ns32k-utek + os=-sysv + ;; +- microblaze*) ++ microblaze) + basic_machine=microblaze-xilinx + ;; +- mingw64) +- basic_machine=x86_64-pc +- os=-mingw64 +- ;; + mingw32) +- basic_machine=i686-pc ++ basic_machine=i386-pc + os=-mingw32 + ;; + mingw32ce) +@@ -829,10 +816,6 @@ + ms1-*) + basic_machine=`echo $basic_machine | sed -e 's/ms1-/mt-/'` + ;; +- msys) +- basic_machine=i686-pc +- os=-msys +- ;; + mvs) + basic_machine=i370-ibm + os=-mvs +@@ -1021,11 +1004,7 @@ + basic_machine=i586-unknown + os=-pw32 + ;; +- rdos | rdos64) +- basic_machine=x86_64-pc +- os=-rdos +- ;; +- rdos32) ++ rdos) + basic_machine=i386-pc + os=-rdos + ;; +@@ -1352,21 +1331,21 @@ + -gnu* | -bsd* | -mach* | -minix* | -genix* | -ultrix* | -irix* \ + | -*vms* | -sco* | -esix* | -isc* | -aix* | -cnk* | -sunos | -sunos[34]*\ + | -hpux* | -unos* | -osf* | -luna* | -dgux* | -auroraux* | -solaris* \ +- | -sym* | -kopensolaris* | -plan9* \ ++ | -sym* | -kopensolaris* \ + | -amigaos* | -amigados* | -msdos* | -newsos* | -unicos* | -aof* \ + | -aos* | -aros* \ + | -nindy* | -vxsim* | -vxworks* | -ebmon* | -hms* | -mvs* \ + | -clix* | -riscos* | -uniplus* | -iris* | -rtu* | -xenix* \ + | -hiux* | -386bsd* | -knetbsd* | -mirbsd* | -netbsd* \ +- | -bitrig* | -openbsd* | -solidbsd* \ ++ | -openbsd* | -solidbsd* \ + | -ekkobsd* | -kfreebsd* | -freebsd* | -riscix* | -lynxos* \ + | -bosx* | -nextstep* | -cxux* | -aout* | -elf* | -oabi* \ + | -ptx* | -coff* | -ecoff* | -winnt* | -domain* | -vsta* \ + | -udi* | -eabi* | -lites* | -ieee* | -go32* | -aux* \ + | -chorusos* | -chorusrdb* | -cegcc* \ +- | -cygwin* | -msys* | -pe* | -psos* | -moss* | -proelf* | -rtems* \ +- | -mingw32* | -mingw64* | -linux-gnu* | -linux-android* \ +- | -linux-newlib* | -linux-musl* | -linux-uclibc* \ ++ | -cygwin* | -pe* | -psos* | -moss* | -proelf* | -rtems* \ ++ | -mingw32* | -linux-gnu* | -linux-android* \ ++ | -linux-newlib* | -linux-uclibc* \ + | -uxpv* | -beos* | -mpeix* | -udk* \ + | -interix* | -uwin* | -mks* | -rhapsody* | -darwin* | -opened* \ + | -openstep* | -oskit* | -conix* | -pw32* | -nonstopux* \ +@@ -1498,6 +1477,9 @@ + -aros*) + os=-aros + ;; ++ -kaos*) ++ os=-kaos ++ ;; + -zvmoe) + os=-zvmoe + ;; +@@ -1546,12 +1528,6 @@ + c4x-* | tic4x-*) + os=-coff + ;; +- c8051-*) +- os=-elf +- ;; +- hexagon-*) +- os=-elf +- ;; + tic54x-*) + os=-coff + ;; +@@ -1579,6 +1555,9 @@ + ;; + m68000-sun) + os=-sunos3 ++ # This also exists in the configure program, but was not the ++ # default. ++ # os=-sunos4 + ;; + m68*-cisco) + os=-aout +@@ -1592,9 +1571,6 @@ + mips*-*) + os=-elf + ;; +- or1k-*) +- os=-elf +- ;; + or32-*) + os=-coff + ;; +diff -rNu a/config/install-sh b/config/install-sh +--- a/config/install-sh 2013-07-03 02:42:49.000000000 +1000 ++++ b/config/install-sh 2012-09-09 04:16:41.000000000 +1000 +@@ -1,7 +1,7 @@ + #!/bin/sh + # install - install a program, script, or datafile + +-scriptversion=2011-11-20.07; # UTC ++scriptversion=2011-01-19.21; # UTC + + # This originates from X11R5 (mit/util/scripts/install.sh), which was + # later released in X11R6 (xc/config/util/install.sh) with the +@@ -35,7 +35,7 @@ + # FSF changes to this file are in the public domain. + # + # Calling this script install-sh is preferred over install.sh, to prevent +-# 'make' implicit rules from creating a file called install from it ++# `make' implicit rules from creating a file called install from it + # when there is no Makefile. + # + # This script is compatible with the BSD install script, but was written +@@ -156,7 +156,7 @@ + -s) stripcmd=$stripprog;; + + -t) dst_arg=$2 +- # Protect names problematic for 'test' and other utilities. ++ # Protect names problematic for `test' and other utilities. + case $dst_arg in + -* | [=\(\)!]) dst_arg=./$dst_arg;; + esac +@@ -190,7 +190,7 @@ + fi + shift # arg + dst_arg=$arg +- # Protect names problematic for 'test' and other utilities. ++ # Protect names problematic for `test' and other utilities. + case $dst_arg in + -* | [=\(\)!]) dst_arg=./$dst_arg;; + esac +@@ -202,7 +202,7 @@ + echo "$0: no input file specified." >&2 + exit 1 + fi +- # It's OK to call 'install-sh -d' without argument. ++ # It's OK to call `install-sh -d' without argument. + # This can happen when creating conditional directories. + exit 0 + fi +@@ -240,7 +240,7 @@ + + for src + do +- # Protect names problematic for 'test' and other utilities. ++ # Protect names problematic for `test' and other utilities. + case $src in + -* | [=\(\)!]) src=./$src;; + esac +@@ -354,7 +354,7 @@ + if test -z "$dir_arg" || { + # Check for POSIX incompatibilities with -m. + # HP-UX 11.23 and IRIX 6.5 mkdir -m -p sets group- or +- # other-writable bit of parent directory when it shouldn't. ++ # other-writeable bit of parent directory when it shouldn't. + # FreeBSD 6.1 mkdir -m -p sets mode of existing directory. + ls_ld_tmpdir=`ls -ld "$tmpdir"` + case $ls_ld_tmpdir in +diff -rNu a/config/ltmain.sh b/config/ltmain.sh +--- a/config/ltmain.sh 2013-07-03 02:42:49.000000000 +1000 ++++ b/config/ltmain.sh 2012-09-09 04:16:41.000000000 +1000 +@@ -70,7 +70,7 @@ + # compiler: $LTCC + # compiler flags: $LTCFLAGS + # linker: $LD (gnu? $with_gnu_ld) +-# $progname: (GNU libtool) 2.4.2 Debian-2.4.2-1.3ubuntu1 ++# $progname: (GNU libtool) 2.4.2 + # automake: $automake_version + # autoconf: $autoconf_version + # +@@ -80,7 +80,7 @@ + + PROGRAM=libtool + PACKAGE=libtool +-VERSION="2.4.2 Debian-2.4.2-1.3ubuntu1" ++VERSION=2.4.2 + TIMESTAMP="" + package_revision=1.3337 + +@@ -5851,9 +5851,10 @@ + # -tp=* Portland pgcc target processor selection + # --sysroot=* for sysroot support + # -O*, -flto*, -fwhopr*, -fuse-linker-plugin GCC link-time optimization ++ # -stdlib=* select c++ std lib with clang + -64|-mips[0-9]|-r[0-9][0-9]*|-xarch=*|-xtarget=*|+DA*|+DD*|-q*|-m*| \ + -t[45]*|-txscale*|-p|-pg|--coverage|-fprofile-*|-F*|@*|-tp=*|--sysroot=*| \ +- -O*|-flto*|-fwhopr*|-fuse-linker-plugin) ++ -O*|-flto*|-fwhopr*|-fuse-linker-plugin|-stdlib=*) + func_quote_for_eval "$arg" + arg="$func_quote_for_eval_result" + func_append compile_command " $arg" +@@ -6124,10 +6125,7 @@ + case $pass in + dlopen) libs="$dlfiles" ;; + dlpreopen) libs="$dlprefiles" ;; +- link) +- libs="$deplibs %DEPLIBS%" +- test "X$link_all_deplibs" != Xno && libs="$libs $dependency_libs" +- ;; ++ link) libs="$deplibs %DEPLIBS% $dependency_libs" ;; + esac + fi + if test "$linkmode,$pass" = "lib,dlpreopen"; then +@@ -6447,19 +6445,19 @@ + # It is a libtool convenience library, so add in its objects. + func_append convenience " $ladir/$objdir/$old_library" + func_append old_convenience " $ladir/$objdir/$old_library" +- tmp_libs= +- for deplib in $dependency_libs; do +- deplibs="$deplib $deplibs" +- if $opt_preserve_dup_deps ; then +- case "$tmp_libs " in +- *" $deplib "*) func_append specialdeplibs " $deplib" ;; +- esac +- fi +- func_append tmp_libs " $deplib" +- done + elif test "$linkmode" != prog && test "$linkmode" != lib; then + func_fatal_error "\`$lib' is not a convenience library" + fi ++ tmp_libs= ++ for deplib in $dependency_libs; do ++ deplibs="$deplib $deplibs" ++ if $opt_preserve_dup_deps ; then ++ case "$tmp_libs " in ++ *" $deplib "*) func_append specialdeplibs " $deplib" ;; ++ esac ++ fi ++ func_append tmp_libs " $deplib" ++ done + continue + fi # $pass = conv + +@@ -7352,9 +7350,6 @@ + revision="$number_minor" + lt_irix_increment=no + ;; +- *) +- func_fatal_configuration "$modename: unknown library version type \`$version_type'" +- ;; + esac + ;; + no) +diff -rNu a/configure b/configure +--- a/configure 2015-03-25 11:42:46.000000000 +1000 ++++ b/configure 2015-04-21 17:09:47.000000000 +1000 +@@ -2397,7 +2397,7 @@ + + + +-am__api_version='1.13' ++am__api_version='1.14' + + # Find a good install program. We prefer a C program (faster), + # so one script is as good as another. But avoid the broken or +@@ -2934,6 +2934,47 @@ + + + ++# POSIX will say in a future version that running "rm -f" with no argument ++# is OK; and we want to be able to make that assumption in our Makefile ++# recipes. So use an aggressive probe to check that the usage we want is ++# actually supported "in the wild" to an acceptable degree. ++# See automake bug#10828. ++# To make any issue more visible, cause the running configure to be aborted ++# by default if the 'rm' program in use doesn't match our expectations; the ++# user can still override this though. ++if rm -f && rm -fr && rm -rf; then : OK; else ++ cat >&2 <<'END' ++Oops! ++ ++Your 'rm' program seems unable to run without file operands specified ++on the command line, even when the '-f' option is present. This is contrary ++to the behaviour of most rm programs out there, and not conforming with ++the upcoming POSIX standard: ++ ++Please tell bug-automake@gnu.org about your system, including the value ++of your $PATH and any error possibly output before this message. This ++can help us improve future automake versions. ++ ++END ++ if test x"$ACCEPT_INFERIOR_RM_PROGRAM" = x"yes"; then ++ echo 'Configuration will proceed anyway, since you have set the' >&2 ++ echo 'ACCEPT_INFERIOR_RM_PROGRAM variable to "yes"' >&2 ++ echo >&2 ++ else ++ cat >&2 <<'END' ++Aborting the configuration process, to ensure you take notice of the issue. ++ ++You can download and install GNU coreutils to get an 'rm' implementation ++that behaves properly: . ++ ++If you want to complete the configuration process using your problematic ++'rm' anyway, export the environment variable ACCEPT_INFERIOR_RM_PROGRAM ++to "yes", and re-run configure. ++ ++END ++ as_fn_error $? "Your 'rm' program is bad, sorry." "$LINENO" 5 ++ fi ++fi + # Check whether --enable-silent-rules was given. + if test "${enable_silent_rules+set}" = set; then : + enableval=$enable_silent_rules; +@@ -3764,6 +3805,65 @@ + ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' + ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' + ac_compiler_gnu=$ac_cv_c_compiler_gnu ++ ++ac_ext=c ++ac_cpp='$CPP $CPPFLAGS' ++ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ++ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ++ac_compiler_gnu=$ac_cv_c_compiler_gnu ++{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether $CC understands -c and -o together" >&5 ++$as_echo_n "checking whether $CC understands -c and -o together... " >&6; } ++if ${am_cv_prog_cc_c_o+:} false; then : ++ $as_echo_n "(cached) " >&6 ++else ++ cat confdefs.h - <<_ACEOF >conftest.$ac_ext ++/* end confdefs.h. */ ++ ++int ++main () ++{ ++ ++ ; ++ return 0; ++} ++_ACEOF ++ # Make sure it works both with $CC and with simple cc. ++ # Following AC_PROG_CC_C_O, we do the test twice because some ++ # compilers refuse to overwrite an existing .o file with -o, ++ # though they will create one. ++ am_cv_prog_cc_c_o=yes ++ for am_i in 1 2; do ++ if { echo "$as_me:$LINENO: $CC -c conftest.$ac_ext -o conftest2.$ac_objext" >&5 ++ ($CC -c conftest.$ac_ext -o conftest2.$ac_objext) >&5 2>&5 ++ ac_status=$? ++ echo "$as_me:$LINENO: \$? = $ac_status" >&5 ++ (exit $ac_status); } \ ++ && test -f conftest2.$ac_objext; then ++ : OK ++ else ++ am_cv_prog_cc_c_o=no ++ break ++ fi ++ done ++ rm -f core conftest* ++ unset am_i ++fi ++{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $am_cv_prog_cc_c_o" >&5 ++$as_echo "$am_cv_prog_cc_c_o" >&6; } ++if test "$am_cv_prog_cc_c_o" != yes; then ++ # Losing compiler, so override with the script. ++ # FIXME: It is wrong to rewrite CC. ++ # But if we don't then we get into trouble of one sort or another. ++ # A longer-term fix would be to have automake use am__CC in this case, ++ # and then we could set am__CC="\$(top_srcdir)/compile \$(CC)" ++ CC="$am_aux_dir/compile $CC" ++fi ++ac_ext=c ++ac_cpp='$CPP $CPPFLAGS' ++ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ++ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ++ac_compiler_gnu=$ac_cv_c_compiler_gnu ++ + DEPDIR="${am__leading_dot}deps" + + ac_config_commands="$ac_config_commands depfiles" +@@ -4952,8 +5052,7 @@ + ;; + *) + lt_cv_sys_max_cmd_len=`(getconf ARG_MAX) 2> /dev/null` +- if test -n "$lt_cv_sys_max_cmd_len" && \ +- test undefined != "$lt_cv_sys_max_cmd_len"; then ++ if test -n "$lt_cv_sys_max_cmd_len"; then + lt_cv_sys_max_cmd_len=`expr $lt_cv_sys_max_cmd_len \/ 4` + lt_cv_sys_max_cmd_len=`expr $lt_cv_sys_max_cmd_len \* 3` + else +@@ -5354,6 +5453,10 @@ + fi + ;; + ++gnu*) ++ lt_cv_deplibs_check_method=pass_all ++ ;; ++ + haiku*) + lt_cv_deplibs_check_method=pass_all + ;; +@@ -5392,11 +5495,11 @@ + ;; + + # This must be glibc/ELF. +-linux* | k*bsd*-gnu | kopensolaris*-gnu | gnu*) ++linux* | k*bsd*-gnu | kopensolaris*-gnu) + lt_cv_deplibs_check_method=pass_all + ;; + +-netbsd* | netbsdelf*-gnu) ++netbsd*) + if echo __ELF__ | $CC -E - | $GREP __ELF__ > /dev/null; then + lt_cv_deplibs_check_method='match_pattern /lib[^/]+(\.so\.[0-9]+\.[0-9]+|_pic\.a)$' + else +@@ -6490,14 +6593,7 @@ + LD="${LD-ld} -m elf_i386_fbsd" + ;; + x86_64-*linux*) +- case `/usr/bin/file conftest.o` in +- *x86-64*) +- LD="${LD-ld} -m elf32_x86_64" +- ;; +- *) +- LD="${LD-ld} -m elf_i386" +- ;; +- esac ++ LD="${LD-ld} -m elf_i386" + ;; + ppc64-*linux*|powerpc64-*linux*) + LD="${LD-ld} -m elf32ppclinux" +@@ -8326,7 +8422,7 @@ + lt_prog_compiler_static='-non_shared' + ;; + +- linux* | k*bsd*-gnu | kopensolaris*-gnu | gnu*) ++ linux* | k*bsd*-gnu | kopensolaris*-gnu) + case $cc_basename in + # old Intel for x86_64 which still supported -KPIC. + ecc*) +@@ -8804,9 +8900,6 @@ + openbsd*) + with_gnu_ld=no + ;; +- linux* | k*bsd*-gnu | gnu*) +- link_all_deplibs=no +- ;; + esac + + ld_shlibs=yes +@@ -9028,7 +9121,7 @@ + fi + ;; + +- netbsd* | netbsdelf*-gnu) ++ netbsd*) + if echo __ELF__ | $CC -E - | $GREP __ELF__ >/dev/null; then + archive_cmds='$LD -Bshareable $libobjs $deplibs $linker_flags -o $lib' + wlarc= +@@ -9205,7 +9298,6 @@ + if test "$aix_use_runtimelinking" = yes; then + shared_flag="$shared_flag "'${wl}-G' + fi +- link_all_deplibs=no + else + # not using gcc + if test "$host_cpu" = ia64; then +@@ -9659,7 +9751,7 @@ + link_all_deplibs=yes + ;; + +- netbsd* | netbsdelf*-gnu) ++ netbsd*) + if echo __ELF__ | $CC -E - | $GREP __ELF__ >/dev/null; then + archive_cmds='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags' # a.out + else +@@ -10496,6 +10588,17 @@ + esac + ;; + ++gnu*) ++ version_type=linux # correct to gnu/linux during the next big refactor ++ need_lib_prefix=no ++ need_version=no ++ library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}${major} ${libname}${shared_ext}' ++ soname_spec='${libname}${release}${shared_ext}$major' ++ shlibpath_var=LD_LIBRARY_PATH ++ shlibpath_overrides_runpath=no ++ hardcode_into_libs=yes ++ ;; ++ + haiku*) + version_type=linux # correct to gnu/linux during the next big refactor + need_lib_prefix=no +@@ -10612,7 +10715,7 @@ + ;; + + # This must be glibc/ELF. +-linux* | k*bsd*-gnu | kopensolaris*-gnu | gnu*) ++linux* | k*bsd*-gnu | kopensolaris*-gnu) + version_type=linux # correct to gnu/linux during the next big refactor + need_lib_prefix=no + need_version=no +@@ -10676,18 +10779,6 @@ + dynamic_linker='GNU/Linux ld.so' + ;; + +-netbsdelf*-gnu) +- version_type=linux +- need_lib_prefix=no +- need_version=no +- library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${shared_ext}' +- soname_spec='${libname}${release}${shared_ext}$major' +- shlibpath_var=LD_LIBRARY_PATH +- shlibpath_overrides_runpath=no +- hardcode_into_libs=yes +- dynamic_linker='NetBSD ld.elf_so' +- ;; +- + netbsd*) + version_type=sunos + need_lib_prefix=no +diff -rNu a/doc/Makefile.in b/doc/Makefile.in +--- a/doc/Makefile.in 2015-03-25 11:42:44.000000000 +1000 ++++ b/doc/Makefile.in 2015-04-21 17:09:42.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/doc/css/Makefile.in b/doc/css/Makefile.in +--- a/doc/css/Makefile.in 2015-03-25 11:42:44.000000000 +1000 ++++ b/doc/css/Makefile.in 2015-04-21 17:09:42.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/doc/examples/Makefile.in b/doc/examples/Makefile.in +--- a/doc/examples/Makefile.in 2015-03-25 11:42:44.000000000 +1000 ++++ b/doc/examples/Makefile.in 2015-04-21 17:09:42.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/doc/examples/compute_prior_dist_example_output_files/Makefile.in b/doc/examples/compute_prior_dist_example_output_files/Makefile.in +--- a/doc/examples/compute_prior_dist_example_output_files/Makefile.in 2015-03-25 11:42:44.000000000 +1000 ++++ b/doc/examples/compute_prior_dist_example_output_files/Makefile.in 2015-04-21 17:09:42.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/doc/examples/sample_opal_scripts/Makefile.in b/doc/examples/sample_opal_scripts/Makefile.in +--- a/doc/examples/sample_opal_scripts/Makefile.in 2015-03-25 11:42:44.000000000 +1000 ++++ b/doc/examples/sample_opal_scripts/Makefile.in 2015-04-21 17:09:42.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/doc/gomo.html b/doc/gomo.html +--- a/doc/gomo.html 2015-03-25 10:44:44.000000000 +1000 ++++ b/doc/gomo.html 2015-04-21 14:11:37.000000000 +1000 +@@ -77,9 +77,9 @@ +
    + 	    ama -oc ama_out -pvalues <motif_file> <fasta_sequence_file> <background_file> 
    +           
    +-

    By default GOMo calculates uses the p-value given ++

    By default GOMo uses the p-value given + for each gene in the CisML file to rank the genes. +- Any sequence failing to provide a p-value will prompt GOMo to exit. ++ Any sequence failing to provide a p-value will cause GOMo to exit. + The --gs switch causes GOMo to use the + gene scores from the CisML file instead for ranking genes.

    +
    +@@ -171,7 +171,7 @@ + --gs  + Use the scores contained in the CisML file for + ranking genes. Any sequence failing to provide a score +- will prompt GOMo to exit. ++ will cause GOMo to exit. + Use the p-values contained in the CisML file + for ranking genes. + +diff -rNu a/doc/images/Makefile.in b/doc/images/Makefile.in +--- a/doc/images/Makefile.in 2015-03-25 11:42:44.000000000 +1000 ++++ b/doc/images/Makefile.in 2015-04-21 17:09:42.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/doc/js/Makefile.in b/doc/js/Makefile.in +--- a/doc/js/Makefile.in 2015-03-25 11:42:44.000000000 +1000 ++++ b/doc/js/Makefile.in 2015-04-21 17:09:42.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/doc/js/menu-data.js b/doc/js/menu-data.js +--- a/doc/js/menu-data.js 2015-03-25 10:44:45.000000000 +1000 ++++ b/doc/js/menu-data.js 2015-04-21 14:11:37.000000000 +1000 +@@ -453,13 +453,13 @@ + "server": true, + "topics": [ + { +- "title": "MEME Suite .org", ++ "title": "Main Server", + "info": "The main MEME Suite site.", + "url": "http://meme-suite.org", + "absolute": true + }, + { +- "title": "MEME Suite .org 2", ++ "title": "Alternate Server", + "info": "The alternate main MEME Suite site.", + "url": "http://alternate.meme-suite.org", + "absolute": true +@@ -470,7 +470,7 @@ + "absolute": true + }, + { +- "title": "GenQuest", ++ "title": "GenQuest (France)", + "url": "http://tools.genouest.org/tools/meme/", + "absolute": true + } +diff -rNu a/etc/Makefile.in b/etc/Makefile.in +--- a/etc/Makefile.in 2015-03-25 11:42:44.000000000 +1000 ++++ b/etc/Makefile.in 2015-04-21 17:09:43.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/m4/libtool.m4 b/m4/libtool.m4 +--- a/m4/libtool.m4 2013-07-03 02:42:49.000000000 +1000 ++++ b/m4/libtool.m4 2012-09-09 04:16:41.000000000 +1000 +@@ -1324,14 +1324,7 @@ + LD="${LD-ld} -m elf_i386_fbsd" + ;; + x86_64-*linux*) +- case `/usr/bin/file conftest.o` in +- *x86-64*) +- LD="${LD-ld} -m elf32_x86_64" +- ;; +- *) +- LD="${LD-ld} -m elf_i386" +- ;; +- esac ++ LD="${LD-ld} -m elf_i386" + ;; + ppc64-*linux*|powerpc64-*linux*) + LD="${LD-ld} -m elf32ppclinux" +@@ -1695,8 +1688,7 @@ + ;; + *) + lt_cv_sys_max_cmd_len=`(getconf ARG_MAX) 2> /dev/null` +- if test -n "$lt_cv_sys_max_cmd_len" && \ +- test undefined != "$lt_cv_sys_max_cmd_len"; then ++ if test -n "$lt_cv_sys_max_cmd_len"; then + lt_cv_sys_max_cmd_len=`expr $lt_cv_sys_max_cmd_len \/ 4` + lt_cv_sys_max_cmd_len=`expr $lt_cv_sys_max_cmd_len \* 3` + else +@@ -2520,6 +2512,17 @@ + esac + ;; + ++gnu*) ++ version_type=linux # correct to gnu/linux during the next big refactor ++ need_lib_prefix=no ++ need_version=no ++ library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}${major} ${libname}${shared_ext}' ++ soname_spec='${libname}${release}${shared_ext}$major' ++ shlibpath_var=LD_LIBRARY_PATH ++ shlibpath_overrides_runpath=no ++ hardcode_into_libs=yes ++ ;; ++ + haiku*) + version_type=linux # correct to gnu/linux during the next big refactor + need_lib_prefix=no +@@ -2636,7 +2639,7 @@ + ;; + + # This must be glibc/ELF. +-linux* | k*bsd*-gnu | kopensolaris*-gnu | gnu*) ++linux* | k*bsd*-gnu | kopensolaris*-gnu) + version_type=linux # correct to gnu/linux during the next big refactor + need_lib_prefix=no + need_version=no +@@ -2681,18 +2684,6 @@ + dynamic_linker='GNU/Linux ld.so' + ;; + +-netbsdelf*-gnu) +- version_type=linux +- need_lib_prefix=no +- need_version=no +- library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${shared_ext}' +- soname_spec='${libname}${release}${shared_ext}$major' +- shlibpath_var=LD_LIBRARY_PATH +- shlibpath_overrides_runpath=no +- hardcode_into_libs=yes +- dynamic_linker='NetBSD ld.elf_so' +- ;; +- + netbsd*) + version_type=sunos + need_lib_prefix=no +@@ -3252,6 +3243,10 @@ + fi + ;; + ++gnu*) ++ lt_cv_deplibs_check_method=pass_all ++ ;; ++ + haiku*) + lt_cv_deplibs_check_method=pass_all + ;; +@@ -3290,11 +3285,11 @@ + ;; + + # This must be glibc/ELF. +-linux* | k*bsd*-gnu | kopensolaris*-gnu | gnu*) ++linux* | k*bsd*-gnu | kopensolaris*-gnu) + lt_cv_deplibs_check_method=pass_all + ;; + +-netbsd* | netbsdelf*-gnu) ++netbsd*) + if echo __ELF__ | $CC -E - | $GREP __ELF__ > /dev/null; then + lt_cv_deplibs_check_method='match_pattern /lib[[^/]]+(\.so\.[[0-9]]+\.[[0-9]]+|_pic\.a)$' + else +@@ -4042,7 +4037,7 @@ + ;; + esac + ;; +- linux* | k*bsd*-gnu | kopensolaris*-gnu | gnu*) ++ linux* | k*bsd*-gnu | kopensolaris*-gnu) + case $cc_basename in + KCC*) + # KAI C++ Compiler +@@ -4106,7 +4101,7 @@ + ;; + esac + ;; +- netbsd* | netbsdelf*-gnu) ++ netbsd*) + ;; + *qnx* | *nto*) + # QNX uses GNU C++, but need to define -shared option too, otherwise +@@ -4341,7 +4336,7 @@ + _LT_TAGVAR(lt_prog_compiler_static, $1)='-non_shared' + ;; + +- linux* | k*bsd*-gnu | kopensolaris*-gnu | gnu*) ++ linux* | k*bsd*-gnu | kopensolaris*-gnu) + case $cc_basename in + # old Intel for x86_64 which still supported -KPIC. + ecc*) +@@ -4583,9 +4578,6 @@ + ;; + esac + ;; +- linux* | k*bsd*-gnu | gnu*) +- _LT_TAGVAR(link_all_deplibs, $1)=no +- ;; + *) + _LT_TAGVAR(export_symbols_cmds, $1)='$NM $libobjs $convenience | $global_symbol_pipe | $SED '\''s/.* //'\'' | sort | uniq > $export_symbols' + ;; +@@ -4648,9 +4640,6 @@ + openbsd*) + with_gnu_ld=no + ;; +- linux* | k*bsd*-gnu | gnu*) +- _LT_TAGVAR(link_all_deplibs, $1)=no +- ;; + esac + + _LT_TAGVAR(ld_shlibs, $1)=yes +@@ -4872,7 +4861,7 @@ + fi + ;; + +- netbsd* | netbsdelf*-gnu) ++ netbsd*) + if echo __ELF__ | $CC -E - | $GREP __ELF__ >/dev/null; then + _LT_TAGVAR(archive_cmds, $1)='$LD -Bshareable $libobjs $deplibs $linker_flags -o $lib' + wlarc= +@@ -5049,7 +5038,6 @@ + if test "$aix_use_runtimelinking" = yes; then + shared_flag="$shared_flag "'${wl}-G' + fi +- _LT_TAGVAR(link_all_deplibs, $1)=no + else + # not using gcc + if test "$host_cpu" = ia64; then +@@ -5354,7 +5342,7 @@ + _LT_TAGVAR(link_all_deplibs, $1)=yes + ;; + +- netbsd* | netbsdelf*-gnu) ++ netbsd*) + if echo __ELF__ | $CC -E - | $GREP __ELF__ >/dev/null; then + _LT_TAGVAR(archive_cmds, $1)='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags' # a.out + else +@@ -6234,6 +6222,9 @@ + _LT_TAGVAR(ld_shlibs, $1)=yes + ;; + ++ gnu*) ++ ;; ++ + haiku*) + _LT_TAGVAR(archive_cmds, $1)='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' + _LT_TAGVAR(link_all_deplibs, $1)=yes +@@ -6395,7 +6386,7 @@ + _LT_TAGVAR(inherit_rpath, $1)=yes + ;; + +- linux* | k*bsd*-gnu | kopensolaris*-gnu | gnu*) ++ linux* | k*bsd*-gnu | kopensolaris*-gnu) + case $cc_basename in + KCC*) + # Kuck and Associates, Inc. (KAI) C++ Compiler +diff -rNu a/scripts/Makefile.in b/scripts/Makefile.in +--- a/scripts/Makefile.in 2015-03-25 11:42:44.000000000 +1000 ++++ b/scripts/Makefile.in 2015-04-21 17:09:43.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/scripts/ame_webservice.pl.in b/scripts/ame_webservice.pl.in +--- a/scripts/ame_webservice.pl.in 2015-03-25 10:44:46.000000000 +1000 ++++ b/scripts/ame_webservice.pl.in 2015-04-21 16:47:41.000000000 +1000 +@@ -74,7 +74,6 @@ + my $pwm_threshold = undef; + my $pvalue_report_threshold = undef; + my $bgformat = undef; +-my $bgfile = undef; + my $help = 0; # FALSE + + # derivative parameters +@@ -131,7 +130,7 @@ + # pwm_threshold: no illegal values? + + if (defined$pvalue_report_threshold) { +- unless ($pvalue_report_threshold > 0 && $pvalue_threshold <= 1) { ++ unless ($pvalue_report_threshold > 0 && $pvalue_report_threshold <= 1) { + push(@arg_errors, "Illegal value for parameter --pvalue-report-threshold."); + } + } +@@ -260,6 +259,9 @@ + TMPDIR => $tmp_dir + ); + ++# Finish up ++write_invocation_log($log_file, $log_date, $log_args); ++ + exit(0); + + # Run the program and record if it succeeded to the status messages +@@ -287,7 +289,7 @@ + } else { + $status_msg = $prog . " exited with error code " . ($status_code >> 8); + } +- print STDERR $status_msg; ++ print STDERR "$status_msg\n"; + push(@{$file_list}, {file => $messages, desc => 'Error Messages'}); + } else { + $status_msg = $prog . ' ran successfully in ' . +@@ -301,7 +303,6 @@ + if ($status_code) { + write_invocation_log($log_file, $log_date, $log_args); + unlink('db') if (-e 'db'); +- exit(1); + } + } + +diff -rNu a/scripts/update-plot-usage.pl.in b/scripts/update-plot-usage.pl.in +--- a/scripts/update-plot-usage.pl.in 2015-03-25 10:44:46.000000000 +1000 ++++ b/scripts/update-plot-usage.pl.in 2015-04-21 14:11:37.000000000 +1000 +@@ -82,12 +82,22 @@ + $date = sprintf "%4d", 1900+$year; + + # make the plot postscript files ++my @ok_pgms; ++my @ok_types; + for ($i=0; $i<=$#pgms; $i++) { +- make_plots($pgms[$i], $logs[$i], $types[$i], $date, $options); ++ if (make_plots($pgms[$i], $logs[$i], $types[$i], $date, $options)) { ++ #printf STDERR "Pushing %s.\n", $pgms[$i]; ++ push @ok_pgms, $pgms[$i]; ++ push @ok_types, $types[$i]; ++ } + } + + # make the final report +-make_report($rep_dir, @pgms, @types); ++if (@ok_pgms) { ++ make_report($rep_dir, @ok_pgms, @ok_types); ++} else { ++ printf STDERR "No programs had log files.\n" ++} + + # cleanup files + &cleanup($status); +@@ -121,6 +131,8 @@ + # + # make_plots + # ++# Returns TRUE on success. ++# + ################################################################################ + sub make_plots { + my($pgm, $log, $types, $date, $options) = @_; +@@ -163,9 +175,14 @@ + print STDERR "$pgm log files: @files\n"; + + # make the requested types of plots +- foreach $type (split(//, $types)) { +- #print STDERR "plot-usage -name $pgm -$type\n"; +- system("cat @files | plot-usage -name $pgm -$type $options"); ++ if (@files) { # make sure log files exist ++ foreach $type (split(//, $types)) { ++ #print STDERR "plot-usage -name $pgm -$type\n"; ++ system("cat @files | plot-usage -name $pgm -$type $options"); ++ } ++ return(1); ++ } else { ++ return(0); + } + + } # make_plots +diff -rNu a/src/Makefile.am b/src/Makefile.am +--- a/src/Makefile.am 2015-03-25 10:44:47.000000000 +1000 ++++ b/src/Makefile.am 2015-04-21 16:03:56.000000000 +1000 +@@ -160,7 +160,7 @@ + motif_regexp.c \ + motifs.c \ + motiph-scoring.c \ +- mtwist.h \ ++ mtwist.c \ + object-list.c \ + order.c \ + data-block.c \ +@@ -302,7 +302,7 @@ + glam2_output.c \ + glam2_recode3_20comp.c \ + glam2_site_sample.c \ +- glam2_util.c ++ glam2_util.c + + glam2scan_CFLAGS = $(AM_CFLAGS) + glam2scan_LDADD = libcommon.la +@@ -335,7 +335,7 @@ + glam2_glam2mask.c \ + glam2_alignment.c \ + glam2_fasta.c \ +- glam2_util.c ++ glam2_util.c + + gomo_CFLAGS = $(AM_CFLAGS) $(LIBXML2_CFLAGS) $(LIBXSLT_CFLAGS) $(OPENMP_CFLAGS) + gomo_LDADD = libcommon.la $(LIBXML2_LIBS) $(LIBXSLT_LIBS) +@@ -344,8 +344,7 @@ + gomo_highlight.c \ + merger.c \ + ranksum_test.c \ +- read_csv.c \ +- mtwist.c ++ read_csv.c + + gomo_highlight_CFLAGS = -DMAIN $(AM_CFLAGS) + gomo_highlight_LDADD = libcommon.la +@@ -576,6 +575,7 @@ + motifs.h \ + motiph-scoring.h \ + mp.h \ ++ mtwist.h \ + mtype.h \ + nrutil.h \ + object-list.h \ +diff -rNu a/src/Makefile.in b/src/Makefile.in +--- a/src/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/src/Makefile.in 2015-04-21 17:09:44.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +@@ -145,9 +145,9 @@ + libcommon_la-motif-in-meme-text.lo \ + libcommon_la-motif-in-meme-xml.lo libcommon_la-motif.lo \ + libcommon_la-motif_regexp.lo libcommon_la-motifs.lo \ +- libcommon_la-motiph-scoring.lo libcommon_la-object-list.lo \ +- libcommon_la-order.lo libcommon_la-data-block.lo \ +- libcommon_la-data-block-reader.lo \ ++ libcommon_la-motiph-scoring.lo libcommon_la-mtwist.lo \ ++ libcommon_la-object-list.lo libcommon_la-order.lo \ ++ libcommon_la-data-block.lo libcommon_la-data-block-reader.lo \ + libcommon_la-prior-reader-from-psp.lo \ + libcommon_la-prior-reader-from-wig.lo \ + libcommon_la-prior-dist.lo libcommon_la-pssm.lo \ +@@ -381,7 +381,7 @@ + $(CFLAGS) $(AM_LDFLAGS) $(LDFLAGS) -o $@ + am_gomo_OBJECTS = gomo-gomo.$(OBJEXT) gomo-gomo_highlight.$(OBJEXT) \ + gomo-merger.$(OBJEXT) gomo-ranksum_test.$(OBJEXT) \ +- gomo-read_csv.$(OBJEXT) gomo-mtwist.$(OBJEXT) ++ gomo-read_csv.$(OBJEXT) + gomo_OBJECTS = $(am_gomo_OBJECTS) + gomo_DEPENDENCIES = libcommon.la $(am__DEPENDENCIES_1) \ + $(am__DEPENDENCIES_1) +@@ -987,7 +987,7 @@ + motif_regexp.c \ + motifs.c \ + motiph-scoring.c \ +- mtwist.h \ ++ mtwist.c \ + object-list.c \ + order.c \ + data-block.c \ +@@ -1113,7 +1113,7 @@ + glam2_output.c \ + glam2_recode3_20comp.c \ + glam2_site_sample.c \ +- glam2_util.c ++ glam2_util.c + + glam2scan_CFLAGS = $(AM_CFLAGS) + glam2scan_LDADD = libcommon.la +@@ -1146,7 +1146,7 @@ + glam2_glam2mask.c \ + glam2_alignment.c \ + glam2_fasta.c \ +- glam2_util.c ++ glam2_util.c + + gomo_CFLAGS = $(AM_CFLAGS) $(LIBXML2_CFLAGS) $(LIBXSLT_CFLAGS) $(OPENMP_CFLAGS) + gomo_LDADD = libcommon.la $(LIBXML2_LIBS) $(LIBXSLT_LIBS) +@@ -1155,8 +1155,7 @@ + gomo_highlight.c \ + merger.c \ + ranksum_test.c \ +- read_csv.c \ +- mtwist.c ++ read_csv.c + + gomo_highlight_CFLAGS = -DMAIN $(AM_CFLAGS) + gomo_highlight_LDADD = libcommon.la +@@ -1364,6 +1363,7 @@ + motifs.h \ + motiph-scoring.h \ + mp.h \ ++ mtwist.h \ + mtype.h \ + nrutil.h \ + object-list.h \ +@@ -1798,7 +1798,6 @@ + @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/gomo-gomo.Po@am__quote@ + @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/gomo-gomo_highlight.Po@am__quote@ + @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/gomo-merger.Po@am__quote@ +-@AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/gomo-mtwist.Po@am__quote@ + @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/gomo-ranksum_test.Po@am__quote@ + @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/gomo-read_csv.Po@am__quote@ + @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/gomo_highlight-gomo_highlight.Po@am__quote@ +@@ -1857,6 +1856,7 @@ + @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/libcommon_la-motif_regexp.Plo@am__quote@ + @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/libcommon_la-motifs.Plo@am__quote@ + @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/libcommon_la-motiph-scoring.Plo@am__quote@ ++@AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/libcommon_la-mtwist.Plo@am__quote@ + @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/libcommon_la-object-list.Plo@am__quote@ + @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/libcommon_la-order.Plo@am__quote@ + @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/libcommon_la-prior-dist.Plo@am__quote@ +@@ -2322,6 +2322,13 @@ + @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ + @am__fastdepCC_FALSE@ $(AM_V_CC@am__nodep@)$(LIBTOOL) $(AM_V_lt) --tag=CC $(AM_LIBTOOLFLAGS) $(LIBTOOLFLAGS) --mode=compile $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) $(CPPFLAGS) $(libcommon_la_CFLAGS) $(CFLAGS) -c -o libcommon_la-motiph-scoring.lo `test -f 'motiph-scoring.c' || echo '$(srcdir)/'`motiph-scoring.c + ++libcommon_la-mtwist.lo: mtwist.c ++@am__fastdepCC_TRUE@ $(AM_V_CC)$(LIBTOOL) $(AM_V_lt) --tag=CC $(AM_LIBTOOLFLAGS) $(LIBTOOLFLAGS) --mode=compile $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) $(CPPFLAGS) $(libcommon_la_CFLAGS) $(CFLAGS) -MT libcommon_la-mtwist.lo -MD -MP -MF $(DEPDIR)/libcommon_la-mtwist.Tpo -c -o libcommon_la-mtwist.lo `test -f 'mtwist.c' || echo '$(srcdir)/'`mtwist.c ++@am__fastdepCC_TRUE@ $(AM_V_at)$(am__mv) $(DEPDIR)/libcommon_la-mtwist.Tpo $(DEPDIR)/libcommon_la-mtwist.Plo ++@AMDEP_TRUE@@am__fastdepCC_FALSE@ $(AM_V_CC)source='mtwist.c' object='libcommon_la-mtwist.lo' libtool=yes @AMDEPBACKSLASH@ ++@AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ ++@am__fastdepCC_FALSE@ $(AM_V_CC@am__nodep@)$(LIBTOOL) $(AM_V_lt) --tag=CC $(AM_LIBTOOLFLAGS) $(LIBTOOLFLAGS) --mode=compile $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) $(CPPFLAGS) $(libcommon_la_CFLAGS) $(CFLAGS) -c -o libcommon_la-mtwist.lo `test -f 'mtwist.c' || echo '$(srcdir)/'`mtwist.c ++ + libcommon_la-object-list.lo: object-list.c + @am__fastdepCC_TRUE@ $(AM_V_CC)$(LIBTOOL) $(AM_V_lt) --tag=CC $(AM_LIBTOOLFLAGS) $(LIBTOOLFLAGS) --mode=compile $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) $(CPPFLAGS) $(libcommon_la_CFLAGS) $(CFLAGS) -MT libcommon_la-object-list.lo -MD -MP -MF $(DEPDIR)/libcommon_la-object-list.Tpo -c -o libcommon_la-object-list.lo `test -f 'object-list.c' || echo '$(srcdir)/'`object-list.c + @am__fastdepCC_TRUE@ $(AM_V_at)$(am__mv) $(DEPDIR)/libcommon_la-object-list.Tpo $(DEPDIR)/libcommon_la-object-list.Plo +@@ -3505,20 +3512,6 @@ + @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ + @am__fastdepCC_FALSE@ $(AM_V_CC@am__nodep@)$(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) $(CPPFLAGS) $(gomo_CFLAGS) $(CFLAGS) -c -o gomo-read_csv.obj `if test -f 'read_csv.c'; then $(CYGPATH_W) 'read_csv.c'; else $(CYGPATH_W) '$(srcdir)/read_csv.c'; fi` + +-gomo-mtwist.o: mtwist.c +-@am__fastdepCC_TRUE@ $(AM_V_CC)$(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) $(CPPFLAGS) $(gomo_CFLAGS) $(CFLAGS) -MT gomo-mtwist.o -MD -MP -MF $(DEPDIR)/gomo-mtwist.Tpo -c -o gomo-mtwist.o `test -f 'mtwist.c' || echo '$(srcdir)/'`mtwist.c +-@am__fastdepCC_TRUE@ $(AM_V_at)$(am__mv) $(DEPDIR)/gomo-mtwist.Tpo $(DEPDIR)/gomo-mtwist.Po +-@AMDEP_TRUE@@am__fastdepCC_FALSE@ $(AM_V_CC)source='mtwist.c' object='gomo-mtwist.o' libtool=no @AMDEPBACKSLASH@ +-@AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ +-@am__fastdepCC_FALSE@ $(AM_V_CC@am__nodep@)$(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) $(CPPFLAGS) $(gomo_CFLAGS) $(CFLAGS) -c -o gomo-mtwist.o `test -f 'mtwist.c' || echo '$(srcdir)/'`mtwist.c +- +-gomo-mtwist.obj: mtwist.c +-@am__fastdepCC_TRUE@ $(AM_V_CC)$(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) $(CPPFLAGS) $(gomo_CFLAGS) $(CFLAGS) -MT gomo-mtwist.obj -MD -MP -MF $(DEPDIR)/gomo-mtwist.Tpo -c -o gomo-mtwist.obj `if test -f 'mtwist.c'; then $(CYGPATH_W) 'mtwist.c'; else $(CYGPATH_W) '$(srcdir)/mtwist.c'; fi` +-@am__fastdepCC_TRUE@ $(AM_V_at)$(am__mv) $(DEPDIR)/gomo-mtwist.Tpo $(DEPDIR)/gomo-mtwist.Po +-@AMDEP_TRUE@@am__fastdepCC_FALSE@ $(AM_V_CC)source='mtwist.c' object='gomo-mtwist.obj' libtool=no @AMDEPBACKSLASH@ +-@AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ +-@am__fastdepCC_FALSE@ $(AM_V_CC@am__nodep@)$(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) $(CPPFLAGS) $(gomo_CFLAGS) $(CFLAGS) -c -o gomo-mtwist.obj `if test -f 'mtwist.c'; then $(CYGPATH_W) 'mtwist.c'; else $(CYGPATH_W) '$(srcdir)/mtwist.c'; fi` +- + gomo_highlight-gomo_highlight.o: gomo_highlight.c + @am__fastdepCC_TRUE@ $(AM_V_CC)$(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) $(CPPFLAGS) $(gomo_highlight_CFLAGS) $(CFLAGS) -MT gomo_highlight-gomo_highlight.o -MD -MP -MF $(DEPDIR)/gomo_highlight-gomo_highlight.Tpo -c -o gomo_highlight-gomo_highlight.o `test -f 'gomo_highlight.c' || echo '$(srcdir)/'`gomo_highlight.c + @am__fastdepCC_TRUE@ $(AM_V_at)$(am__mv) $(DEPDIR)/gomo_highlight-gomo_highlight.Tpo $(DEPDIR)/gomo_highlight-gomo_highlight.Po +diff -rNu a/src/ame.c b/src/ame.c +--- a/src/ame.c 2015-03-25 10:44:47.000000000 +1000 ++++ b/src/ame.c 2015-04-21 14:11:38.000000000 +1000 +@@ -638,10 +638,12 @@ + ARRAYLST_T* read_motifs; + MREAD_T *mread; + int num_motifs_before_rc = 0; ++ int num_motifs_after_rc = 0; + int i, j, before_count, db_size; + int *db_sizes; + char *bg_src; + ALPH_T alph; ++ BOOLEAN_T use_rc = FALSE; + + db_sizes = malloc(sizeof(int) * args.number_motif_files); + before_count = 0; +@@ -709,24 +711,35 @@ + + // reverse complement the originals adding to the original read in list + num_motifs_before_rc = arraylst_size(read_motifs); +- add_reverse_complements(read_motifs); ++ ++ // Add reverse complement motifs, interleaving with originals. ++ // Check if alphabet uses RCs: ++ use_rc = TRUE; // FIXME for alphabet handling ++ if (use_rc) { ++ add_reverse_complements(read_motifs); ++ motifs.revcomp = TRUE; ++ } + + //Allocate array for the motifs +- motif_list_to_array(read_motifs, &(motifs.motifs), &(motifs.num)); ++ motif_list_to_array(read_motifs, &(motifs.motifs), &(num_motifs_after_rc)); ++ motifs.num_b4_rc = num_motifs_before_rc; ++ + //free the list of motifs + free_motifs(read_motifs); + + // check reverse complements. +- assert(motifs.num / 2 == num_motifs_before_rc); ++ if (use_rc) { ++ assert(num_motifs_after_rc / 2 == num_motifs_before_rc); ++ } + + // Allocate a pssm, odds matrix and db index for each + // including reverse complements. +- motifs.pssms = malloc(sizeof(PSSM_T) * motifs.num); +- motifs.odds = malloc(sizeof(MATRIX_T*) * motifs.num); +- motifs.db_idx = malloc(sizeof(int) * motifs.num); +- memset(motifs.pssms, 0, sizeof(PSSM_T) * motifs.num); +- memset(motifs.odds, 0, sizeof(MATRIX_T*) * motifs.num); +- memset(motifs.db_idx, 0, sizeof(int) * motifs.num); ++ motifs.pssms = malloc(sizeof(PSSM_T) * num_motifs_after_rc); ++ motifs.odds = malloc(sizeof(MATRIX_T*) * num_motifs_after_rc); ++ motifs.db_idx = malloc(sizeof(int) * num_motifs_after_rc); ++ memset(motifs.pssms, 0, sizeof(PSSM_T) * num_motifs_after_rc); ++ memset(motifs.odds, 0, sizeof(MATRIX_T*) * num_motifs_after_rc); ++ memset(motifs.db_idx, 0, sizeof(int) * num_motifs_after_rc); + + //Allocate our pv_lookup space if required. + if (TOTAL_HITS == args.scoring) { +@@ -735,7 +748,7 @@ + + // We need to create odds matrices if we're doing AMA-type scoring + // Or, we create PSSMs and pv_lookup tables for the total-hits style instead. +- for (i = 0, j = 0, before_count = 0; i < motifs.num; i++) { ++ for (i = 0, j = 0, before_count = 0; i < num_motifs_after_rc; i++) { + // setup db index tracking + if ((i - before_count) >= db_sizes[j]) { + before_count += db_sizes[j]; +@@ -748,21 +761,22 @@ + PSSM_T *newpssm = build_motif_pssm(motif_at(motifs.motifs, i), + motifs.bg_freqs, motifs.bg_freqs, NULL, 1.0, range, gcbins, FALSE); + motifs.pssms[i] = *newpssm; +- if (i % 2 != 0) { ++ // If using reverse complements check that RC matrix has same number or rows ++ if (use_rc && (i % 2 != 0)) { + assert(get_num_rows(motifs.pssms[i].matrix) == get_num_rows(motifs.pssms[i-1].matrix)); + } + } else { + //convert_to_odds_matrix(motif_at(motifs.motifs, i), motifs.bg_freqs); + motifs.odds[i] = create_odds_matrix(motif_at(motifs.motifs, i), motifs.bg_freqs); +- if (i % 2 != 0) { ++ // If using reverse complements check that RC matrix has same number or rows ++ if (use_rc && (i % 2 != 0)) { + assert(get_num_rows(motifs.odds[i]) == get_num_rows(motifs.odds[i-1])); + } + } + } ++ + // cleanup + free(db_sizes); +- // reset motif count to before rev comp +- motifs.num = num_motifs_before_rc; + } + + void rsc_scan_sequences() { +@@ -785,10 +799,11 @@ + double scaled_pvalue_threshold = args.pvalue_threshold; + double avg_seq_length = 0; + ALPH_T alph; ++ BOOLEAN_T use_rc = motifs.revcomp; + + // get the alphabet from the global motifs + alph = INVALID_ALPH; +- if (motifs.num > 0) { ++ if (motifs.num_b4_rc > 0) { + alph = get_motif_alph(motif_at(motifs.motifs, 0)); + } + assert(alph != INVALID_ALPH); +@@ -812,8 +827,9 @@ + + // Get width of widest motif. + int max_width = 0; +- for (i=0;i max_width) max_width = w; + } + +@@ -854,7 +870,7 @@ + args.fix_partition = num_seqs; + int old_num_seqs = num_seqs; + read_many_fastas(alph, control_file, MAX_SEQ_LENGTH, &num_seqs, &seq_list); +- // Remove primary control that are shorter than the widest motif. ++ // Remove control sequences that are shorter than the widest motif. + for (i=j=old_num_seqs; i= max_width) { +@@ -862,7 +878,7 @@ + } else { + char *name = get_seq_name(seq_list[i]); + if (args.verbose >= NORMAL_VERBOSE) { +- fprintf(stderr, "Removing primary sequence %s since it is shorter (%d) than widest motif (%d)\n", ++ fprintf(stderr, "Removing control sequence %s since it is shorter (%d) than widest motif (%d)\n", + name, length, max_width); + } + } +@@ -874,7 +890,7 @@ + } + if (j != num_seqs) { + if (args.verbose >= NORMAL_VERBOSE) +- fprintf(stderr, "Warning: Removed %d control sequences that were shorter than the longest motif (%d)\n", ++ fprintf(stderr, "Warning: Removed %d control sequence(s) that were shorter than the longest motif (%d)\n", + num_seqs-j, max_width); + } + num_seqs = j; // too short sequences removed +@@ -905,8 +921,8 @@ + // Score all the sequences using all the arrays and store in Global results[motif][seq]. + + //Allocate the required space for results +- results = malloc(sizeof(double*) * motifs.num); +- for (i=0;i= HIGHER_VERBOSE) + fprintf(stderr, "\nScaling %s down by 1 / %.4g", +- get_motif_st_id(motif_at(motifs.motifs, motifi)), maxscore); ++ get_motif_st_id(motif_at(motifs.motifs, adj_motif_index)), maxscore); + } // linreg normalize + } // not totalhits + } // motif +@@ -982,7 +999,7 @@ + double max_sequence_score = -1e300; + double max_median_sequence_score = -1e300; + double *all_scores = malloc(sizeof(double) * num_seqs); +- for (i=0;i max_sequence_score) max_sequence_score = results[i][j]; +@@ -1014,10 +1031,10 @@ + + seq_num = get_num_strings(seq_ids); //number of sequences + //allocate space for final one result per motif array. +- rsr = malloc(sizeof(rsc_result_t*)*motifs.num); ++ rsr = malloc(sizeof(rsc_result_t*)*motifs.num_b4_rc); + +- for(i=0;ipwm_score = results[i][j]; + if (results[i][j] > highest_score) +- highest_score = results[i][j]; //keep track of the pwm high score. ++ highest_score = results[i][j]; //keep track of the PWM high score. + rankings[j]->f_score = get_array_item(j, seq_fscores); //we don't use this yet +- rankings[j]->f_rank = j+1; ++ rankings[j]->f_rank = j+1; // Ranks according to input order. + } + + //Try shuffling here. +- //ame_shuffle((void**)rankings, seq_num); ++ // This seems to be to handle the case of tied scores ++ // which are ordered arbitrarily by the call to qsort. ++ // Ideally ties should be handled correctly in, for example, ++ // the ranksum test. + SHUFFLE(rankings, seq_num); + +- //Sort it ++ //Sort it (ties are handled arbitrarily. + qsort (rankings, seq_num, sizeof(rsc_rank_t*), rsc_compare_ranks_pwm_score); + + //Assign pwm ranks + for (j=0; j < seq_num; j++) { +- rankings[j]->pwm_rank = j+1; ++ rankings[j]->pwm_rank = j+1; // Ranks when sorted by PWM. + } + + //Positive FL is the default. +- if (POS_PWM != args.positive_list) { +- //resort via FASTA score rank ++ if (POS_FL == args.positive_list) { ++ //resort via FASTA score rank; actually rank is just original order of sequences. + qsort (rankings, seq_num, sizeof(rsc_rank_t*), rsc_compare_ranks_f_rank); + } + +@@ -1087,9 +1107,9 @@ + } + + if (LINREG_METHOD == args.pvalue_method) { +- qsort(rsr, motifs.num, sizeof(rsc_result_t*), rsc_compare_mse); ++ qsort(rsr, motifs.num_b4_rc, sizeof(rsc_result_t*), rsc_compare_mse); + } else { +- qsort(rsr, motifs.num, sizeof(rsc_result_t*), rsc_compare_scores); ++ qsort(rsr, motifs.num_b4_rc, sizeof(rsc_result_t*), rsc_compare_scores); + } + + if (LINREG_METHOD != args.pvalue_method && SPEARMAN_METHOD != args.pvalue_method) { +@@ -1097,20 +1117,20 @@ + if (args.fix_partition <= 0) thresh = seq_num; + rsc_print_results("Motif p-values are corrected by #Motifs * " + "#ThresholdsTested - (%i * %i = %i)\n\n", +- motifs.num, thresh, motifs.num * thresh); ++ motifs.num_b4_rc, thresh, motifs.num_b4_rc * thresh); + } + jsonwr_property(args.json_output, "motifs"); + jsonwr_start_array_value(args.json_output); +- for (i = 0; i < motifs.num; ++i) { ++ for (i = 0; i < motifs.num_b4_rc; ++i) { + double number_of_tests; + double corrected_p_val = 0; + + result = rsr[i]; + + if (args.fix_partition > 0) { +- number_of_tests = motifs.num * 1; ++ number_of_tests = motifs.num_b4_rc * 1; + } else { +- number_of_tests = motifs.num * seq_num; ++ number_of_tests = motifs.num_b4_rc * seq_num; + } + + if (RANKSUM_METHOD == args.pvalue_method) { +@@ -1171,6 +1191,9 @@ + int seq_num; + int j; + ++ //Adjust motif_index for possible reverse complements. ++ int adj_motif_index = motifs.revcomp ? motif_index*2 : motif_index; ++ + //Vars for the test + double* x; + double* y; +@@ -1211,11 +1234,11 @@ + + if (args.verbose >= HIGH_VERBOSE) { + rsc_print_results("Spearman MSE of motif %s top %i seqs: %.4g\n", +- get_motif_st_id(motif_at(motifs.motifs, motif_index*2)), seq_num, ++ get_motif_st_id(motif_at(motifs.motifs, adj_motif_index)), seq_num, + rank_score); + } + +- init_result (lowest_motif_result, motifs.db_idx[motif_index*2], motif_at(motifs.motifs, motif_index*2), ++ init_result (lowest_motif_result, motifs.db_idx[adj_motif_index], motif_at(motifs.motifs, adj_motif_index), + seq_num, + rank_score, rank_score, //Not really p-values, but they'll do... + rank_score, -1); +@@ -1233,6 +1256,9 @@ + int seq_num; + int j; + ++ //Adjust motif_index for possible reverse complements. ++ int adj_motif_index = motifs.revcomp ? motif_index*2 : motif_index; ++ + //Vars for the regression + double* x; + double* y; +@@ -1277,7 +1303,7 @@ + char* filename; + filename = malloc(sizeof(char)*(strlen(args.linreg_dump_dir) + 50)); + sprintf(filename, "%s/%s.tsv", args.linreg_dump_dir, +- get_motif_st_id(motif_at(motifs.motifs, motif_index*2))); ++ get_motif_st_id(motif_at(motifs.motifs, adj_motif_index))); + + fh = fopen(filename, "w"); + fputs("X\tY\n", fh); +@@ -1313,13 +1339,13 @@ + + if (args.verbose >= HIGH_VERBOSE) { + rsc_print_results("LinReg MSE of motif %s top %i seqs: %.4g (m: %.4g b: %.4g)\n", +- get_motif_st_id(motif_at(motifs.motifs,motif_index*2)), j+1, mse, m, b); ++ get_motif_st_id(motif_at(motifs.motifs,adj_motif_index)), j+1, mse, m, b); + } + + //Add to our motif list if lowest MSE + if (lowest_mse > mse) { + lowest_mse = mse; +- init_result (lowest_motif_result, motifs.db_idx[motif_index*2], motif_at(motifs.motifs,motif_index*2), j+1, ++ init_result (lowest_motif_result, motifs.db_idx[adj_motif_index], motif_at(motifs.motifs,adj_motif_index), j+1, + m, b, //Not really p-values, but they'll do... + mse, -1); + } +@@ -1332,7 +1358,7 @@ + /* + * Using the Ranksum test, + * +- * this method returns the lowest scoring subdivision of a set of sequences for a given motif. ++ * This method returns the lowest scoring subdivision of a set of sequences for a given motif. + * It's not self-contained, as it requires to hook into the global variables results, motifs, seq_ids. + */ + rsc_result_t* rsc_do_ranksum_test(rsc_rank_t** rankings, int motif_index) { +@@ -1344,6 +1370,9 @@ + RSR_T* r; + rsc_result_t* lowest_motif_result; + ++ //Adjust motif_index for possible reverse complements. ++ int adj_motif_index = motifs.revcomp ? motif_index*2 : motif_index; ++ + seq_num = get_num_strings(seq_ids); //number of sequences + n = seq_num; + na = ta_obs = 0; +@@ -1351,23 +1380,26 @@ + lowest_motif_result = malloc(sizeof(rsc_result_t)); //allocate space, as a ptr to this will go in the array later + //that's why we don't free it in this loop. + ++ // By default "rankings" is sorted in the original order of the sequences. ++ // The top of the rankings list are considered "positives". + for (j=0; j < seq_num - 1; j++) { + /* We now are not going to compare about ties for right now - instead we'll just + * count them up. + * We need to keep track of: +- * int n, number of samples +- int na, number of positives +- double ta_obs sum of ranks of positives ++ * int n, number of samples ++ int na, number of positives ++ double ta_obs sum of ranks of positives + */ + na++; + if (POS_PWM == args.positive_list) { + ta_obs += rankings[j]->f_rank; //We consider FASTA score to tell us what's positive + } else { +- ta_obs += rankings[j]->pwm_rank; //We consider the pwm to tell us what's positive ++ ta_obs += rankings[j]->pwm_rank; //We consider the PWM to tell us what's positive + } + + // Compute p-value if at allowed partition point +- if (args.fix_partition <= 0 || j == args.fix_partition) { ++ // Fixed bug: was stopping at j==args.fix_partition. ++ if (args.fix_partition <= 0 || j == args.fix_partition-1) { + if (QUICK_RS == args.rs_method) { + //This thing is working backwards. + // Should be: r = ranksum_from_stats(n, na, ta_obs); +@@ -1376,20 +1408,20 @@ + } else { + // Beware 2d array pointer arithmetic. + // This needs to be fixed badly. +- r = ranksum_from_sets(results[motif_index*2] + (j+1), seq_num-(j+1), +- results[motif_index*2], j+1); ++ r = ranksum_from_sets(results[adj_motif_index] + (j+1), seq_num-(j+1), ++ results[adj_motif_index], j+1); + } + + if (args.verbose >= HIGH_VERBOSE) { + fprintf(stderr, "Ranksum p-values of motif %s top %i seqs " + "(left,right,twotailed): %g %g %g U-value: %.4g \n", +- get_motif_st_id(motif_at(motifs.motifs,motif_index*2)), j+1, ++ get_motif_st_id(motif_at(motifs.motifs,adj_motif_index)), j+1, + RSR_get_p_left(r), RSR_get_p_right(r), RSR_get_p_twotailed(r), RSR_get_u(r)); + } + //Add to our motif list +- if (lowest_pval > RSR_get_p_right(r)) { ++ if (lowest_pval >= RSR_get_p_right(r)) { + lowest_pval = RSR_get_p_right(r); +- init_result (lowest_motif_result, motifs.db_idx[motif_index*2], motif_at(motifs.motifs, motif_index*2), j+1, ++ init_result (lowest_motif_result, motifs.db_idx[adj_motif_index], motif_at(motifs.motifs, adj_motif_index), j+1, + RSR_get_p_left(r), RSR_get_p_right(r), RSR_get_p_twotailed(r), + RSR_get_u(r)); + } +@@ -1417,6 +1449,9 @@ + rsc_result_t* lowest_motif_result; + int tp,fn,fp,tn; + ++ //Adjust motif_index for possible reverse complements. ++ int adj_motif_index = motifs.revcomp ? motif_index*2 : motif_index; ++ + seq_num = get_num_strings(seq_ids); //number of sequences + lowest_pval = 100; //a large number. + lowest_motif_result = malloc(sizeof(rsc_result_t)); //allocate space, as a ptr to this will go in the array later +@@ -1461,11 +1496,11 @@ + + pright = exp(getLogFETPvalue(tp, tp+fn, fp, tn+fp, 0)); + lowest_pval = pright; +- init_result (lowest_motif_result, motifs.db_idx[motif_index*2], motif_at(motifs.motifs,motif_index*2), ++ init_result (lowest_motif_result, motifs.db_idx[adj_motif_index], motif_at(motifs.motifs,adj_motif_index), + i+1, lowest_pval, lowest_pval, lowest_pval, -1); + if (args.verbose >= HIGH_VERBOSE) { + fprintf(stderr, "M3: %s Threshold: %i tp: %i fn: %i tn: %i fp: %i P %g\n", +- get_motif_st_id(motif_at(motifs.motifs, motif_index*2)), ++ get_motif_st_id(motif_at(motifs.motifs, adj_motif_index)), + i, tp,fn,tn,fp, pright); + } + } else { +@@ -1504,18 +1539,18 @@ + pright = exp(getLogFETPvalue(tp, tp+fn, fp, tn+fp, 0)); + if (args.verbose >= HIGH_VERBOSE) { + fprintf(stderr, "Fisher's exact test p-value of motif %s top %i seqs (tp >= observed): %g\n", +- get_motif_st_id(motif_at(motifs.motifs, motif_index*2)), i+1, pright); ++ get_motif_st_id(motif_at(motifs.motifs, adj_motif_index)), i+1, pright); + } + + //Add to our motif list + if (lowest_pval >= pright) { + lowest_pval = pright; +- init_result (lowest_motif_result, motifs.db_idx[motif_index*2], motif_at(motifs.motifs,motif_index*2), ++ init_result (lowest_motif_result, motifs.db_idx[adj_motif_index], motif_at(motifs.motifs,adj_motif_index), + i+1, lowest_pval, lowest_pval, lowest_pval, -1); + } + if (args.verbose >= HIGHER_VERBOSE) { + fprintf(stderr, "M: %s Threshold: %i tp: %i fn: %i tn: %i fp: %i P %g\n", +- get_motif_st_id(motif_at(motifs.motifs, motif_index*2)), ++ get_motif_st_id(motif_at(motifs.motifs, adj_motif_index)), + i, tp,fn,tn,fp, pright); + } + } +@@ -1544,6 +1579,9 @@ + int n,N; + int i0,i1,i2,i3,B0,B1,B2,B3; + ++ //Adjust motif_index for possible reverse complements. ++ int adj_motif_index = motifs.revcomp ? motif_index*2 : motif_index; ++ + seq_num = get_num_strings(seq_ids); //number of sequences + lowest_pval = 100; //a large number. + lowest_motif_result = malloc(sizeof(rsc_result_t)); //allocate space, as a ptr to this will go in the array later +@@ -1686,11 +1724,11 @@ + //Add to our motif list + if (args.verbose >= HIGH_VERBOSE) { + fprintf(stderr, "Motif: %s Threshold: %i P-value: %g\n", +- get_motif_st_id(motif_at(motifs.motifs, motif_index*2)), i, exp(p)); ++ get_motif_st_id(motif_at(motifs.motifs, adj_motif_index)), i, exp(p)); + } + lowest_pval = p; +- init_result (lowest_motif_result, motifs.db_idx[motif_index*2], +- motif_at(motifs.motifs, motif_index*2), i+1, ++ init_result (lowest_motif_result, motifs.db_idx[adj_motif_index], ++ motif_at(motifs.motifs, adj_motif_index), i+1, + lowest_motif_result->pleft, // exp(p) + p, + lowest_motif_result->pboth, // exp(p) +@@ -1812,12 +1850,12 @@ + //Add to our motif list + if (args.verbose >= HIGH_VERBOSE) { + fprintf(stderr, "Motif: %s Threshold: %i P-value: %g\n", +- get_motif_st_id(motif_at(motifs.motifs, motif_index*2)), i, exp(p)); ++ get_motif_st_id(motif_at(motifs.motifs, adj_motif_index)), i, exp(p)); + } + if (lowest_pval >= p) { + lowest_pval = p; +- init_result (lowest_motif_result, motifs.db_idx[motif_index*2], +- motif_at(motifs.motifs, motif_index*2), ++ init_result (lowest_motif_result, motifs.db_idx[adj_motif_index], ++ motif_at(motifs.motifs, adj_motif_index), + i+1, + lowest_motif_result->pleft, // exp(p) + p, +diff -rNu a/src/ame.h b/src/ame.h +--- a/src/ame.h 2015-03-25 10:44:47.000000000 +1000 ++++ b/src/ame.h 2015-04-21 14:11:38.000000000 +1000 +@@ -88,12 +88,16 @@ + + typedef struct { + char* filename; +- MOTIF_T* motifs; ++ BOOLEAN_T revcomp; // reverse complements included. ++ MOTIF_T* motifs; // If revcomp==TRUE, every other ++ // index contains the RC copy of the ++ // preceding motif. + PSSM_T* pssms; + MATRIX_T** odds; + int* db_idx; + ARRAY_T** pv_lookup; +- int num; ++ int num_b4_rc; // Number of motifs (not counting ++ // reverse complements). + ARRAY_T* bg_freqs; + } rsc_motifs_t; + +@@ -109,9 +113,9 @@ + + typedef struct { + int f_rank; ++ double f_score; + int pwm_rank; + double pwm_score; +- double f_score; + } rsc_rank_t; + + +diff -rNu a/src/filters/Makefile.in b/src/filters/Makefile.in +--- a/src/filters/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/src/filters/Makefile.in 2015-04-21 17:09:44.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/src/filters/dust/Makefile.in b/src/filters/dust/Makefile.in +--- a/src/filters/dust/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/src/filters/dust/Makefile.in 2015-04-21 17:09:44.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/src/filters/purge/Makefile.in b/src/filters/purge/Makefile.in +--- a/src/filters/purge/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/src/filters/purge/Makefile.in 2015-04-21 17:09:44.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/src/glam2_init.c b/src/glam2_init.c +--- a/src/glam2_init.c 2015-03-25 10:44:41.000000000 +1000 ++++ b/src/glam2_init.c 2015-04-21 14:11:38.000000000 +1000 +@@ -2,6 +2,7 @@ + #include + #include /* srand */ + #include /* strcmp */ ++#include "mtwist.h" // must come before glam2_util.h + #include "glam2_util.h" + #include "glam2_recode3_20comp.h" + #include "glam2_dna_prior.h" +@@ -161,7 +162,8 @@ + } + + void init(data *d) { +- srand(d->a.seed); ++ //srand(d->a.seed); ++ mt_seed32(d->a.seed); + init_alph(&d->alph, d->a.alph_name); + init_seqs(&d->seqs, d); + #if 0 +diff -rNu a/src/glam2_output.c b/src/glam2_output.c +--- a/src/glam2_output.c 2015-03-25 10:44:41.000000000 +1000 ++++ b/src/glam2_output.c 2015-04-21 14:11:38.000000000 +1000 +@@ -172,10 +172,13 @@ + // convert counts to frequencies + motif.freqs = allocate_matrix(width, asize); + for (i = 0; i < width; ++i) { ++ double match_count = (double) aln->cols[i].match_count; ++ double uniform = 1.0/asize; + for (j = 0; j < asize; ++j) { + set_matrix_cell(i, j, + // should give a different "n" for each row when making logo +- aln->cols[i].emission_counts[j]/((double) aln->cols[i].match_count), ++ //aln->cols[i].emission_counts[j]/((double) aln->cols[i].match_count), ++ (match_count != 0 ? aln->cols[i].emission_counts[j]/match_count : uniform), + motif.freqs + ); + } +diff -rNu a/src/glam2_util.c b/src/glam2_util.c +--- a/src/glam2_util.c 2015-03-25 10:44:41.000000000 +1000 ++++ b/src/glam2_util.c 2015-04-21 14:11:38.000000000 +1000 +@@ -6,6 +6,8 @@ + #include + #include + #include ++#include "mtwist.h" // Must come before glam2_util.h or duplicate ++ // symbol error at link time. + #include "glam2_util.h" + + const char *prog_name = ""; +@@ -224,17 +226,6 @@ + } + } + +-double rand_dbl(const double n) { +- double r; +- assert(n == n); /* check for NaN */ +- assert(n > 0); +- assert(n <= DBL_MAX); /* check for inf */ +- do { +- r = rand() / (RAND_MAX + 1.0) * n; /* from C FAQ */ +- } while (r >= n); /* r can equal n when n is tiny (e.g. < DBL_MIN) */ +- return r; +-} +- + double *pick_dbl(const double *ptr, const size_t size) { + const double tot = sum_dbl(ptr, size); + const double r = rand_dbl(tot); +diff -rNu a/src/glam2_util.h b/src/glam2_util.h +--- a/src/glam2_util.h 2015-03-25 10:44:41.000000000 +1000 ++++ b/src/glam2_util.h 2015-04-21 14:11:38.000000000 +1000 +@@ -93,14 +93,6 @@ + /* Get the sum of a set of doubles, working in log space. size must be >0 */ + double log_sum(const double *ptr, const size_t size); + +-/* Random integer between 0 (inclusive) and n (exclusive) */ +-/* n must be > 0 and <= RAND_MAX+1 */ +-int rand_int(const unsigned n); +- +-/* Random double between 0 (inclusive) and n (exclusive) */ +-/* n must be > 0 */ +-double rand_dbl(const double n); +- + /* Randomly pick a member of a set of doubles, weighted by their values */ + double *pick_dbl(const double *ptr, const size_t size); + +diff -rNu a/src/libexslt/Makefile.in b/src/libexslt/Makefile.in +--- a/src/libexslt/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/src/libexslt/Makefile.in 2015-04-21 17:09:44.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/src/libxml2/Makefile.in b/src/libxml2/Makefile.in +--- a/src/libxml2/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/src/libxml2/Makefile.in 2015-04-21 17:09:44.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/src/libxml2/include/Makefile.in b/src/libxml2/include/Makefile.in +--- a/src/libxml2/include/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/src/libxml2/include/Makefile.in 2015-04-21 17:09:44.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/src/libxml2/include/libxml/Makefile.in b/src/libxml2/include/libxml/Makefile.in +--- a/src/libxml2/include/libxml/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/src/libxml2/include/libxml/Makefile.in 2015-04-21 17:09:44.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/src/libxslt/Makefile.in b/src/libxslt/Makefile.in +--- a/src/libxslt/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/src/libxslt/Makefile.in 2015-04-21 17:09:44.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/src/parallel/Makefile.in b/src/parallel/Makefile.in +--- a/src/parallel/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/src/parallel/Makefile.in 2015-04-21 17:09:44.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/src/utils.c b/src/utils.c +--- a/src/utils.c 2015-03-25 10:44:42.000000000 +1000 ++++ b/src/utils.c 2015-04-21 14:11:38.000000000 +1000 +@@ -22,6 +22,7 @@ + #include + #include + #include "dir.h" ++#include "mtwist.h" // must come before utils.h + #include "utils.h" + + +@@ -1364,19 +1365,23 @@ + return desc; + } + +-/******************************************************************************** +-Generate random integer in range 0..n-1 +-********************************************************************************/ ++/* Random integer between 0 (inclusive) and n (exclusive) */ ++/* n must be > 0 and <= RAND_MAX+1 */ + int rand_int(const unsigned n) { /* from C FAQ */ +- unsigned d, threshold, r; + assert(n > 0); + assert(n <= RAND_MAX + 1u); +- d = (RAND_MAX + 1u) / n; +- threshold = d * n; +- do { +- r = rand(); +- } while(r >= threshold); +- return r / d; ++ unsigned r = mt_ldrand() * n; ++ return r; ++} ++ ++/* Random double between 0 (inclusive) and n (exclusive) */ ++/* n must be > 0 */ ++double rand_dbl(const double n) { ++ assert(n == n); /* check for NaN */ ++ assert(n > 0); ++ assert(n <= DBL_MAX); /* check for inf */ ++ double r = mt_ldrand() * n; ++ return r; + } + + /******************************************************************************** +diff -rNu a/src/utils.h b/src/utils.h +--- a/src/utils.h 2015-03-25 10:44:42.000000000 +1000 ++++ b/src/utils.h 2015-04-21 14:11:38.000000000 +1000 +@@ -13,6 +13,7 @@ + #include + #include + #include ++#include + #include "macros.h" + + #define FALSE false +@@ -549,5 +550,14 @@ + ******************************************************************/ + void shuffle(void *base, size_t n, size_t size); + ++/* Random integer between 0 (inclusive) and n (exclusive) */ ++/* n must be > 0 and <= RAND_MAX+1 */ ++int rand_int(const unsigned n); ++ ++/* Random double between 0 (inclusive) and n (exclusive) */ ++/* n must be > 0 */ ++double rand_dbl(const double n); ++ ++ + #endif + +diff -rNu a/src/wiggle/Makefile.in b/src/wiggle/Makefile.in +--- a/src/wiggle/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/src/wiggle/Makefile.in 2015-04-21 17:09:45.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/Makefile.in b/tests/Makefile.in +--- a/tests/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/tests/Makefile.in 2015-04-21 17:09:45.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/ame/Makefile.in b/tests/ame/Makefile.in +--- a/tests/ame/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/tests/ame/Makefile.in 2015-04-21 17:09:45.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/centrimo/Makefile.in b/tests/centrimo/Makefile.in +--- a/tests/centrimo/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/tests/centrimo/Makefile.in 2015-04-21 17:09:45.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/clustalw2fasta/Makefile.in b/tests/clustalw2fasta/Makefile.in +--- a/tests/clustalw2fasta/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/tests/clustalw2fasta/Makefile.in 2015-04-21 17:09:45.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/common/Makefile.in b/tests/common/Makefile.in +--- a/tests/common/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/tests/common/Makefile.in 2015-04-21 17:09:45.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/create-priors/Makefile.in b/tests/create-priors/Makefile.in +--- a/tests/create-priors/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/tests/create-priors/Makefile.in 2015-04-21 17:09:45.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/draw-mhmm/Makefile.in b/tests/draw-mhmm/Makefile.in +--- a/tests/draw-mhmm/Makefile.in 2015-03-25 11:42:45.000000000 +1000 ++++ b/tests/draw-mhmm/Makefile.in 2015-04-21 17:09:45.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/dreme/Makefile.in b/tests/dreme/Makefile.in +--- a/tests/dreme/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/dreme/Makefile.in 2015-04-21 17:09:45.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/fasta-center/Makefile.in b/tests/fasta-center/Makefile.in +--- a/tests/fasta-center/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/fasta-center/Makefile.in 2015-04-21 17:09:45.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/fimo/Makefile.in b/tests/fimo/Makefile.in +--- a/tests/fimo/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/fimo/Makefile.in 2015-04-21 17:09:45.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/glam2/Makefile.in b/tests/glam2/Makefile.in +--- a/tests/glam2/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/glam2/Makefile.in 2015-04-21 17:09:45.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/glam2/glam2.txt b/tests/glam2/glam2.txt +--- a/tests/glam2/glam2.txt 2015-03-25 10:44:45.000000000 +1000 ++++ b/tests/glam2/glam2.txt 2015-04-21 14:11:38.000000000 +1000 +@@ -1,47 +1,43 @@ + GLAM2: Gapped Local Alignment of Motifs + Version 1056 + +-/home/james/dist/src/glam2 -M -r 2 -n 100 -O results/glam2_1 p ../doc/examples/At.fa ++/Users/t.bailey/meme_hg/meme/src/glam2 -M -r 3 -n 100 -O results/glam2_1 p At.s + Sequences: 19 + Greatest sequence length: 1112 + Residue counts: A=538 C=175 D=553 E=721 F=419 G=664 H=244 I=516 K=663 L=1000 M=235 N=484 P=466 Q=340 R=623 S=922 T=503 V=633 W=108 Y=326 x=0 + +-Score: 637.039 Columns: 32 Sequences: 19 ++Score: 675.899 Columns: 29 Sequences: 19 + +- ***......*..**************************** +-At1g01140.1_ 194 .KG......YD.GAAADVWSCG.VILFVLMAGYLPFDEPN 224 + 62.8 +-At1g01140.2_ 194 .KG......YD.GAAADVWSCG.VILFVLMAGYLPFDEPN 224 + 62.8 +-At1g01140.3_ 194 .KG......YD.GAAADVWSCG.VILFVLMAGYLPFDEPN 224 + 62.8 +-At1g01450.1_ 214 .SGTAGSLKY..SDKSDVYSFG.MVSFELLTGKVPFEDSH 249 + 42.0 +-At1g01540.1_ 329 CTGM.....L..NEKSDIYSFG.ILIMEIITGRNPVDYSR 360 + 59.2 +-At1g01540.2_ 329 CTGM.....L..NEKSDIYSFG.ILIMEIITGRNPVDYSR 360 + 59.2 +-At1g01560.1_ 215 CSE......Y..TAAIDIWSVG.CILGEIMTREPLFPGRD 245 + 53.1 +-At1g01740.1_ 223 .TG......RI.TAESVIYSFG.TLLLDLLTGKH.IPPSH 252 + 24.0 +-At1g02970.1_ 416 .NED.....YEHLDKVDIFSLG.VTVYELIKGSP.LTESR 447 + 27.6 +-At1g03740.1_ 388 ASH......Y..GVGVDLWSTG.CILGELYAGKPILPGKT 418 + 33.0 +-At1g03920.1_ 350 .KG......Y..GMECDWWSLG.AIMYEMLVGYPPFYADD 379 + 36.1 +-At1g03930.1_ 184 .THLGVE..Q..SRRDDLEALG.YVLMYFLKGSLPWQGLK 217 + 34.9 +-At1g04210.1_ 993 AMHEQNF..Y..GLEVDIWSFG.CLIFELLTLQNPYFDLS 1027 + 39.2 +-At1g04440.1_ 184 .THLGIE..Q..SRRDDLESLG.YLLMYFLRGSLPWQGLR 217 + 36.9 +-At1g04700.1_ 946 .NGSSN...RV.SEKVDVFSFG.IVMWEILTGEEPYANLH 979 + 39.5 +-At1g05100.1_ 176 ARGER....Q..GKESDIWAVG.CTVIEMVTGSQPWIGAD 208 + 35.6 +-At1g05700.1_ 736 .NG......L..NEKSDIYSFG.VVLLEMITGKTVIKESQ 765 + 44.5 +-At1g06390.1_ 245 ATE......Y..TASIDIWSAG.CVLAELLLGQPLFPGEN 275 + 61.0 +-At1g06390.2_ 245 ATE......Y..TASIDIWSAG.CVLAELLLGQPLFPGEN 275 + 61.0 +- +- ATG Y GAKSDIWSFG CILFELLTGKPPFDGSN +- CKE SEAV VY L VV M IIA SL PELR +- H T E L M Y ++ ***************************** ++At1g01140.1_ 196 YDGAAADVWSCGVILFVLMAGYLPFDEPN 224 + 60.0 ++At1g01140.2_ 196 YDGAAADVWSCGVILFVLMAGYLPFDEPN 224 + 60.0 ++At1g01140.3_ 196 YDGAAADVWSCGVILFVLMAGYLPFDEPN 224 + 60.0 ++At1g01450.1_ 221 KYSDKSDVYSFGMVSFELLTGKVPFEDSH 249 + 43.1 ++At1g01540.1_ 332 MLNEKSDIYSFGILIMEIITGRNPVDYSR 360 + 57.3 ++At1g01540.2_ 332 MLNEKSDIYSFGILIMEIITGRNPVDYSR 360 + 57.3 ++At1g01560.1_ 217 EYTAAIDIWSVGCILGEIMTRE.PLFPGR 244 + 52.5 ++At1g01740.1_ 225 RITAESVIYSFGTLLLDLLTGK.HIPPSH 252 + 24.0 ++At1g02970.1_ 420 EHLDKVDIFSLGVTVYELIKGS.PLTESR 447 + 36.6 ++At1g03740.1_ 390 HYGVGVDLWSTGCILGELYAGK.PILPGK 417 + 33.4 ++At1g03920.1_ 351 GYGMECDWWSLGAIMYEMLVGY.PPFYAD 378 + 29.8 ++At1g03930.1_ 189 EQSRRDDLEALGYVLMYFLKGSLPWQGLK 217 + 37.8 ++At1g04210.1_ 999 FYGLEVDIWSFGCLIFELLTLQNPYFDLS 1027 + 45.3 ++At1g04440.1_ 189 EQSRRDDLESLGYLLMYFLRGSLPWQGLR 217 + 38.9 ++At1g04700.1_ 951 RVSEKVDVFSFGIVMWEILTGEEPYANLH 979 + 42.5 ++At1g05100.1_ 180 RQGKESDIWAVGCTVIEMVTGSQPWIGAD 208 + 40.0 ++At1g05700.1_ 737 GLNEKSDIYSFGVVLLEMITGKTVIKESQ 765 + 43.4 ++At1g06390.1_ 247 EYTASIDIWSAGCVLAELLLGQ.PLFPGE 274 + 55.7 ++At1g06390.2_ 247 EYTASIDIWSAGCVLAELLLGQ.PLFPGE 274 + 55.7 ++ ++ EYGAKSDIWSFGCILFELLTGKLPFDESR ++ SEAV VY L VV M IIA SN LFPG ++ T E L M Y L + + A C D E F G H I K L M N P Q R S T V W Y Del Ins Score +- 5 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11 -8.02 ++ 0 0 0 6 1 2 1 0 1 0 2 0 0 0 3 0 0 0 0 3 0 5.92 + 0 -0.102 +- 0 0 0 0 0 0 0 0 4 0 1 3 0 0 1 3 7 0 0 0 0 14.6 ++ 0 0 3 0 0 0 1 1 0 3 0 0 0 3 0 0 0 1 0 7 0 13.8 + 0 -0.102 +- 0 0 0 4 0 11 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 34.9 +- 26 -51.5 +- 0 0 0 0 0 0 0 0 0 3 0 0 0 3 2 0 0 0 0 11 0 34.6 +- 7 -27.8 + 0 0 0 0 0 7 0 0 0 1 0 3 0 0 0 4 4 0 0 0 0 14.8 + 0 -0.102 + 7 0 2 4 0 0 0 0 1 1 1 0 0 0 2 0 0 1 0 0 0 6.36 +@@ -62,8 +58,6 @@ + 0 -0.102 + 0 0 0 0 0 19 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 64.0 + 0 -0.102 +- 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 19 -11.8 +- 0 -0.102 + 1 6 0 0 0 0 0 3 0 0 1 0 0 0 0 0 1 5 0 2 0 22.1 + 0 -0.102 + 0 0 0 0 0 0 0 6 0 5 0 0 0 0 0 0 2 6 0 0 0 26.6 +@@ -84,93 +78,173 @@ + 0 -0.102 + 0 0 0 2 0 0 0 0 4 0 0 0 0 3 2 4 0 0 0 4 0 12.6 + 0 -0.102 +- 0 0 0 1 0 0 1 0 0 5 0 3 6 1 0 0 1 1 0 0 0 5.25 ++ 0 0 0 1 0 0 0 0 0 5 0 3 0 1 0 0 1 1 0 0 7 -19.9 + 0 -0.102 +- 0 0 0 0 0 0 0 1 0 3 0 0 12 0 0 0 0 1 0 0 2 19.9 ++ 0 0 0 0 0 0 1 0 0 0 0 0 17 0 0 0 0 1 0 0 0 55.5 + 0 -0.102 +- 0 0 0 0 8 0 0 2 0 2 0 0 0 0 0 0 0 2 3 2 0 29.2 ++ 0 0 0 0 4 0 0 3 0 4 0 0 1 0 0 0 0 2 3 2 0 14.6 + 0 -0.102 +- 1 0 5 1 1 0 0 1 1 0 0 0 5 2 0 0 1 0 0 1 0 0.967 ++ 1 0 5 1 5 0 0 1 1 1 0 0 1 2 0 0 1 0 0 0 0 2.44 + 0 -0.102 +- 1 0 2 5 0 7 0 0 0 0 0 1 1 0 0 0 0 0 0 2 0 11.2 +- 0 -0.102 +- 1 0 1 2 0 0 0 0 1 4 0 0 3 0 1 6 0 0 0 0 0 3.02 +- 0 -0.102 +- 0 0 3 0 0 0 3 0 1 0 0 5 0 1 4 1 1 0 0 0 0 14.3 +- +-Score: 482.929 Columns: 24 Sequences: 19 +- +- ************************ +-At1g01140.1_ 238 SCPP.WFSQGAKRVIKRILEPNPI 260 + 37.2 +-At1g01140.2_ 240 SCPP.WFSQGAKRVIKRILEPNPI 262 + 37.2 +-At1g01140.3_ 238 SCPP.WFSQGAKRVIKRILEPNPI 260 + 37.2 +-At1g01450.1_ 225 KSD..VYSFGMVSF.ELLTGKVPF 245 + 31.9 +-At1g01540.1_ 336 KSD..IYSFGILIM.EIITGRNPV 356 + 46.7 +-At1g01540.2_ 336 KSD..IYSFGILIM.EIITGRNPV 356 + 46.7 +-At1g01560.1_ 221 AID..IWSVGCILG.EIMTREPLF 241 + 30.2 +-At1g01740.1_ 229 ESV..IYSFGTLLL.DLLTGKHIP 249 + 19.2 +-At1g02970.1_ 424 KVD..IFSLGVTVY.ELIKGSPLT 444 + 32.0 +-At1g03740.1_ 394 GVD..LWSTGCILG.ELYAGKPIL 414 + 22.3 +-At1g03920.1_ 355 ECD..WWSLGAIMY.EMLVGYPPF 375 + 39.3 +-At1g03930.1_ 194 D.D..LEALGYVLM.YFLKGSLPW 213 + 23.4 +-At1g04210.1_ 1003 EVD..IWSFGCLIF.ELLTLQNPY 1023 + 40.3 +-At1g04440.1_ 194 D.D..LESLGYLLM.YFLRGSLPW 213 + 23.4 +-At1g04700.1_ 955 KVD..VFSFGIVMW.EILTGEEPY 975 + 38.3 +-At1g05100.1_ 184 ESD..IWAVGCTVI.EMVTGSQPW 204 + 34.9 +-At1g05700.1_ 741 KSD..IYSFGVVLL.EMITGKTVI 761 + 38.5 +-At1g06390.1_ 251 SID..IWSAGCVLA.ELLLGQPLF 271 + 44.4 +-At1g06390.2_ 251 SID..IWSAGCVLA.ELLLGQPLF 271 + 44.4 +- +- KSDP IWSFGCVLMIELLTGKNPF +- SC WF L AL IIL SPLI +- EV Y ++ 0 0 2 5 0 3 0 0 0 0 0 1 5 0 0 0 0 0 0 3 0 12.7 ++ 0 -0.102 ++ 2 0 0 0 0 4 0 0 0 4 0 0 3 0 0 6 0 0 0 0 0 10.1 ++ 0 -0.102 ++ 0 0 2 2 0 0 3 0 2 0 0 3 0 1 5 1 0 0 0 0 0 12.3 ++ ++Score: 313.467 Columns: 30 Sequences: 15 ++ ++ ***.***..***********.************* ++At1g01140.1_ 11 ASRTRVG..NYEMG.RTLGE.GSFA.KVKYAKNT 39 + 57.6 ++At1g01140.2_ 11 ASRTRVG..NYEMG.RTLGE.GSFA.KVKYAKNT 39 + 57.6 ++At1g01140.3_ 11 ASRTRVG..NYEMG.RTLGE.GSFA.KVKYAKNT 39 + 57.6 ++At1g01540.1_ 291 QWNAKVS..DFGLA.KLLGSESSYV.TTRVMGTF 320 + 29.5 ++At1g01540.2_ 291 QWNAKVS..DFGLA.KLLGSESSYV.TTRVMGTF 320 + 29.5 ++At1g01560.1_ 178 CDL.KIG..DFGLA.RTKSE.TDFM.TEYVVTRW 205 + 5.53 ++At1g02970.1_ 242 LSR.YLT..DFHEI.RQIGA.GHFS.RVFKVLKR 269 + 13.6 ++At1g03740.1_ 206 APR.RAN..TFEKL.EKIGQ.GTYS.SVYRARDL 233 + 15.3 ++At1g03920.1_ 127 LQRHKMGADDFELL.TMIGK.GAFG.EVRVVREI 157 + 27.8 ++At1g03930.1_ 1 MDL.VIGG.KFKLG.RKIGS.GSFG.ELYLGINV 29 + 38.8 ++At1g04440.1_ 1 MDR.VVGG.KFKLG.RKLGS.GSFG.EIFLGVNV 29 + 43.3 ++At1g04700.1_ 758 LQIIKNT..DLEDL.HELGS.GTFG.TVYYGKWR 786 + 22.8 ++At1g05700.1_ 554 ADVIKMT..N.NFG.QVLGK.GGFG.TVYHGFYD 581 + 17.0 ++At1g06390.1_ 62 GEP.KQT..ISYMAERVVGT.GSFG.IVFQAKCL 90 + 41.9 ++At1g06390.2_ 62 GEP.KQT..ISYMAERVVGT.GSFG.IVFQAKCL 90 + 41.9 ++ ++ ADR KVG DFELGERTLGS GSFG TVYVAKNL ++ LS R T NYGMA KI E YA E FYG T ++ L V K K V ++ R + + A C D E F G H I K L M N P Q R S T V W Y Del Ins Score +- 1 0 2 4 0 1 0 0 6 0 0 0 0 0 0 5 0 0 0 0 0 14.6 +- 0 -0.102 +- 0 4 0 0 0 0 0 3 0 0 0 0 0 0 0 6 0 4 0 0 2 9.61 +- 0 -0.102 +- 0 0 15 0 0 0 0 0 0 0 0 0 3 0 0 0 0 1 0 0 0 43.1 +- 0 -0.102 +- 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 16 -13.0 +- 0 -0.102 +- 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 19 -11.8 +- 0 -0.102 +- 0 0 0 0 0 0 0 10 0 3 0 0 0 0 0 0 0 2 4 0 0 37.2 +- 0 -0.102 +- 0 0 0 2 5 0 0 0 0 0 0 0 0 0 0 0 0 0 7 5 0 46.0 +- 0 -0.102 +- 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17 0 0 0 0 0 48.7 +- 0 -0.102 +- 2 0 0 0 7 0 0 0 0 4 0 0 0 3 0 0 1 2 0 0 0 14.3 +- 0 -0.102 +- 0 0 0 0 0 19 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 64.0 +- 0 -0.102 +- 4 6 0 0 0 0 0 3 0 0 1 0 0 0 0 0 1 2 0 2 0 18.9 +- 0 -0.102 +- 0 0 0 0 0 0 0 3 3 5 0 0 0 0 0 0 2 6 0 0 0 15.1 +- 0 -0.102 +- 0 0 0 0 0 0 0 3 0 8 2 0 0 0 3 1 0 2 0 0 0 13.5 +- 0 -0.102 +- 2 0 0 0 2 2 0 1 0 2 4 0 0 0 0 0 0 3 1 2 0 5.62 +- 0 -0.102 +- 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 16 -13.6 +- 0 -0.102 +- 0 0 1 13 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 2 0 33.3 +- 0 -0.102 +- 0 0 0 0 2 0 0 4 0 7 3 0 0 0 3 0 0 0 0 0 0 21.5 +- 0 -0.102 +- 0 0 0 0 0 0 0 7 0 9 1 0 0 0 0 0 0 1 0 1 0 29.7 +- 0 -0.102 +- 1 0 0 0 0 0 0 0 2 5 0 0 0 0 1 0 9 1 0 0 0 14.8 +- 0 -0.102 +- 0 0 0 3 0 14 0 0 0 1 0 0 0 0 1 0 0 0 0 0 0 31.0 +- 0 -0.102 +- 0 0 0 2 0 0 0 0 4 0 0 0 3 3 2 4 0 0 0 1 0 7.58 +- 0 -0.102 +- 0 0 0 1 0 0 1 0 0 2 0 6 6 1 0 0 1 1 0 0 0 8.88 +- 0 -0.102 +- 0 0 0 0 0 0 0 2 0 4 0 0 12 0 0 0 0 1 0 0 0 32.6 +- 0 -0.102 +- 0 0 0 0 5 0 0 4 0 1 0 0 1 0 0 0 1 2 3 2 0 14.0 ++ 5 1 0 0 0 2 0 0 0 3 2 0 0 2 0 0 0 0 0 0 0 3.42 ++ 0 -0.0953 ++ 0 0 4 2 0 0 0 0 0 0 0 0 1 2 0 4 0 0 2 0 0 8.37 ++ 0 -0.0953 ++ 0 0 0 0 0 0 0 1 0 2 0 2 2 0 7 0 0 1 0 0 0 7.99 ++ 8 -27.6 ++ 0 0 0 0 0 0 0 0 8 0 0 0 0 0 4 0 0 2 0 1 0 21.1 ++ 0 -0.0953 ++ 1 0 0 0 0 0 0 2 0 1 2 1 0 2 0 0 0 6 0 0 0 7.29 ++ 0 -0.0953 ++ 0 0 0 0 0 7 0 0 0 0 0 1 0 0 0 2 5 0 0 0 0 17.7 ++ 4 -19.6 ++ 0 0 6 0 0 0 0 2 2 0 0 4 0 0 0 0 1 0 0 0 0 13.0 ++ 0 -0.0953 ++ 0 0 0 0 8 0 0 0 0 1 0 0 0 0 0 2 0 0 0 3 1 18.6 ++ 0 -0.0953 ++ 0 0 0 6 0 3 1 0 2 0 0 1 0 0 0 0 0 0 0 2 0 8.77 ++ 0 -0.0953 ++ 0 0 1 1 1 0 0 0 1 6 5 0 0 0 0 0 0 0 0 0 0 11.2 ++ 0 -0.0953 ++ 5 0 0 0 0 6 0 1 0 3 0 0 0 0 0 0 0 0 0 0 0 11.4 ++ 0 -0.0953 ++ 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13 -13.8 ++ 0 -0.0953 ++ 0 0 0 1 0 0 1 0 2 0 0 0 0 1 9 0 1 0 0 0 0 20.2 ++ 0 -0.0953 ++ 0 0 0 1 0 0 0 0 3 2 1 0 0 1 0 0 4 3 0 0 0 2.87 ++ 0 -0.0953 ++ 0 0 0 0 0 0 0 4 1 8 0 0 0 0 0 0 0 2 0 0 0 18.9 ++ 0 -0.0953 ++ 0 0 0 0 0 14 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 42.2 ++ 0 -0.0953 ++ 1 0 0 4 0 0 0 0 2 0 0 0 0 1 0 5 2 0 0 0 0 9.15 ++ 2 -13.8 ++ 0 0 0 0 0 12 0 0 0 0 0 0 0 0 0 2 1 0 0 0 0 30.2 ++ 0 -0.0953 ++ 1 0 1 0 0 1 1 0 0 0 0 0 0 0 0 9 2 0 0 0 0 13.2 ++ 0 -0.0953 ++ 0 0 0 0 12 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 49.2 ++ 0 -0.0953 ++ 3 0 0 0 0 7 0 0 0 0 1 0 0 0 0 2 0 2 0 0 0 11.8 ++ 0 -0.0953 ++ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15 -11.1 ++ 0 -0.0953 ++ 0 0 0 3 0 0 0 2 3 0 0 0 0 0 1 1 5 0 0 0 0 8.14 ++ 0 -0.0953 ++ 0 0 0 1 0 0 0 1 0 1 0 0 0 0 0 0 2 10 0 0 0 20.4 ++ 0 -0.0953 ++ 0 0 0 0 4 0 0 0 3 0 0 0 0 0 3 0 0 0 0 5 0 20.4 ++ 0 -0.0953 ++ 0 0 0 0 0 0 1 0 1 2 0 0 0 2 1 0 0 4 0 4 0 6.31 ++ 0 -0.0953 ++ 6 0 0 0 0 4 0 0 0 0 2 0 0 0 0 0 0 3 0 0 0 15.0 ++ 0 -0.0953 ++ 0 0 0 0 1 2 0 1 6 1 0 0 0 0 2 0 1 1 0 0 0 2.03 ++ 0 -0.0953 ++ 0 2 1 1 0 0 0 0 1 0 0 5 0 0 1 0 2 0 1 1 0 2.48 ++ 0 -0.0953 ++ 0 0 1 0 2 0 0 1 0 3 0 0 0 0 2 0 3 2 1 0 0 0.646 ++ ++Score: 195.180 Columns: 22 Sequences: 18 ++ ++ ********************** ++At1g01140.1_ 314 PVSMNAFELISSSSEFSLENLF 335 + 38.5 ++At1g01140.2_ 316 PVSMNAFELISSSSEFSLENLF 337 + 38.5 ++At1g01140.3_ 314 PVSMNAFELISSSSEFSLENLF 335 + 38.5 ++At1g01450.1_ 259 IR.AGERPLFPFNSPKFITNLT 279 + 18.2 ++At1g01540.1_ 6 AAFLNT.ELSKPTSIFGLR.LW 25 + 22.2 ++At1g01540.2_ 6 AAFLNT.ELSKPTSIFGLR.LW 25 + 22.2 ++At1g01560.1_ 132 IR.SNQ.PLTDDHSRFFLYQLL 151 + 18.0 ++At1g01740.1_ 268 SCLEGQFS.DSDGTE.LVR.LT 286 + 1.59 ++At1g02970.1_ 453 IK.EGKLPLLPGHSL.QLQQLL 472 + 15.3 ++At1g03740.1_ 406 ELYAGK.PILPGKTE..VEQLH 424 + 10.9 ++At1g03920.1_ 401 RLSRGARDLI.GKLLCSVNQRL 421 + 16.7 ++At1g03930.1_ 140 RK.ANQVYIIDFGLGKKYRDLQ 160 + 23.0 ++At1g04210.1_ 85 KFFSNEIDLFPPELG.NLVNLE 105 + 11.2 ++At1g04440.1_ 140 RK.ANQVYIIDYGLAKKYRDLQ 160 + 19.6 ++At1g04700.1_ 335 RNSFGQ.Q.SPPTSPFSVHKRA 354 + 7.44 ++At1g05700.1_ 388 PCLPND.YIW.EGLNCSYDSLT 407 + 12.2 ++At1g06390.1_ 263 ELLLGQ.PLF.PGEN.SVDQLV 281 + 24.2 ++At1g06390.2_ 263 ELLLGQ.PLF.PGEN.SVDQLV 281 + 24.2 ++ ++ PLSANQFPLIPPGSEFSLRQL ++ R LLGAREIFS L K VEN ++ F V D ++ ++ A C D E F G H I K L M N P Q R S T V W Y Del Ins Score ++ 2 0 0 3 0 0 0 3 1 0 0 0 4 0 4 1 0 0 0 0 0 5.92 ++ 0 -0.100 ++ 2 2 0 0 1 0 0 0 3 4 0 1 0 0 2 0 0 3 0 0 0 0.904 ++ 0 -0.100 ++ 0 0 0 0 3 0 0 0 0 4 0 0 0 0 0 5 0 0 0 1 5 -7.25 ++ 0 -0.100 ++ 4 0 0 2 1 0 0 0 0 4 3 0 1 0 1 2 0 0 0 0 0 1.59 ++ 0 -0.100 ++ 0 0 0 0 0 8 0 0 0 0 0 10 0 0 0 0 0 0 0 0 0 44.2 ++ 0 -0.100 ++ 4 0 1 2 0 0 0 0 2 0 0 0 0 7 0 0 2 0 0 0 0 16.8 ++ 0 -0.100 ++ 0 0 0 0 4 0 0 1 0 1 0 0 0 0 2 0 0 2 0 0 8 -15.8 ++ 0 -0.100 ++ 0 0 2 5 0 0 0 0 0 0 0 0 6 1 0 1 0 0 0 3 0 14.7 ++ 0 -0.100 ++ 0 0 0 0 0 0 0 4 0 12 0 0 0 0 0 0 0 0 0 0 2 24.0 ++ 0 -0.100 ++ 0 0 1 0 4 0 0 6 0 2 0 0 0 0 0 3 1 0 1 0 0 9.31 ++ 0 -0.100 ++ 0 0 3 0 0 0 0 0 2 0 0 0 5 0 0 4 0 0 0 0 4 -3.85 ++ 0 -0.100 ++ 0 0 2 1 2 3 0 0 0 0 0 0 6 0 0 3 0 0 0 1 0 6.07 ++ 0 -0.100 ++ 0 0 0 1 0 6 2 0 2 0 0 1 0 0 0 3 3 0 0 0 0 9.32 ++ 0 -0.100 ++ 0 0 0 2 0 0 0 0 0 5 0 0 0 0 0 9 2 0 0 0 0 17.4 ++ 0 -0.100 ++ 1 0 0 5 0 2 0 2 0 2 0 3 2 0 1 0 0 0 0 0 0 -0.929 ++ 0 -0.100 ++ 0 2 0 0 7 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 6 -1.12 ++ 0 -0.100 ++ 0 0 0 0 2 2 0 0 2 1 0 1 0 1 0 8 0 0 0 0 1 -1.17 ++ 0 -0.100 ++ 0 0 0 0 0 0 0 1 0 8 0 0 0 0 0 0 0 6 0 3 0 25.5 ++ 0 -0.100 ++ 0 0 3 4 0 0 1 0 0 0 0 1 0 1 5 0 1 1 0 1 0 4.77 ++ 0 -0.100 ++ 0 0 2 0 0 0 0 0 1 0 0 5 0 6 0 1 0 0 0 0 3 4.15 ++ 0 -0.100 ++ 0 0 0 0 0 0 0 0 0 16 0 0 0 0 2 0 0 0 0 0 0 40.2 ++ 0 -0.100 ++ 1 0 0 1 3 0 1 0 0 3 0 0 0 2 0 0 3 2 2 0 0 2.66 + +diff -rNu a/tests/glam2scan/Makefile.in b/tests/glam2scan/Makefile.in +--- a/tests/glam2scan/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/glam2scan/Makefile.in 2015-04-21 17:09:45.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/glam2scan/glam2scan.txt b/tests/glam2scan/glam2scan.txt +--- a/tests/glam2scan/glam2scan.txt 2015-03-25 10:44:45.000000000 +1000 ++++ b/tests/glam2scan/glam2scan.txt 2015-04-21 14:11:38.000000000 +1000 +@@ -1,80 +1,80 @@ + GLAM2SCAN + Version 1056 + +-/home/james/dist/src/glam2scan p glam2/glam2.txt ../doc/examples/At.fa ++/Users/t.bailey/meme_hg/meme/src/glam2scan p glam2/glam2.txt At.s + +- ****.**************************** +-At1g01140.1_4-2-4_SnRK3. 194 .KGYDGAAADVWSCG.VILFVLMAGYLPFDEPN 224 + 69.0 ++ ***************************** ++At1g01140.1_4-2-4_SnRK3. 196 YDGAAADVWSCGVILFVLMAGYLPFDEPN 224 + 66.9 + +- ****.**************************** +-At1g01140.2_SnRK3.12 194 .KGYDGAAADVWSCG.VILFVLMAGYLPFDEPN 224 + 69.0 ++ ***************************** ++At1g01140.2_SnRK3.12 196 YDGAAADVWSCGVILFVLMAGYLPFDEPN 224 + 66.9 + +- ****.**************************** +-At1g01140.3_SnRK3.12 194 .KGYDGAAADVWSCG.VILFVLMAGYLPFDEPN 224 + 69.0 ++ ***************************** ++At1g01140.3_SnRK3.12 196 YDGAAADVWSCGVILFVLMAGYLPFDEPN 224 + 66.9 + +- ******************************** +-At1g06390.1_4-5-4_ASK-io 245 ATEYTASIDIWSAG.CVLAELLLGQPLFPGEN 275 + 68.6 ++ ***************************** ++At1g01540.1_1-6-3 332 MLNEKSDIYSFGILIMEIITGRNPVDYSR 360 + 65.1 + +- ******************************** +-At1g06390.2_ASK-iota 245 ATEYTASIDIWSAG.CVLAELLLGQPLFPGEN 275 + 68.6 ++ ***************************** ++At1g01540.2_Putative 332 MLNEKSDIYSFGILIMEIITGRNPVDYSR 360 + 65.1 + +- ***.***************************** +-At1g01540.1_1-6-3 329 CTGMLNEKSDIYSFG.ILIMEIITGRNPVDYSR 360 + 67.6 ++ ***************************** ++At1g01560.1_4-5-1_MPK11 217 EYTAAIDIWSVGCILGEIMTRE.PLFPGR 244 + 63.2 + +- ***.***************************** +-At1g01540.2_Putative 329 CTGMLNEKSDIYSFG.ILIMEIITGRNPVDYSR 360 + 67.6 ++ ***************************** ++At1g06390.1_4-5-4_ASK-io 247 EYTASIDIWSAGCVLAELLLGQ.PLFPGE 274 + 62.6 + +- ******************************** +-At1g01560.1_4-5-1_MPK11 215 CSEYTAAIDIWSVG.CILGEIMTREPLFPGRD 245 + 66.3 ++ ***************************** ++At1g06390.2_ASK-iota 247 EYTASIDIWSAGCVLAELLLGQ.PLFPGE 274 + 62.6 + +- ******************************** +-At1g03920.1_4-2-6 350 .KGYGMECDWWSLG.AIMYEMLVGYPPFYADD 379 + 61.5 ++ ***************************** ++At1g04210.1_protein 999 FYGLEVDIWSFGCLIFELLTLQNPYFDLS 1027 + 61.7 + +- ***....***************************** +-At1g04210.1_protein 993 AMHEQNFYGLEVDIWSFG.CLIFELLTLQNPYFDLS 1027 + 60.5 ++ ***************************** ++At1g01450.1_2-1-1 221 KYSDKSDVYSFGMVSFELLTGKVPFEDSH 249 + 60.7 + +- ***......***************************** +-At1g01450.1_2-1-1 214 .SGTAGSLKYSDKSDVYSFG.MVSFELLTGKVPFEDSH 249 + 58.7 ++ ***************************** ++At1g04700.1_2-1-4-1_Raf1 951 RVSEKVDVFSFGIVMWEILTGEEPYANLH 979 + 57.2 + +- ******************************** +-At1g05700.1_1-8-1 736 .NGLNEKSDIYSFG.VVLLEMITGKTVIKESQ 765 + 57.5 ++ ***************************** ++At1g05700.1_1-8-1 737 GLNEKSDIYSFGVVLLEMITGKTVIKESQ 765 + 56.2 + +- ***..***************************** +-At1g05100.1_4-4-1_MAPKKK 176 ARGERQGKESDIWAVG.CTVIEMVTGSQPWIGAD 208 + 55.9 ++ ***************************** ++At1g03920.1_4-2-6 351 GYGMECDWWSLGAIMYEMLVGY.PPFYAD 378 + 56.2 + +- ******************************** +-At1g03740.1_4-5-2 388 ASHYGVGVDLWSTG.CILGELYAGKPILPGKT 418 + 55.8 ++ ***************************** ++At1g05100.1_4-4-1_MAPKKK 180 RQGKESDIWAVGCTVIEMVTGSQPWIGAD 208 + 55.6 + +- ***...*.**************************** +-At1g04700.1_2-1-4-1_Raf1 946 .NGSSNRVSEKVDVFSFG.IVMWEILTGEEPYANLH 979 + 53.9 ++ ***************************** ++At1g03740.1_4-5-2 390 HYGVGVDLWSTGCILGELYAGK.PILPGK 417 + 53.1 + +- ***....***************************** +-At1g04440.1_3-1-1-1 184 .THLGIEQSRRDDLESLG.YLLMYFLRGSLPWQGLR 217 + 50.6 ++ ***************************** ++At1g04440.1_3-1-1-1 189 EQSRRDDLESLGYLLMYFLRGSLPWQGLR 217 + 52.3 + +- ***....***************************** +-At1g03930.1_3-1-1-1_ADK1 184 .THLGVEQSRRDDLEALG.YVLMYFLKGSLPWQGLK 217 + 48.0 ++ ***************************** ++At1g02970.1_4-3-1 420 EHLDKVDIFSLGVTVYELIKGS.PLTESR 447 + 51.0 + +- ****.**************************** +-At1g01740.1_1-16-1 223 .TGRITAESVIYSFG.TLLLDLLTGKH.IPPSH 252 + 47.3 ++ ***************************** ++At1g03930.1_3-1-1-1_ADK1 189 EQSRRDDLEALGYVLMYFLKGSLPWQGLK 217 + 50.0 + +- ***.*..**************************** +-At1g02970.1_4-3-1 416 .NEDYEHLDKVDIFSLG.VTVYELIKGSP.LTESR 447 + 42.6 ++ ***************************** ++At1g01740.1_1-16-1 225 RITAESVIYSFGTLLLDLLTGK.HIPPSH 252 + 49.3 + +- ******************************** +-At1g01540.1_1-6-3 11 .TELSKPTSIFGLRLWVVIGILLGSLIVIALF 41 + -4.38 ++ ***************************** ++At1g04700.1_2-1-4-1_Raf1 595 KSSDKADYSSPNTNFPVVFLRQEPMIPRH 623 + -11.5 + +- ******************************** +-At1g01540.2_Putative 11 .TELSKPTSIFGLRLWVVIGILLGSLIVIALF 41 + -4.38 ++ *************.**************** ++At1g01540.1_1-6-3 12 ELSKPTSIFGLRLWVVIGILLGSLIVIALF 41 + -13.7 + +- ******************************** +-At1g03740.1_4-5-2 323 .SGL.EHC..HSRG.VLHRD.IKGSNLLIDSK 348 + -15.2 ++ *************.**************** ++At1g01540.2_Putative 12 ELSKPTSIFGLRLWVVIGILLGSLIVIALF 41 + -13.7 + +- ***.*.**************************** +-At1g04700.1_2-1-4-1_Raf1 591 CSTTKSSDKADYSSPN.TNFPVVFLRQEPMIPRH 623 + -16.2 ++ ***************************** ++At1g03740.1_4-5-2 322 LSGLEH.CHSRGVLHRD.IKGSNLLIDSK 348 + -13.8 + +- ***.***************************** +-At1g03740.1_4-5-2 151 .KGVEKPEVE.ASVR.VVHRELKRGSSIVSPKD 180 + -17.4 ++ ***************************** ++At1g01140.1_4-2-4_SnRK3. 385 KSGRKGQL.SVATEVFE.VAPSLHVVELR 411 + -14.6 + +- ***......***************************** +-At1g03930.1_3-1-1-1_ADK1 63 .TGVPNLKWYGVEGD.YNV..MVI.DLL.GPS.LEDLF 93 + -19.0 ++ ***************************** ++At1g01140.2_SnRK3.12 387 KSGRKGQL.SVATEVFE.VAPSLHVVELR 413 + -14.6 + +diff -rNu a/tests/gomo/Makefile.in b/tests/gomo/Makefile.in +--- a/tests/gomo/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/gomo/Makefile.in 2015-04-21 17:09:45.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/mast/Makefile.in b/tests/mast/Makefile.in +--- a/tests/mast/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/mast/Makefile.in 2015-04-21 17:09:46.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/mcast/Makefile.in b/tests/mcast/Makefile.in +--- a/tests/mcast/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/mcast/Makefile.in 2015-04-21 17:09:46.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/meme/Makefile.in b/tests/meme/Makefile.in +--- a/tests/meme/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/meme/Makefile.in 2015-04-21 17:09:46.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/mhmm/Makefile.in b/tests/mhmm/Makefile.in +--- a/tests/mhmm/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/mhmm/Makefile.in 2015-04-21 17:09:46.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/mhmms/Makefile.in b/tests/mhmms/Makefile.in +--- a/tests/mhmms/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/mhmms/Makefile.in 2015-04-21 17:09:46.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/mhmmscan/Makefile.in b/tests/mhmmscan/Makefile.in +--- a/tests/mhmmscan/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/mhmmscan/Makefile.in 2015-04-21 17:09:46.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/motiph/Makefile.in b/tests/motiph/Makefile.in +--- a/tests/motiph/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/motiph/Makefile.in 2015-04-21 17:09:46.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/psp-gen/Makefile.in b/tests/psp-gen/Makefile.in +--- a/tests/psp-gen/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/psp-gen/Makefile.in 2015-04-21 17:09:46.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/qvalue/Makefile.in b/tests/qvalue/Makefile.in +--- a/tests/qvalue/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/qvalue/Makefile.in 2015-04-21 17:09:46.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/scaffold/Makefile.in b/tests/scaffold/Makefile.in +--- a/tests/scaffold/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/scaffold/Makefile.in 2015-04-21 17:09:46.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/scripts/Makefile.in b/tests/scripts/Makefile.in +--- a/tests/scripts/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/scripts/Makefile.in 2015-04-21 17:09:46.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/scripts/glam2.test b/tests/scripts/glam2.test +--- a/tests/scripts/glam2.test 2015-03-25 10:44:42.000000000 +1000 ++++ b/tests/scripts/glam2.test 2015-04-21 14:11:38.000000000 +1000 +@@ -1,8 +1,8 @@ + #!/usr/bin/perl test_driver +-# Test fimo ++# Test glam2 + &test('glam2_1', '', + 'glam2', '', +- ['-M', '-r', 2, '-n', 100, '-O', 'results/glam2_1', 'p', 'At.s'], ++ ['-M', '-r', 3, '-n', 100, '-O', 'results/glam2_1', 'p', 'At.s'], + [ + {output => 'results/glam2_1/glam2.txt', reference => 'glam2/glam2.txt', type => 'text', ignore => ['glam2']} + ], +diff -rNu a/tests/spamo/Makefile.in b/tests/spamo/Makefile.in +--- a/tests/spamo/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/spamo/Makefile.in 2015-04-21 17:09:46.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/tomtom/Makefile.in b/tests/tomtom/Makefile.in +--- a/tests/tomtom/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/tomtom/Makefile.in 2015-04-21 17:09:46.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/tests/web/Makefile.in b/tests/web/Makefile.in +--- a/tests/web/Makefile.in 2015-03-25 11:42:46.000000000 +1000 ++++ b/tests/web/Makefile.in 2015-04-21 17:09:46.000000000 +1000 +@@ -1,4 +1,4 @@ +-# Makefile.in generated by automake 1.13.3 from Makefile.am. ++# Makefile.in generated by automake 1.14 from Makefile.am. + # @configure_input@ + + # Copyright (C) 1994-2013 Free Software Foundation, Inc. +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/Ame.java b/website/src/au/edu/uq/imb/memesuite/servlet/Ame.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Ame.java 2015-03-25 10:44:44.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Ame.java 2015-04-14 13:43:17.000000000 +1000 +@@ -218,7 +218,7 @@ + main.set("advanced_options", advBtn.getComponent()); + main.set("submit_reset", submitReset.getComponent()); + main.set("footer", footer.getComponent()); +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); + } + +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/Centrimo.java b/website/src/au/edu/uq/imb/memesuite/servlet/Centrimo.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Centrimo.java 2015-03-25 10:44:44.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Centrimo.java 2015-04-14 13:43:17.000000000 +1000 +@@ -240,7 +240,7 @@ + main.set("advanced_options", advBtn.getComponent()); + main.set("submit_reset", submitReset.getComponent()); + main.set("footer", footer.getComponent()); +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); + } + +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/Dreme.java b/website/src/au/edu/uq/imb/memesuite/servlet/Dreme.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Dreme.java 2015-03-25 10:44:44.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Dreme.java 2015-04-14 13:43:17.000000000 +1000 +@@ -142,7 +142,7 @@ + main.set("advanced_options", advancedOptions.getComponent()); + main.set("submit_reset", submitReset.getComponent()); + main.set("footer", footer.getComponent()); +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); + } + +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/Fimo.java b/website/src/au/edu/uq/imb/memesuite/servlet/Fimo.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Fimo.java 2015-03-25 10:44:44.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Fimo.java 2015-04-14 13:43:17.000000000 +1000 +@@ -166,7 +166,7 @@ + main.set("advanced_options", advBtn.getComponent()); + main.set("submit_reset", submitReset.getComponent()); + main.set("footer", footer.getComponent()); +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); + } + +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/Glam2.java b/website/src/au/edu/uq/imb/memesuite/servlet/Glam2.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Glam2.java 2015-03-25 10:44:44.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Glam2.java 2015-04-14 13:43:17.000000000 +1000 +@@ -182,7 +182,7 @@ + main.set("max_iter", WebUtils.paramOptInteger(request, "max_iter", 1, 1000000, 2000)); + if (WebUtils.paramBool(request, "norc")) main.set("norc_checked", "checked"); + // output +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); + } + +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/Glam2Request.java b/website/src/au/edu/uq/imb/memesuite/servlet/Glam2Request.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Glam2Request.java 2015-04-09 18:20:39.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Glam2Request.java 2015-04-14 13:43:17.000000000 +1000 +@@ -78,7 +78,7 @@ + parameters.add(parameter.toSub().set("name", "aln_embed"). + set("value", WebUtils.escapeHTML(aln))); + out.set("parameter", parameters); +- resp.setContentType("text/html"); ++ resp.setContentType("text/html; charset=UTF-8"); + out.output(resp.getWriter()); + } + +@@ -119,7 +119,7 @@ + parameters.add(parameter.toSub().set("name", "motifs_embed"). + set("value", WebUtils.escapeHTML(builder.toString()))); + out.set("parameter", parameters); +- resp.setContentType("text/html"); ++ resp.setContentType("text/html; charset=UTF-8"); + out.output(resp.getWriter()); + } + +@@ -171,7 +171,7 @@ + } + + out.set("parameter", parameters); +- resp.setContentType("text/html"); ++ resp.setContentType("text/html; charset=UTF-8"); + out.output(resp.getWriter()); + + } +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/Glam2scan.java b/website/src/au/edu/uq/imb/memesuite/servlet/Glam2scan.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Glam2scan.java 2015-03-25 10:44:44.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Glam2scan.java 2015-04-14 13:43:17.000000000 +1000 +@@ -154,7 +154,7 @@ + main.set("advanced_options", advBtn.getComponent()); + main.set("submit_reset", submitReset.getComponent()); + main.set("footer", footer.getComponent()); +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); + } + +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/Gomo.java b/website/src/au/edu/uq/imb/memesuite/servlet/Gomo.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Gomo.java 2015-03-25 10:44:44.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Gomo.java 2015-04-14 13:43:17.000000000 +1000 +@@ -167,7 +167,7 @@ + main.set("advanced_options", advBtn.getComponent()); + main.set("submit_reset", submitReset.getComponent()); + main.set("footer", footer.getComponent()); +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); + } + +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/JobStatus.java b/website/src/au/edu/uq/imb/memesuite/servlet/JobStatus.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/JobStatus.java 2015-03-25 10:44:44.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/JobStatus.java 2015-04-14 13:43:17.000000000 +1000 +@@ -127,7 +127,7 @@ + status = app.queryStatus(jobId); + } catch (RemoteException e) { /* ignore */ } + } +- resp.setContentType("application/xml"); ++ resp.setContentType("application/xml; charset=UTF-8"); + PrintWriter out = resp.getWriter(); + if (status != null) { + String url = jobUrl(status); +@@ -198,7 +198,7 @@ + page.empty("program_header"); + page.set("status", "expired"); + } +- resp.setContentType("text/html"); ++ resp.setContentType("text/html; charset=UTF-8"); + page.output(resp.getWriter()); + } + } +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/Mast.java b/website/src/au/edu/uq/imb/memesuite/servlet/Mast.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Mast.java 2015-03-25 10:44:44.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Mast.java 2015-04-14 13:43:17.000000000 +1000 +@@ -191,7 +191,7 @@ + main.set("advanced_options", advBtn.getComponent()); + main.set("submit_reset", submitReset.getComponent()); + main.set("footer", footer.getComponent()); +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); + } + +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/Mcast.java b/website/src/au/edu/uq/imb/memesuite/servlet/Mcast.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Mcast.java 2015-03-25 10:44:44.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Mcast.java 2015-04-14 13:43:17.000000000 +1000 +@@ -178,7 +178,7 @@ + main.set("advanced_options", advBtn.getComponent()); + main.set("submit_reset", submitReset.getComponent()); + main.set("footer", footer.getComponent()); +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); + } + +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/Meme.java b/website/src/au/edu/uq/imb/memesuite/servlet/Meme.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Meme.java 2015-03-25 10:44:44.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Meme.java 2015-04-14 13:43:17.000000000 +1000 +@@ -169,7 +169,7 @@ + main.set("advanced_options", advancedOptions.getComponent()); + main.set("submit_reset", submitReset.getComponent()); + main.set("footer", footer.getComponent()); +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); + } + +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/MemeRequest.java b/website/src/au/edu/uq/imb/memesuite/servlet/MemeRequest.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/MemeRequest.java 2015-03-25 10:44:44.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/MemeRequest.java 2015-04-14 13:43:17.000000000 +1000 +@@ -114,7 +114,7 @@ + parameters.add(parameter.toSub().set("name", "motifs_embed"). + set("value", WebUtils.escapeHTML(motifs))); + out.set("parameter", parameters); +- resp.setContentType("text/html"); ++ resp.setContentType("text/html; charset=UTF-8"); + out.output(resp.getWriter()); + } + +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/Memechip.java b/website/src/au/edu/uq/imb/memesuite/servlet/Memechip.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Memechip.java 2015-03-25 10:44:44.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Memechip.java 2015-04-14 13:43:17.000000000 +1000 +@@ -243,7 +243,7 @@ + main.set("centrimo_opts", centrimoOpts.getComponent()); + main.set("submit_reset", submitReset.getComponent()); + main.set("footer", footer.getComponent()); +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); + } + +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/ShowGomoDBs.java b/website/src/au/edu/uq/imb/memesuite/servlet/ShowGomoDBs.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/ShowGomoDBs.java 2015-03-25 10:44:44.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/ShowGomoDBs.java 2015-04-14 13:43:17.000000000 +1000 +@@ -70,7 +70,7 @@ + private void display(HttpServletResponse response) + throws IOException, ServletException { + GomoDBList gomoDBList = (GomoDBList)context.getAttribute(GOMO_DB_KEY); +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + HTMLSub out = template.toSub(); + if (gomoDBList != null) { + try { +@@ -103,7 +103,7 @@ + private void outputXmlListingsOfCategory(HttpServletResponse response, long categoryId) + throws IOException, ServletException { + GomoDBList gomoDBList = (GomoDBList)context.getAttribute(GOMO_DB_KEY); +- response.setContentType("application/xml"); ++ response.setContentType("application/xml; charset=UTF-8"); + // turn off caching + // response.setHeader("Cache-Control", "no-cache, no-store, must-revalidate"); // HTTP 1.1. + // response.setHeader("Pragma", "no-cache"); // HTTP 1.0. +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/ShowMotifDBs.java b/website/src/au/edu/uq/imb/memesuite/servlet/ShowMotifDBs.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/ShowMotifDBs.java 2015-03-25 10:44:44.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/ShowMotifDBs.java 2015-04-14 13:43:17.000000000 +1000 +@@ -69,7 +69,7 @@ + private void display(HttpServletResponse response) + throws IOException, ServletException { + MotifDBList motifDBList = (MotifDBList)context.getAttribute(MOTIF_DB_KEY); +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + HTMLSub out = template.toSub(); + if (motifDBList != null) { + try { +@@ -102,7 +102,7 @@ + private void outputXmlListing(HttpServletResponse response, long listingId) + throws IOException { + MotifDBList motifDBList = (MotifDBList)context.getAttribute(MOTIF_DB_KEY); +- response.setContentType("application/xml"); ++ response.setContentType("application/xml; charset=UTF-8"); + PrintWriter out = null; + try { + MotifDB motifDB = motifDBList.getMotifListing(listingId); +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/ShowSequenceDBs.java b/website/src/au/edu/uq/imb/memesuite/servlet/ShowSequenceDBs.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/ShowSequenceDBs.java 2015-04-09 18:20:39.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/ShowSequenceDBs.java 2015-04-21 14:11:38.000000000 +1000 +@@ -68,17 +68,17 @@ + private void display(HttpServletResponse response) + throws IOException, ServletException { + SequenceDBList sequenceDBList = (SequenceDBList)context.getAttribute(SEQUENCE_DB_KEY); +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + HTMLSub out = template.toSub(); + if (sequenceDBList != null) { + try { + out.set("category", new AllCategory(sequenceDBList)); + } catch (SQLException e) { + logger.log(Level.SEVERE, "Error loading sequence categories", e); +- out.empty("content"); ++ out.empty("category"); + } + } else { +- out.empty("content"); ++ out.empty("category"); + } + out.output(response.getWriter()); + } +@@ -127,7 +127,7 @@ + long categoryId, boolean shortOnly, EnumSet allowedAlphabets) + throws IOException, ServletException { + SequenceDBList sequenceDBList = (SequenceDBList)context.getAttribute(SEQUENCE_DB_KEY); +- response.setContentType("application/xml"); ++ response.setContentType("application/xml; charset=UTF-8"); + // turn off caching + // response.setHeader("Cache-Control", "no-cache, no-store, must-revalidate"); // HTTP 1.1. + // response.setHeader("Pragma", "no-cache"); // HTTP 1.0. +@@ -187,7 +187,7 @@ + long listingId, boolean shortOnly, EnumSet allowedAlphabets) + throws IOException, ServletException { + SequenceDBList sequenceDBList = (SequenceDBList)context.getAttribute(SEQUENCE_DB_KEY); +- response.setContentType("application/xml"); ++ response.setContentType("application/xml; charset=UTF-8"); + PrintWriter out = null; + try { + List versions = sequenceDBList.getVersions(listingId, shortOnly, allowedAlphabets); +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/Spamo.java b/website/src/au/edu/uq/imb/memesuite/servlet/Spamo.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Spamo.java 2015-03-25 10:44:44.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Spamo.java 2015-04-14 13:43:17.000000000 +1000 +@@ -185,7 +185,7 @@ + main.set("advanced_options", advBtn.getComponent()); + main.set("submit_reset", submitReset.getComponent()); + main.set("footer", footer.getComponent()); +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); + } + +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/SubmitJob.java b/website/src/au/edu/uq/imb/memesuite/servlet/SubmitJob.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/SubmitJob.java 2015-04-09 18:20:39.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/SubmitJob.java 2015-04-14 13:43:17.000000000 +1000 +@@ -657,7 +657,7 @@ + // set up a non-blocking call + JobSubOutputType subOut = this.appServicePort.launchJob(in); + +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + HTMLSub verify = this.tmplVerify.toSub(); + verify.set("service", this.serviceName); + verify.set("id", subOut.getJobID()); +@@ -758,7 +758,7 @@ + } + + public void displayErrors(HttpServletResponse response) throws IOException { +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + SubmitJob.this.tmplWhine.toSub().set("message", feedback).output( + response.getWriter()); + } +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/Tomtom.java b/website/src/au/edu/uq/imb/memesuite/servlet/Tomtom.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Tomtom.java 2015-03-25 10:44:44.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Tomtom.java 2015-04-14 13:43:17.000000000 +1000 +@@ -206,7 +206,7 @@ + main.set("advanced_options", advBtn.getComponent()); + main.set("submit_reset", submitReset.getComponent()); + main.set("footer", footer.getComponent()); +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); + } + +@@ -356,7 +356,7 @@ + response.reset(); + storeUniqueId(uuid, response); + response.setBufferSize(DEFAULT_BUFFER_SIZE); +- response.setContentType("text/html"); ++ response.setContentType("text/html; charset=UTF-8"); + response.setHeader("Content-Length", String.valueOf(result.length())); + // Prepare streams. + BufferedInputStream input = null; +diff -rNu a/website/src/au/edu/uq/imb/memesuite/servlet/util/WebUtils.java b/website/src/au/edu/uq/imb/memesuite/servlet/util/WebUtils.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/util/WebUtils.java 2015-03-25 10:44:45.000000000 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/util/WebUtils.java 2015-04-14 13:43:17.000000000 +1000 +@@ -757,7 +757,7 @@ + throws ServletException, IOException { + String stars = "*******************************************************************************"; + String dashes = "-------------------------------------------------------------------------------"; +- resp.setContentType("text/plain"); ++ resp.setContentType("text/plain; charset=UTF-8"); + PrintWriter out = resp.getWriter(); + out.println(error); + Enumeration paramNames = req.getParameterNames(); +diff -rNu a/website/web.xml b/website/web.xml +--- a/website/web.xml 2015-03-25 10:44:46.000000000 +1000 ++++ b/website/web.xml 2015-04-14 13:43:17.000000000 +1000 +@@ -208,6 +208,20 @@ + + + ++ ++ SetCharacterEncoding ++ org.apache.catalina.filters.SetCharacterEncodingFilter ++ ++ encoding ++ UTF-8 ++ ++ ++ ++ ++ SetCharacterEncoding ++ /* ++ ++ + + diff --git a/tools/meme-suite/sources/patch_4.10.1_3 b/tools/meme-suite/sources/patch_4.10.1_3 new file mode 100644 index 0000000000000000000000000000000000000000..891e5eb0a02d961fedea90f95421370afb63af13 --- /dev/null +++ b/tools/meme-suite/sources/patch_4.10.1_3 @@ -0,0 +1,3175 @@ +diff -r 7f602ff1853b -r cd5970c6318f doc/download.html +--- a/doc/download.html Tue Apr 21 17:07:55 2015 +1000 ++++ b/doc/download.html Mon May 25 18:19:58 2015 +1000 +@@ -9,7 +9,7 @@ + + + ++ + + +
    +@@ -63,26 +240,36 @@ +
    +

    Motif Databases

    +
    +- ++

    [Click a category to show its available databases. Within a category click a database to see details.]

    + +- +-
    +-

    A Listing

    +-
    +-

    A description of the listing will go here. It +- will be about two or three sentences long.

    +-
    Files
    +-
      +-
    • file +- 100 motifs, between 7 +- and 23 in width (average width +- 12.4).
    • +-
    ++
    ++
    ++

    A Category (Number of Databases Databases)

    ++   ++ ++ +
    ++
    Loading...
    +
    +- + +- ++ +
    +
    + +diff -r 7f602ff1853b -r cd5970c6318f website/templates/show_sequence_dbs.tmpl +--- a/website/templates/show_sequence_dbs.tmpl Tue Apr 21 17:07:55 2015 +1000 ++++ b/website/templates/show_sequence_dbs.tmpl Mon May 25 18:19:58 2015 +1000 +@@ -377,11 +377,11 @@ +
    +

    Sequence Databases

    +
    +-

    Click a category to show its available databases. Within a category click a database to see details.

    ++

    [Click a category to show its available databases. Within a category click a database to see details.]

    + +
    +
    +-

    A Category

    ++

    A Category (Count of Databases databases)

    +   + + +diff -r 7f602ff1853b -r cd5970c6318f website/templates/spamo.tmpl +--- a/website/templates/spamo.tmpl Tue Apr 21 17:07:55 2015 +1000 ++++ b/website/templates/spamo.tmpl Mon May 25 18:19:58 2015 +1000 +@@ -50,7 +50,9 @@ +
    + + + +@@ -115,7 +117,7 @@ + secondaries + secondary motifs + Input the secondary motifs. +- Select, upload or enter motifs to check for preferred spacings relative to the primary motif. ++ Select a motif database or enter motifs to test for preferred spacings relative to the primary motif. + DATABASE + DNA RNA + +diff -r 7f602ff1853b -r cd5970c6318f website/templates/status.tmpl +--- a/website/templates/status.tmpl Tue Apr 21 17:07:55 2015 +1000 ++++ b/website/templates/status.tmpl Mon May 25 18:19:58 2015 +1000 +@@ -99,20 +99,17 @@ +
    +

    No job details available to display.

    +
    +- ++
    ++ ++
    + + +diff -r 7f602ff1853b -r cd5970c6318f website/templates/tomtom.tmpl +--- a/website/templates/tomtom.tmpl Tue Apr 21 17:07:55 2015 +1000 ++++ b/website/templates/tomtom.tmpl Mon May 25 18:19:58 2015 +1000 +@@ -112,7 +112,7 @@ + target_motifs + target motifs + Select target motifs +- Choose a database or file to compare with. ++ Select a motif database or provide motifs to compare with. + DNA RNA + DATABASE + diff --git a/tools/meme-suite/sources/patch_4.10.1_4 b/tools/meme-suite/sources/patch_4.10.1_4 new file mode 100644 index 0000000000000000000000000000000000000000..ab1a476e74057e5aaae19e9d81d40396d41efbb4 --- /dev/null +++ b/tools/meme-suite/sources/patch_4.10.1_4 @@ -0,0 +1,1901 @@ +diff -r cd5970c6318f -r eb3670af8100 MemeSuite.properties.in +--- a/MemeSuite.properties.in Mon May 25 18:19:58 2015 +1000 ++++ b/MemeSuite.properties.in Mon Jun 15 19:01:40 2015 +1000 +@@ -12,3 +12,12 @@ + lib.dir = @lib.dir@ + db.dir = @db.dir@ + sendmail = @sendmail@ ++# Limits on website submissions per unique user. ++# If a value is specified then it must match the pattern COUNT/TIME ++# where both COUNT and TIME are integers. ++# COUNT is the maximum number of uncompleted job submissions. ++# TIME is the maximum tracking time in seconds for a job submission. ++# If either COUNT or TIME is zero then there is no limit. ++# For example, 4 unfinished jobs per hour is written as: ++# quota = 4/3600 ++quota = +diff -r cd5970c6318f -r eb3670af8100 doc/css/style.css +--- a/doc/css/style.css Mon May 25 18:19:58 2015 +1000 ++++ b/doc/css/style.css Mon Jun 15 19:01:40 2015 +1000 +@@ -688,6 +688,15 @@ + margin-bottom: 5px; + text-align:center; + } ++p.submit_limit_warn { ++ margin: 1px; ++ padding: 5px; ++ border: 3px double black; ++ background-color: #FFC; ++} ++p.submit_limit_warn:not(.active) { ++ display: none; ++} + div.submit_buttons { + text-align: center; + } +diff -r cd5970c6318f -r eb3670af8100 doc/js/menu.js +--- a/doc/js/menu.js Mon May 25 18:19:58 2015 +1000 ++++ b/doc/js/menu.js Mon Jun 15 19:01:40 2015 +1000 +@@ -22,6 +22,7 @@ + MemeMenu.is_server = false; + MemeMenu.path_prefix = ""; + MemeMenu.online_prefix = ""; ++MemeMenu.last_modified_timestamps = {}; + + // calculate the path to this script + MemeMenu.base = ( +@@ -724,6 +725,8 @@ + if (xmlhttp.readyState === 4) { + if (xmlhttp.status === 200 && /\S/.test(xmlhttp.responseText)) { + last_modified = new Date(xmlhttp.getResponseHeader("Last-Modified")); ++ // store the last modified date so we can use it in our cookie ++ MemeMenu.last_modified_timestamps[cookie_name] = last_modified; + cookie_re = RegExp("^(?:.*;)?\\s*"+cookie_name+"\\s*=([^;]*)(?:;.*)?$"); + if ((match = cookie_re.exec(document.cookie)) !== null) { + seen_and_dismissed = new Date(parseInt(match[1], 10)); +@@ -772,18 +775,25 @@ + + MemeMenu.remove_notification = function(e) { + "use strict"; +- var elem, important, cookie_name, now, expiry; ++ var elem, important, cookie_name, now, timestamp, expiry; + elem = this; + elem.removeEventListener("click", MemeMenu.remove_notification, false); + while (elem && !/\bnotice_area\b/.test(elem.className)) elem = elem.parentNode; + if (elem && elem.parentNode) elem.parentNode.removeChild(elem); + important = /\bimportant\b/.test(elem.className); + cookie_name = elem.getAttribute("data-cookie-name"); ++ // Determine what we think the time is. + now = new Date(); +- // date when unimportant messages are shown again. ++ // Determine when the server thinks the file was last changed ++ // or approximate it if unknown. ++ timestamp = MemeMenu.last_modified_timestamps[cookie_name]; ++ if (timestamp == null) timestamp = now; ++ // Calculate a date when unimportant messages are shown again. ++ // This is calculated relative to the time we think it is, as it ++ // is our browser which will be throwing away the cookies. + expiry = new Date(now.getTime() + (30 * 24 * 60 * 60 * 1000)); // 1 month + // note that cookies for important messages always expire with the session +- document.cookie = cookie_name + "=" + now.getTime() + ++ document.cookie = cookie_name + "=" + timestamp.getTime() + + (important ? "" : "; expires=" + expiry.toGMTString()) + "; path=/"; + } + +diff -r cd5970c6318f -r eb3670af8100 doc/update-sequence-db.html +--- a/doc/update-sequence-db.html Mon May 25 18:19:58 2015 +1000 ++++ b/doc/update-sequence-db.html Mon Jun 15 19:01:40 2015 +1000 +@@ -8,6 +8,16 @@ + + + ++ + + + + ++

    Database Schema

    ++
    ++

    As well as downloading the sequence files from many sources, the updater ++ tracks the files using a SQLite database. The schema of the database is ++ given below.

    ++

    tblCategory

    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    ColumnTypeConstraintDescription
    idINTEGERPRIMARY KEYA auto-generated unique identifier for the category. Other tables reference this field.
    nameTEXTUNIQUE NOT NULLThe unique name of the category as shown to users.
    ++

    tblListing

    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    ColumnTypeConstraintDescription
    idINTEGERPRIMARY KEYA auto-generated unique identifier for the listing. Other tables reference this field.
    categoryIdINTEGERNOT NULL REFERENCES tblCategory (id)The identifier of the category that contains this listing.
    nameTEXTNOT NULLThe name of the listing shown to users.
    descriptionTEXTNOT NULLThe description of the listing shown to users.
    ++

    The combination of the fields categoryId and name is unique.

    ++ ++

    tblSequenceFile

    ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++
    ColumnTypeConstraintDescription
    idINTEGERPRIMARY KEYA auto-generated unique identifier for the sequence file.
    retrieverINTEGERNOT NULLAn identifier for the code module that downloaded this sequence. ++ It allows the individual code modules to ensure they don't change ++ the records of files downloaded by other modules.
    listingIdINTEGERNOT NULL REFERENCES tblListing (id)The identifier of the listing that contains this sequence file.
    alphabetINTEGERNOT NULL CHECK (alphabet IN (1, 2, 4))Represents the alphabet as powers of 2 so they can be combined into a bitset. ++
      ++
    • RNA = 1,
    • ++
    • DNA = 2,
    • ++
    • Protein = 4.
    • ++
    ++
    editionINTEGERNOT NULLA machine readable version. This field is used for sorting. Larger numbers are considered newer.
    versionTEXTNOT NULLA human readable version which is displayed to the user.
    descriptionTEXTNOT NULLThe description of the sequence file, often containing information about the source.
    fileSeqTEXTUNIQUE NOT NULLThe relative path to the sequence file.
    fileBgTEXTUNIQUE NOT NULLThe relative path to the background file.
    sequenceCountINTEGERNOT NULLThe number of sequences.
    totalLenINTEGERNOT NULLThe total end-to-end combined length of the sequences.
    minLenINTEGERNOT NULLThe length of the shortest sequence.
    maxLenINTEGERNOT NULLThe length of the longest sequence.
    avgLenREALNOT NULLThe average length of the sequences.
    stdDLenREALNOT NULLCurrently unused! Intended to store the standard deviation of the average length.
    obsoleteINTEGERDEFAULT 0Used to flag sequences as obsolete. Sequences flagged as obsolete are hidden from the interface.
    ++

    The combination of the fields listingId, alphabet and edition is unique.

    ++ ++
    ++ + + + +diff -r cd5970c6318f -r eb3670af8100 src/display.c +--- a/src/display.c Mon May 25 18:19:58 2015 +1000 ++++ b/src/display.c Mon Jun 15 19:01:40 2015 +1000 +@@ -1034,7 +1034,7 @@ + + if (format == 1) { + double e1, m1; +- exp10_logx(log_ev/log(10.0), m1, e1, 3); ++ exp10_logx(log_ev/log(10.0), m1, e1, 1); + for (i=0; i -HUGE_VAL && value < HUGE_VAL) { // normal value + e = floor(value); +- m = exp10(value - e); ++ m = pow(10.0, value - e); + // check that rounding up won't cause a 9.9999 to go to a 10 + if (m + (.5 * pow(10,-prec)) >= 10) { + m = 1; +diff -r cd5970c6318f -r eb3670af8100 src/macros.h +--- a/src/macros.h Mon May 25 18:19:58 2015 +1000 ++++ b/src/macros.h Mon Jun 15 19:01:40 2015 +1000 +@@ -31,9 +31,10 @@ + #ifdef sgi4d + extern double rint(); /* missing from math.h ? */ + #endif +-#define exp10(X) pow(10.0, (X)) + #ifndef ibmrs6000 +- #define log10(X) (log(X)/2.30258509299405) ++ #define mylog10(X) (log(X)/2.30258509299405) ++#else ++ #define mylog10(X) log10(X) + #endif + + #ifdef UNIX +@@ -128,10 +129,10 @@ + #define RNDDIG 14 + #define RND(x, d, y) { \ + if (x > 0) { \ +- double _z_ = exp10(ceil((d)-1-log10(x))); \ ++ double _z_ = pow(10.0, ceil((d)-1-mylog10(x))); \ + y = rint(_z_*(x))/_z_; \ + } else if (x < 0) { \ +- double _z_ = exp10(ceil((d)-1-log10(-x))); \ ++ double _z_ = pow(10.0, ceil((d)-1-mylog10(-x))); \ + y = -rint(_z_*(-x))/_z_; \ + } else { \ + y = 0; \ +@@ -182,7 +183,7 @@ + */ + #define exp10_logx(logx, m, e, prec) { \ + (e) = floor(logx); \ +- (m) = exp10((logx) - (e)); \ ++ (m) = pow(10.0, (logx) - (e)); \ + if (m+(.5*pow(10,-prec)) >= 10) { (m) = 1; (e) += 1;} \ + } + +diff -r cd5970c6318f -r eb3670af8100 src/motif-in-dreme-xml.c +--- a/src/motif-in-dreme-xml.c Mon May 25 18:19:58 2015 +1000 ++++ b/src/motif-in-dreme-xml.c Mon Jun 15 19:01:40 2015 +1000 +@@ -115,7 +115,7 @@ + motif->length = length; + motif->num_sites = num_sites; + motif->log_evalue = log10evalue; +- motif->evalue = exp10(log10evalue); ++ motif->evalue = pow(10.0, log10evalue); + // both DNA and RNA have 4 letters + motif->alph = data->fscope.alphabet; + motif->flags = MOTIF_BOTH_STRANDS; // DREME does not support the concept of single strand scanning (yet) +diff -r cd5970c6318f -r eb3670af8100 src/motif-in-meme-html.c +--- a/src/motif-in-meme-html.c Mon May 25 18:19:58 2015 +1000 ++++ b/src/motif-in-meme-html.c Mon Jun 15 19:01:40 2015 +1000 +@@ -501,12 +501,12 @@ + if (log10_evalue != get_motif_log_evalue(parser->mscope.motif)) { + html_error(parser, "The %s of motif %s has an evalue value %g " + "which does not match the existing value of %g.\n", +- type, name, exp10(log10_evalue), get_motif_evalue(parser->mscope.motif)); ++ type, name, pow(10.0, log10_evalue), get_motif_evalue(parser->mscope.motif)); + } + } else { + parser->mscope.has_evalue = TRUE; + parser->mscope.motif->log_evalue = log10_evalue; +- parser->mscope.motif->evalue = exp10(log10_evalue); ++ parser->mscope.motif->evalue = pow(10.0, log10_evalue); + } + } + } +diff -r cd5970c6318f -r eb3670af8100 src/motif-in-meme-json.c +--- a/src/motif-in-meme-json.c Mon May 25 18:19:58 2015 +1000 ++++ b/src/motif-in-meme-json.c Mon Jun 15 19:01:40 2015 +1000 +@@ -213,7 +213,7 @@ + MOTIF_T *motif; + motif = (MOTIF_T*)owner; + motif->log_evalue = log10_evalue_from_string(value); +- motif->evalue = exp10(motif->log_evalue); ++ motif->evalue = pow(10.0, motif->log_evalue); + return true; + } + +diff -r cd5970c6318f -r eb3670af8100 src/motif-in-meme-text.c +--- a/src/motif-in-meme-text.c Mon May 25 18:19:58 2015 +1000 ++++ b/src/motif-in-meme-text.c Mon Jun 15 19:01:40 2015 +1000 +@@ -539,12 +539,12 @@ + if (log10_evalue != get_motif_log_evalue(parser->mscope.motif)) { + error(parser, "The %s of motif %s has an evalue value %g " + "which does not match the existing value of %g.\n", +- type, name, exp10(log10_evalue), get_motif_evalue(parser->mscope.motif)); ++ type, name, pow(10.0, log10_evalue), get_motif_evalue(parser->mscope.motif)); + } + } else { + parser->mscope.has_evalue = TRUE; + parser->mscope.motif->log_evalue = log10_evalue; +- parser->mscope.motif->evalue = exp10(log10_evalue); ++ parser->mscope.motif->evalue = pow(10.0, log10_evalue); + } + } + } +diff -r cd5970c6318f -r eb3670af8100 src/motif-in-meme-xml.c +--- a/src/motif-in-meme-xml.c Mon May 25 18:19:58 2015 +1000 ++++ b/src/motif-in-meme-xml.c Mon Jun 15 19:01:40 2015 +1000 +@@ -358,7 +358,7 @@ + motif->num_sites = sites; + motif->url = strdup(url); + motif->log_evalue = log10_evalue; +- motif->evalue = exp10(log10_evalue); ++ motif->evalue = pow(10.0, log10_evalue); + // calculate alphabet size + motif->alph = data->alph; + motif->flags = (data->fscope.strands == 2 ? MOTIF_BOTH_STRANDS : 0); +diff -r cd5970c6318f -r eb3670af8100 src/scanned-sequence.c +--- a/src/scanned-sequence.c Mon May 25 18:19:58 2015 +1000 ++++ b/src/scanned-sequence.c Mon Jun 15 19:01:40 2015 +1000 +@@ -15,7 +15,7 @@ + memset(sseq, 0, sizeof(SCANNED_SEQ_T)); + sseq->seq_id = strdup(seq_id); + sseq->length = length; +- sseq->pvalue = exp10(log10pvalue); ++ sseq->pvalue = pow(10.0, log10pvalue); + sseq->site_count = site_count; + sseq->sites = (SCANNED_SITE_T*)mm_malloc(sizeof(SCANNED_SITE_T) * site_count); + memset(sseq->sites, 0, sizeof(SCANNED_SITE_T) * site_count); +@@ -34,7 +34,7 @@ + sseq = mm_malloc(sizeof(SCANNED_SEQ_T)); + memset(sseq, 0, sizeof(SCANNED_SEQ_T)); + sseq->seq_id = seq_id; +- sseq->pvalue = exp10(log10pvalue); ++ sseq->pvalue = pow(10.0, log10pvalue); + return sseq; + } + +@@ -62,7 +62,7 @@ + ssite->m_num = m_num; + ssite->strand = strand; + ssite->position = position; +- ssite->pvalue = exp10(log10pvalue); ++ ssite->pvalue = pow(10.0, log10pvalue); + } + + /* +@@ -77,7 +77,7 @@ + ssite->m_num = motif_num; + ssite->position = sseq->length; + ssite->strand = strand; +- ssite->pvalue = exp10(log10pvalue); ++ ssite->pvalue = pow(10.0, log10pvalue); + sseq->length += motif_len; + } + +diff -r cd5970c6318f -r eb3670af8100 src/utils.c +--- a/src/utils.c Mon May 25 18:19:58 2015 +1000 ++++ b/src/utils.c Mon Jun 15 19:01:40 2015 +1000 +@@ -25,7 +25,6 @@ + #include "mtwist.h" // must come before utils.h + #include "utils.h" + +- + /*********************************************************************** + * Return the value to replace a missing value -- NaN. + ***********************************************************************/ +@@ -748,7 +747,7 @@ + double m, e; + if (log10_ev > -HUGE_VAL && log10_ev < HUGE_VAL) { // normal value + e = floor(log10_ev); +- m = exp10(log10_ev - e); ++ m = pow(10.0, log10_ev - e); + // check that rounding up won't cause a 9.9999 to go to a 10 + if (m + (.5 * pow(10,-prec)) >= 10) { + m = 1; +diff -r cd5970c6318f -r eb3670af8100 website/js/site.js +--- a/website/js/site.js Mon May 25 18:19:58 2015 +1000 ++++ b/website/js/site.js Mon Jun 15 19:01:40 2015 +1000 +@@ -999,23 +999,65 @@ + } + + /* ++ * Sums up the sizes of all the form fields in bytes. ++ */ ++function calculate_form_size(form) { ++ var size = 0; ++ var i, j, field, blob; ++ try { ++ for (i = 0; i < form.length; i++) { ++ field = form[i]; ++ if (field.disabled) continue; ++ if (field.name == null || field.name == "") continue; ++ if (field.tagName == "INPUT") { ++ if (field.type.toUpperCase() == "FILE") { ++ for (j = 0; j < field.files.length; j++) { ++ size += field.files[j].size; ++ } ++ } else { ++ blob = new Blob([field.value], {type: 'text/plain'}); ++ size += blob.size; ++ } ++ } else if (field.tagName == "TEXTAREA") { ++ blob = new Blob([field.value], {type: 'text/plain'}); ++ size += blob.size; ++ } ++ } ++ } catch (e) { ++ if (window.console && console.log) { ++ console.log("Failed to calculate form size: " + e); ++ } ++ } ++ return size; ++} ++ ++ ++/* + * Checks the value of the email field as defined in component_job_details.tmpl + * I considered putting this in a separate script like the others + * (ie component_job_details.js) but it's so trivial it hardly seemed worth it. ++ * Also checks the combined size of the form fields to hopefully avoid people ++ * getting their large files reject with no explanation. + */ + function check_job_details(skip_email_check) { + "use strict"; +- var email; ++ var email, form_size; + if (!skip_email_check) { + email = $("email").value; + // allow the email field to be empty +- if (/^\s*$/.test(email)) return true; +- // if the field contains something then check that an @ is present +- if (email.indexOf("@") === -1) { +- alert("Please correct or remove the email used for recieving the job details.\n"); +- return false; ++ if (!/^\s*$/.test(email)) { ++ // if the field contains something then check that an @ is present ++ if (email.indexOf("@") === -1) { ++ alert("Please correct or remove the email used for recieving the job details.\n"); ++ return false; ++ } + } + } ++ form_size = calculate_form_size($("email").form) + 1024; ++ if (form_size > (1024 * 1024 * 80)) { ++ alert("The combined size of the form inputs exceeds 80MB and is too large to be accepted by the server.\n"); ++ return false; ++ } + return true; + }; + +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/data/MemeSuiteProperties.java +--- a/website/src/au/edu/uq/imb/memesuite/data/MemeSuiteProperties.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/data/MemeSuiteProperties.java Mon Jun 15 19:01:40 2015 +1000 +@@ -8,6 +8,7 @@ + import java.util.Properties; + import java.util.concurrent.TimeUnit; + import java.util.prefs.BackingStoreException; ++import java.util.regex.Matcher; + import java.util.regex.Pattern; + + /** +@@ -26,6 +27,8 @@ + private File dbDir; + private String sendmail; + private int jobExpiry; ++ private long quotaDuration; ++ private int quotaCount; + + public MemeSuiteProperties() throws BackingStoreException { + // load the properties file +@@ -119,6 +122,24 @@ + "entry \"serverDN\"."); + } + this.sendmail = config.getProperty("sendmail"); ++ String quota = config.getProperty("quota"); ++ quotaCount = 0; ++ quotaDuration = 0; ++ if (quota != null && !quota.matches("^\\s*$")) { ++ Pattern QUOTA_RE = Pattern.compile("^\\s*(\\d+)\\s*/\\s*(\\d+)\\s*$"); ++ try { ++ Matcher matcher = QUOTA_RE.matcher(quota); ++ if (!matcher.matches()) throw new NumberFormatException(); ++ quotaCount = Integer.parseInt(matcher.group(1), 10); ++ quotaDuration = Integer.parseInt(matcher.group(2), 10); ++ } catch (NumberFormatException e) { ++ throw new BackingStoreException("The quota must either " + ++ "be unlisted/empty (indicating no limit) or be 2 positive integers " + ++ "separated by a forward slash in the pattern COUNT/TIME. If " + ++ "listed it should be in the file \"MemeSuite.properties\" for the " + ++ "entry \"quota\"."); ++ } ++ } + } + + public String getVersion() { +@@ -187,4 +208,12 @@ + public long getExpiryDelay() { + return TimeUnit.DAYS.toMillis(jobExpiry); + } ++ ++ public int getQuotaCount() { ++ return quotaCount; ++ } ++ ++ public long getQuotaDuration() { ++ return quotaDuration; ++ } + } +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/db/SQL.java +--- a/website/src/au/edu/uq/imb/memesuite/db/SQL.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/db/SQL.java Mon Jun 15 19:01:40 2015 +1000 +@@ -154,6 +154,10 @@ + public static final String MARK_SEQUENCE_FILE = + "UPDATE tblSeqenceFile SET obsolete = ? WHERE id = ?"; + ++ public static final String MARK_GLOB_SEQUENCE_FILES = ++ "UPDATE tblSequenceFile SET obsolete = ? WHERE fileSeq GLOB ?"; ++ ++ + // COUNT things + public static final String COUNT_CATEGORIES = + "SELECT COUNT(*) FROM tblCategory"; +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/io/fasta/FastaHandler.java +--- a/website/src/au/edu/uq/imb/memesuite/io/fasta/FastaHandler.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/io/fasta/FastaHandler.java Mon Jun 15 19:01:40 2015 +1000 +@@ -1,6 +1,7 @@ + package au.edu.uq.imb.memesuite.io.fasta; + + import java.io.IOException; ++import java.math.BigDecimal; + + /** + * A set of callbacks to handle the parsing of a FASTA file. +@@ -50,13 +51,14 @@ + /** + * The FASTA parser will call this method when it has read a weight from a + * WEIGHTS line. ++ * + * @param value the value of the weight read. + * @throws FastaException when the handler can not accept this and wants the + * parsing stopped now. + * @throws IOException when an IO problem occurs, for example if the handler + * fails to write to a file it is recording the sequences in. + */ +- public void weight(double value) throws FastaException, IOException; ++ public void weight(BigDecimal value) throws FastaException, IOException; + + /** + * The FASTA parser will call this method when it has found the start of a +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/io/fasta/FastaParser.java +--- a/website/src/au/edu/uq/imb/memesuite/io/fasta/FastaParser.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/io/fasta/FastaParser.java Mon Jun 15 19:01:40 2015 +1000 +@@ -3,6 +3,7 @@ + import java.io.ByteArrayOutputStream; + import java.io.IOException; + import java.io.InputStream; ++import java.math.BigDecimal; + import java.nio.charset.Charset; + + import static au.edu.uq.imb.memesuite.io.fasta.FastaParseException.Reason.*; +@@ -342,17 +343,17 @@ + // look for the end of the number + if (isASCIISpace(buffer[i])) { + if (this.numberBuffer.size() > 0) { +- double weight = 1; ++ BigDecimal weight = BigDecimal.ONE; + if (this.numberBuffer.size() <= 20) { + try { +- weight = Double.valueOf(this.numberBuffer.toString("UTF-8")); +- if (weight <= 0 || weight > 1) { ++ weight = new BigDecimal(this.numberBuffer.toString("UTF-8")); ++ if (weight.compareTo(BigDecimal.ZERO) <= 0 || weight.compareTo(BigDecimal.ONE) > 0) { + if (!this.weightOutOfRange) { + FastaParser.this.out.error( + new FastaParseException(pos, line, column, WEIGHTS_OUT_OF_RANGE)); + this.weightOutOfRange = true; + } +- weight = 1; ++ weight = BigDecimal.ONE; + } + } catch (NumberFormatException e) { + if (!this.weightNaN) { +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/io/fasta/FastaWriter.java +--- a/website/src/au/edu/uq/imb/memesuite/io/fasta/FastaWriter.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/io/fasta/FastaWriter.java Mon Jun 15 19:01:40 2015 +1000 +@@ -4,9 +4,8 @@ + + import java.io.IOException; + import java.io.OutputStream; ++import java.math.BigDecimal; + import java.nio.charset.Charset; +-import java.text.DecimalFormat; +-import java.text.NumberFormat; + + public class FastaWriter implements FastaHandler { + private OutputStream out; +@@ -15,7 +14,6 @@ + private int idLen; + private int descLen; + private boolean keepWeights; +- private NumberFormat weightFormat; + // state information + private boolean firstLine; + private int outLineLen; +@@ -30,7 +28,6 @@ + this.descLen = 0; + this.keepWeights = true; + this.stats = new SequenceStats(); +- this.weightFormat = new DecimalFormat("#.###"); + } + + /** +@@ -90,10 +87,10 @@ + } + } + +- public void weight(double value) throws IOException { ++ public void weight(BigDecimal value) throws IOException { + if (this.keepWeights) { + this.out.write(' '); +- this.out.write(this.weightFormat.format(value).getBytes(utf8)); ++ this.out.write(value.toString().getBytes(utf8)); + } + } + +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/servlet/Ame.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Ame.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Ame.java Mon Jun 15 19:01:40 2015 +1000 +@@ -179,7 +179,7 @@ + background = new ComponentBfile(context, tmplMain.getSubtemplate("bfile")); + jobDetails = new ComponentJobDetails(cache); + advBtn = new ComponentAdvancedOptions(cache); +- submitReset = new ComponentSubmitReset(cache); ++ submitReset = new ComponentSubmitReset(cache, jobTable.getCount(), jobTable.getDuration()); + footer = new ComponentFooter(cache, msp); + } + +@@ -204,7 +204,7 @@ + } + + @Override +- protected void displayForm(HttpServletRequest request, HttpServletResponse response) throws IOException { ++ protected void displayForm(HttpServletRequest request, HttpServletResponse response, long quotaMinWait) throws IOException { + HTMLSub main = tmplMain.toSub(); + main.set("help", new HTMLSub[]{header.getHelp(), motifs.getHelp(), + sequences.getHelp(), jobDetails.getHelp(), advBtn.getHelp(), background.getHelp(), +@@ -216,7 +216,7 @@ + main.set("bfile", background.getComponent()); + main.set("job_details", jobDetails.getComponent()); + main.set("advanced_options", advBtn.getComponent()); +- main.set("submit_reset", submitReset.getComponent()); ++ main.set("submit_reset", submitReset.getComponent(quotaMinWait)); + main.set("footer", footer.getComponent()); + response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/servlet/Centrimo.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Centrimo.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Centrimo.java Mon Jun 15 19:01:40 2015 +1000 +@@ -201,7 +201,7 @@ + background = new ComponentBfile(context, tmplMain.getSubtemplate("bfile")); + jobDetails = new ComponentJobDetails(cache); + advBtn = new ComponentAdvancedOptions(cache); +- submitReset = new ComponentSubmitReset(cache); ++ submitReset = new ComponentSubmitReset(cache, jobTable.getCount(), jobTable.getDuration()); + footer = new ComponentFooter(cache, msp); + } + +@@ -226,7 +226,7 @@ + } + + @Override +- protected void displayForm(HttpServletRequest request, HttpServletResponse response) throws IOException { ++ protected void displayForm(HttpServletRequest request, HttpServletResponse response, long quotaMinWait) throws IOException { + HTMLSub main = tmplMain.toSub(); + main.set("help", new HTMLSub[]{header.getHelp(), motifs.getHelp(), + sequences.getHelp(), background.getHelp(), jobDetails.getHelp(), +@@ -238,7 +238,7 @@ + main.set("bfile", background.getComponent()); + main.set("job_details", jobDetails.getComponent()); + main.set("advanced_options", advBtn.getComponent()); +- main.set("submit_reset", submitReset.getComponent()); ++ main.set("submit_reset", submitReset.getComponent(quotaMinWait)); + main.set("footer", footer.getComponent()); + response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/servlet/ConfigurationLoader.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/ConfigurationLoader.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/ConfigurationLoader.java Mon Jun 15 19:01:40 2015 +1000 +@@ -31,11 +31,16 @@ + public static final String SEQUENCE_DB_KEY = "au.edu.uq.imb.memesuite.sequencedb"; + public static final String MOTIF_DB_KEY = "au.edu.uq.imb.memesuite.motifdb"; + public static final String GOMO_DB_KEY = "au.edu.uq.imb.memesuite.gomodb"; ++ public static final String JOB_TABLE_KEY = "au.edu.uq.imb.memesuite.jobs"; + + public ConfigurationLoader() { + delayedCleanup = new LinkedBlockingQueue(); + } + ++ private SubmitJob.TimeLimitedJobTable getJobTable(MemeSuiteProperties config) { ++ return new SubmitJob.TimeLimitedJobTable(config.getQuotaDuration(), config.getQuotaCount()); ++ } ++ + private SequenceDBList getSequenceDB(MemeSuiteProperties config) { + SequenceDBList sequenceDB = null; + File sequencesDir = new File(config.getDbDir(), "fasta_databases"); +@@ -86,6 +91,7 @@ + return; + } + context.setAttribute(CONFIG_KEY, config); ++ context.setAttribute(JOB_TABLE_KEY, getJobTable(config)); + context.setAttribute(SEQUENCE_DB_KEY, getSequenceDB(config)); + CsvWatcher watcher = new CsvWatcher(context, config); + watcher.run(); +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/servlet/Dreme.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Dreme.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Dreme.java Mon Jun 15 19:01:40 2015 +1000 +@@ -1,6 +1,5 @@ + package au.edu.uq.imb.memesuite.servlet; + +-import au.edu.uq.imb.memesuite.data.Alphabet; + import au.edu.uq.imb.memesuite.data.SequenceDataSource; + import au.edu.uq.imb.memesuite.servlet.util.*; + import au.edu.uq.imb.memesuite.template.HTMLSub; +@@ -105,7 +104,7 @@ + control = new ComponentSequences(context, tmplMain.getSubtemplate("control")); + jobDetails = new ComponentJobDetails(cache); + advancedOptions = new ComponentAdvancedOptions(cache); +- submitReset = new ComponentSubmitReset(cache); ++ submitReset = new ComponentSubmitReset(cache, jobTable.getCount(), jobTable.getDuration()); + footer = new ComponentFooter(cache, msp); + } + +@@ -130,7 +129,7 @@ + } + + @Override +- protected void displayForm(HttpServletRequest request, HttpServletResponse response) throws IOException { ++ protected void displayForm(HttpServletRequest request, HttpServletResponse response, long quotaMinWait) throws IOException { + HTMLSub main = this.tmplMain.toSub(); + main.set("help", new HTMLSub[]{header.getHelp(), sequences.getHelp(), + jobDetails.getHelp(), advancedOptions.getHelp(), submitReset.getHelp(), +@@ -140,7 +139,7 @@ + main.set("control", control.getComponent()); + main.set("job_details", jobDetails.getComponent()); + main.set("advanced_options", advancedOptions.getComponent()); +- main.set("submit_reset", submitReset.getComponent()); ++ main.set("submit_reset", submitReset.getComponent(quotaMinWait)); + main.set("footer", footer.getComponent()); + response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/servlet/Fimo.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Fimo.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Fimo.java Mon Jun 15 19:01:40 2015 +1000 +@@ -129,7 +129,7 @@ + sequences = new ComponentSequences(context, tmplMain.getSubtemplate("sequences")); + jobDetails = new ComponentJobDetails(cache); + advBtn = new ComponentAdvancedOptions(cache); +- submitReset = new ComponentSubmitReset(cache); ++ submitReset = new ComponentSubmitReset(cache, jobTable.getCount(), jobTable.getDuration()); + footer = new ComponentFooter(cache, msp); + } + +@@ -154,7 +154,7 @@ + } + + @Override +- protected void displayForm(HttpServletRequest request, HttpServletResponse response) throws IOException { ++ protected void displayForm(HttpServletRequest request, HttpServletResponse response, long quotaMinWait) throws IOException { + HTMLSub main = tmplMain.toSub(); + main.set("help", new HTMLSub[]{header.getHelp(), motifs.getHelp(), + sequences.getHelp(), jobDetails.getHelp(), advBtn.getHelp(), +@@ -164,7 +164,7 @@ + main.set("sequences", sequences.getComponent()); + main.set("job_details", jobDetails.getComponent()); + main.set("advanced_options", advBtn.getComponent()); +- main.set("submit_reset", submitReset.getComponent()); ++ main.set("submit_reset", submitReset.getComponent(quotaMinWait)); + main.set("footer", footer.getComponent()); + response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/servlet/Glam2.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Glam2.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Glam2.java Mon Jun 15 19:01:40 2015 +1000 +@@ -131,7 +131,7 @@ + sequences = new ComponentSequences(context, tmplMain.getSubtemplate("sequences")); + jobDetails = new ComponentJobDetails(cache); + advancedOptions = new ComponentAdvancedOptions(cache); +- submitReset = new ComponentSubmitReset(cache); ++ submitReset = new ComponentSubmitReset(cache, jobTable.getCount(), jobTable.getDuration()); + footer = new ComponentFooter(cache, msp); + } + +@@ -156,7 +156,7 @@ + } + + @Override +- protected void displayForm(HttpServletRequest request, HttpServletResponse response) throws IOException { ++ protected void displayForm(HttpServletRequest request, HttpServletResponse response, long quotaMinWait) throws IOException { + HTMLSub main = this.tmplMain.toSub(); + main.set("help", new HTMLSub[]{header.getHelp(), sequences.getHelp(), + jobDetails.getHelp(), advancedOptions.getHelp(), submitReset.getHelp(), +@@ -167,7 +167,7 @@ + request.getParameter("sequences_name"))); + main.set("job_details", jobDetails.getComponent()); + main.set("advanced_options", advancedOptions.getComponent()); +- main.set("submit_reset", submitReset.getComponent()); ++ main.set("submit_reset", submitReset.getComponent(quotaMinWait)); + main.set("footer", footer.getComponent()); + // set values from a GLAM2 rerun action + main.set("min_seqs", WebUtils.paramOptInteger(request, "min_seqs", 2, null, 2)); +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/servlet/Glam2scan.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Glam2scan.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Glam2scan.java Mon Jun 15 19:01:40 2015 +1000 +@@ -115,7 +115,7 @@ + sequences = new ComponentSequences(context, tmplMain.getSubtemplate("sequences")); + jobDetails = new ComponentJobDetails(cache); + advBtn = new ComponentAdvancedOptions(cache); +- submitReset = new ComponentSubmitReset(cache); ++ submitReset = new ComponentSubmitReset(cache, jobTable.getCount(), jobTable.getDuration()); + footer = new ComponentFooter(cache, msp); + } + +@@ -140,7 +140,7 @@ + } + + @Override +- protected void displayForm(HttpServletRequest request, HttpServletResponse response) throws IOException { ++ protected void displayForm(HttpServletRequest request, HttpServletResponse response, long quotaMinWait) throws IOException { + HTMLSub main = tmplMain.toSub(); + main.set("help", new HTMLSub[]{header.getHelp(), sequences.getHelp(), + jobDetails.getHelp(), advBtn.getHelp(), submitReset.getHelp(), +@@ -152,7 +152,7 @@ + main.set("sequences", sequences.getComponent()); + main.set("job_details", jobDetails.getComponent()); + main.set("advanced_options", advBtn.getComponent()); +- main.set("submit_reset", submitReset.getComponent()); ++ main.set("submit_reset", submitReset.getComponent(quotaMinWait)); + main.set("footer", footer.getComponent()); + response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/servlet/Gomo.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Gomo.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Gomo.java Mon Jun 15 19:01:40 2015 +1000 +@@ -130,7 +130,7 @@ + gomoSequences = new ComponentGomo(context, tmplMain.getSubtemplate("gomo_sequences")); + jobDetails = new ComponentJobDetails(cache); + advBtn = new ComponentAdvancedOptions(cache); +- submitReset = new ComponentSubmitReset(cache); ++ submitReset = new ComponentSubmitReset(cache, jobTable.getCount(), jobTable.getDuration()); + footer = new ComponentFooter(cache, msp); + } + +@@ -155,7 +155,7 @@ + } + + @Override +- protected void displayForm(HttpServletRequest request, HttpServletResponse response) throws IOException { ++ protected void displayForm(HttpServletRequest request, HttpServletResponse response, long quotaMinWait) throws IOException { + HTMLSub main = tmplMain.toSub(); + main.set("help", new HTMLSub[]{header.getHelp(), motifs.getHelp(), + gomoSequences.getHelp(), jobDetails.getHelp(), advBtn.getHelp(), +@@ -165,7 +165,7 @@ + main.set("gomo_sequences", gomoSequences.getComponent()); + main.set("job_details", jobDetails.getComponent()); + main.set("advanced_options", advBtn.getComponent()); +- main.set("submit_reset", submitReset.getComponent()); ++ main.set("submit_reset", submitReset.getComponent(quotaMinWait)); + main.set("footer", footer.getComponent()); + response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/servlet/Mast.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Mast.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Mast.java Mon Jun 15 19:01:40 2015 +1000 +@@ -154,7 +154,7 @@ + sequences = new ComponentSequences(context, tmplMain.getSubtemplate("sequences")); + jobDetails = new ComponentJobDetails(cache); + advBtn = new ComponentAdvancedOptions(cache); +- submitReset = new ComponentSubmitReset(cache); ++ submitReset = new ComponentSubmitReset(cache, jobTable.getCount(), jobTable.getDuration()); + footer = new ComponentFooter(cache, msp); + } + +@@ -179,7 +179,7 @@ + } + + @Override +- protected void displayForm(HttpServletRequest request, HttpServletResponse response) throws IOException { ++ protected void displayForm(HttpServletRequest request, HttpServletResponse response, long quotaMinWait) throws IOException { + HTMLSub main = tmplMain.toSub(); + main.set("help", new HTMLSub[]{header.getHelp(), motifs.getHelp(), + sequences.getHelp(), jobDetails.getHelp(), advBtn.getHelp(), +@@ -189,7 +189,7 @@ + main.set("sequences", sequences.getComponent()); + main.set("job_details", jobDetails.getComponent()); + main.set("advanced_options", advBtn.getComponent()); +- main.set("submit_reset", submitReset.getComponent()); ++ main.set("submit_reset", submitReset.getComponent(quotaMinWait)); + main.set("footer", footer.getComponent()); + response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/servlet/Mcast.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Mcast.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Mcast.java Mon Jun 15 19:01:40 2015 +1000 +@@ -1,6 +1,5 @@ + package au.edu.uq.imb.memesuite.servlet; + +-import au.edu.uq.imb.memesuite.data.Alphabet; + import au.edu.uq.imb.memesuite.data.MotifDataSource; + import au.edu.uq.imb.memesuite.data.SequenceDataSource; + import au.edu.uq.imb.memesuite.data.SequenceInfo; +@@ -141,7 +140,7 @@ + sequences = new ComponentSequences(context, tmplMain.getSubtemplate("sequences")); + jobDetails = new ComponentJobDetails(cache); + advBtn = new ComponentAdvancedOptions(cache); +- submitReset = new ComponentSubmitReset(cache); ++ submitReset = new ComponentSubmitReset(cache, jobTable.getCount(), jobTable.getDuration()); + footer = new ComponentFooter(cache, msp); + } + +@@ -166,7 +165,7 @@ + } + + @Override +- protected void displayForm(HttpServletRequest request, HttpServletResponse response) throws IOException { ++ protected void displayForm(HttpServletRequest request, HttpServletResponse response, long quotaMinWait) throws IOException { + HTMLSub main = tmplMain.toSub(); + main.set("help", new HTMLSub[]{header.getHelp(), motifs.getHelp(), + sequences.getHelp(), jobDetails.getHelp(), advBtn.getHelp(), +@@ -176,7 +175,7 @@ + main.set("sequences", sequences.getComponent()); + main.set("job_details", jobDetails.getComponent()); + main.set("advanced_options", advBtn.getComponent()); +- main.set("submit_reset", submitReset.getComponent()); ++ main.set("submit_reset", submitReset.getComponent(quotaMinWait)); + main.set("footer", footer.getComponent()); + response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/servlet/Meme.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Meme.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Meme.java Mon Jun 15 19:01:40 2015 +1000 +@@ -2,7 +2,6 @@ + + import au.edu.uq.imb.memesuite.data.Alphabet; + import au.edu.uq.imb.memesuite.data.Background; +-import au.edu.uq.imb.memesuite.data.NamedFileDataSource; + import au.edu.uq.imb.memesuite.data.SequenceDataSource; + import au.edu.uq.imb.memesuite.servlet.util.*; + import au.edu.uq.imb.memesuite.template.HTMLSub; +@@ -131,7 +130,7 @@ + background = new ComponentBfile(context, tmplMain.getSubtemplate("bfile")); + jobDetails = new ComponentJobDetails(cache); + advancedOptions = new ComponentAdvancedOptions(cache); +- submitReset = new ComponentSubmitReset(cache); ++ submitReset = new ComponentSubmitReset(cache, jobTable.getCount(), jobTable.getDuration()); + footer = new ComponentFooter(cache, msp); + } + +@@ -156,7 +155,7 @@ + } + + @Override +- protected void displayForm(HttpServletRequest request, HttpServletResponse response) throws IOException { ++ protected void displayForm(HttpServletRequest request, HttpServletResponse response, long quotaMinWait) throws IOException { + HTMLSub main = this.tmplMain.toSub(); + main.set("help", new HTMLSub[]{header.getHelp(), sequences.getHelp(), + background.getHelp(), jobDetails.getHelp(), advancedOptions.getHelp(), +@@ -167,7 +166,7 @@ + main.set("bfile", background.getComponent()); + main.set("job_details", jobDetails.getComponent()); + main.set("advanced_options", advancedOptions.getComponent()); +- main.set("submit_reset", submitReset.getComponent()); ++ main.set("submit_reset", submitReset.getComponent(quotaMinWait)); + main.set("footer", footer.getComponent()); + response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/servlet/Memechip.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Memechip.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Memechip.java Mon Jun 15 19:01:40 2015 +1000 +@@ -202,7 +202,7 @@ + memeOpts = new ComponentAdvancedOptions(cache, tmplMain.getSubtemplate("meme_opts")); + dremeOpts = new ComponentAdvancedOptions(cache, tmplMain.getSubtemplate("dreme_opts")); + centrimoOpts = new ComponentAdvancedOptions(cache, tmplMain.getSubtemplate("centrimo_opts")); +- submitReset = new ComponentSubmitReset(cache); ++ submitReset = new ComponentSubmitReset(cache, jobTable.getCount(), jobTable.getDuration()); + footer = new ComponentFooter(cache, msp); + } + +@@ -227,7 +227,7 @@ + } + + @Override +- protected void displayForm(HttpServletRequest request, HttpServletResponse response) throws IOException { ++ protected void displayForm(HttpServletRequest request, HttpServletResponse response, long quotaMinWait) throws IOException { + HTMLSub main = tmplMain.toSub(); + main.set("help", new HTMLSub[]{header.getHelp(), motifs.getHelp(), + sequences.getHelp(), background.getHelp(), jobDetails.getHelp(), +@@ -241,7 +241,7 @@ + main.set("meme_opts", memeOpts.getComponent()); + main.set("dreme_opts", dremeOpts.getComponent()); + main.set("centrimo_opts", centrimoOpts.getComponent()); +- main.set("submit_reset", submitReset.getComponent()); ++ main.set("submit_reset", submitReset.getComponent(quotaMinWait)); + main.set("footer", footer.getComponent()); + response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/servlet/Spamo.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Spamo.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Spamo.java Mon Jun 15 19:01:40 2015 +1000 +@@ -147,7 +147,7 @@ + secondaries = new ComponentMotifs(context, tmplMain.getSubtemplate("secondaries")); + jobDetails = new ComponentJobDetails(cache); + advBtn = new ComponentAdvancedOptions(cache); +- submitReset = new ComponentSubmitReset(cache); ++ submitReset = new ComponentSubmitReset(cache, jobTable.getCount(), jobTable.getDuration()); + footer = new ComponentFooter(cache, msp); + } + +@@ -172,7 +172,7 @@ + } + + @Override +- protected void displayForm(HttpServletRequest request, HttpServletResponse response) throws IOException { ++ protected void displayForm(HttpServletRequest request, HttpServletResponse response, long quotaMinWait) throws IOException { + HTMLSub main = tmplMain.toSub(); + main.set("help", new HTMLSub[]{header.getHelp(), primary.getHelp(), + sequences.getHelp(), jobDetails.getHelp(), advBtn.getHelp(), +@@ -183,7 +183,7 @@ + main.set("secondaries", secondaries.getComponent()); + main.set("job_details", jobDetails.getComponent()); + main.set("advanced_options", advBtn.getComponent()); +- main.set("submit_reset", submitReset.getComponent()); ++ main.set("submit_reset", submitReset.getComponent(quotaMinWait)); + main.set("footer", footer.getComponent()); + response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/servlet/SubmitJob.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/SubmitJob.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/SubmitJob.java Mon Jun 15 19:01:40 2015 +1000 +@@ -2,6 +2,8 @@ + + import java.io.*; + import java.nio.CharBuffer; ++import java.rmi.RemoteException; ++import java.text.SimpleDateFormat; + import java.util.*; + import java.util.concurrent.TimeUnit; + import java.util.regex.*; +@@ -24,14 +26,13 @@ + import au.edu.uq.imb.memesuite.servlet.util.FeedbackHandler; + import au.edu.uq.imb.memesuite.servlet.util.WebUtils; + import au.edu.uq.imb.memesuite.util.JsonWr; +-import edu.sdsc.nbcr.opal.AppServicePortType; +-import edu.sdsc.nbcr.opal.InputFileType; +-import edu.sdsc.nbcr.opal.JobInputType; +-import edu.sdsc.nbcr.opal.JobSubOutputType; ++import edu.sdsc.nbcr.opal.*; + import org.apache.commons.io.IOUtils; ++import org.globus.gram.GramJob; + + import static au.edu.uq.imb.memesuite.servlet.ConfigurationLoader.CONFIG_KEY; + import static au.edu.uq.imb.memesuite.servlet.ConfigurationLoader.CACHE_KEY; ++import static au.edu.uq.imb.memesuite.servlet.ConfigurationLoader.JOB_TABLE_KEY; + + public abstract class SubmitJob extends HttpServlet { + private String serviceName; +@@ -40,8 +41,10 @@ + private HTMLTemplate tmplVerify; + private HTMLTemplate tmplEmail; + private AppServicePortType appServicePort; ++ private OpalTrackerFactory jobFactory; + protected MemeSuiteProperties msp; + protected HTMLTemplateCache cache; ++ protected TimeLimitedJobTable jobTable; + protected ServletContext context; + + public abstract class JobData implements JsonWr.JsonValue { +@@ -103,14 +106,16 @@ + msp = (MemeSuiteProperties)context.getAttribute(CONFIG_KEY); + if (msp == null) throw new ServletException("Failed to get MEME Suite properties"); + cache = (HTMLTemplateCache)context.getAttribute(CACHE_KEY); ++ jobTable = (TimeLimitedJobTable)context.getAttribute(JOB_TABLE_KEY); + this.tmplWhine = cache.loadAndCache("/WEB-INF/templates/whine.tmpl"); + this.tmplVerify = cache.loadAndCache("/WEB-INF/templates/verify.tmpl"); + this.tmplEmail = cache.loadAndCache("/WEB-INF/templates/email.tmpl"); + appServicePort = WebUtils.getOpal(msp, serviceName); ++ jobFactory = new OpalTrackerFactory(appServicePort); + } + + protected abstract void displayForm(HttpServletRequest request, +- HttpServletResponse response) throws IOException; ++ HttpServletResponse response, long quotaMinWait) throws IOException; + protected abstract E checkParameters(FeedbackHandler feedback, + HttpServletRequest request) throws IOException, ServletException; + public abstract String title(); +@@ -611,8 +616,19 @@ + return email; + } + ++ protected String loggableDate(Date timestamp) { ++ if (timestamp == null) timestamp = new Date(); ++ // This date format must match the date format specified ++ // in the Perl implementation MemeWebUtils::loggable_date() ++ SimpleDateFormat dateFormat = new SimpleDateFormat("dd/MM/yy HH:mm:ss"); ++ dateFormat.setTimeZone(TimeZone.getTimeZone("GMT")); ++ return dateFormat.format(timestamp); ++ } ++ + protected void submitOpalJob(UUID userId, E data, HttpServletResponse response) +- throws ServletException, IOException { ++ throws ServletException, IOException, QuotaException { ++ // test if we can submit a job ++ OpalTracker tracker = (OpalTracker)jobTable.addJob(userId.toString(), jobFactory); + // store user ID + storeUniqueId(userId, response); + // launch job +@@ -622,7 +638,7 @@ + //this line gives a warning and I have no idea why! + @SuppressWarnings("unchecked") + List sources = data.files(); +- int fileCount = sources.size() + (data.description() != null ? 1 : 0) + 1; ++ int fileCount = sources.size() + (data.description() != null ? 1 : 0) + 2; + InputFileType[] files = new InputFileType[fileCount]; + { + int i; +@@ -649,6 +665,12 @@ + InputFileType file = new InputFileType(); + file.setContents(userId.toString().getBytes("UTF-8")); + file.setName("uuid"); ++ files[i++] = file; ++ } ++ { ++ InputFileType file = new InputFileType(); ++ file.setContents(loggableDate(new Date()).getBytes("UTF-8")); ++ file.setName("submit_time_file"); + files[i] = file; + } + } +@@ -656,6 +678,7 @@ + + // set up a non-blocking call + JobSubOutputType subOut = this.appServicePort.launchJob(in); ++ tracker.setJobId(subOut.getJobID()); + + response.setContentType("text/html; charset=UTF-8"); + HTMLSub verify = this.tmplVerify.toSub(); +@@ -687,7 +710,7 @@ + } + } + +- protected UUID requestUniqueId(HttpServletRequest request) { ++ protected UUID getUniqueId(HttpServletRequest request) { + UUID uuid = null; + Cookie[] cookies = request.getCookies(); + if (cookies != null) { // returns null when no cookies (really stupid design in my opinion) +@@ -701,10 +724,20 @@ + } + } + } ++ return uuid; ++ } ++ ++ protected UUID requestUniqueId(HttpServletRequest request) { ++ UUID uuid = getUniqueId(request); + if (uuid == null) uuid = UUID.randomUUID(); + return uuid; + } + ++ protected long getMinWait(HttpServletRequest request) { ++ UUID uuid = getUniqueId(request); ++ return (uuid == null ? 0 : jobTable.attemptMakeSpace(uuid.toString())); ++ } ++ + protected void storeUniqueId(UUID uuid, HttpServletResponse response) { + // update the cookie information + Cookie cookie = new Cookie("meme_uuid", uuid.toString()); +@@ -716,7 +749,11 @@ + @Override + public void doGet(HttpServletRequest request, HttpServletResponse response) + throws IOException, ServletException { +- this.displayForm(request, response); ++ if (request.getParameter("wait") != null) { ++ this.outputMinWait(request, response); ++ } else { ++ this.displayForm(request, response, getMinWait(request)); ++ } + } + + @Override +@@ -732,11 +769,35 @@ + } else { + feedback.displayErrors(response); + } ++ } catch (QuotaException e) { ++ feedback.whine("Maximum job submission quota reached. " + ++ "On this server you may only submit " + jobTable.getCount() + ++ " jobs every " + jobTable.getDuration() + " seconds. " + ++ "You may submit a new job in " + e.getTimeout() + " seconds."); ++ feedback.displayErrors(response); + } finally { + data.cleanUp(); + } + } else { +- this.displayForm(request, response); ++ this.displayForm(request, response, getMinWait(request)); ++ } ++ } ++ ++ public void outputMinWait(HttpServletRequest request, HttpServletResponse response) throws IOException{ ++ byte[] message = Long.toString(getMinWait(request)).getBytes("UTF-8"); ++ response.setContentType("text/plain; charset=UTF-8"); ++ response.setHeader("Content-Length", Integer.toString(message.length)); ++ ServletOutputStream output = null; ++ try { ++ output = response.getOutputStream(); ++ output.write(message); ++ output.close(); output = null; ++ } finally { ++ if (output != null) { ++ try { ++ output.close(); ++ } catch (IOException e) { /* ignore */ } ++ } + } + } + +@@ -763,5 +824,285 @@ + response.getWriter()); + } + } ++ ++ /** ++ * Factory class for constructing OpalTracker objects. ++ */ ++ public static class OpalTrackerFactory implements TrackerFactory { ++ protected final AppServicePortType app; ++ public OpalTrackerFactory(AppServicePortType app) { ++ this.app = app; ++ } ++ @Override ++ public Tracker constructTracker() { ++ return new OpalTracker(app); ++ } ++ } ++ ++ /** ++ * Keeps track of Opal jobs. ++ */ ++ public static class OpalTracker extends Tracker { ++ protected final AppServicePortType app; ++ protected String jobId = null; ++ ++ /** ++ * Constructs an Opal job tracker ++ * @param app the application running the job. ++ */ ++ public OpalTracker(AppServicePortType app) { ++ this.app = app; ++ } ++ ++ /** ++ * Stores the Opal job ID in the tracker so it can do a status lookup. ++ * @param jobId the Opal job ID. ++ */ ++ public synchronized void setJobId(String jobId) { ++ this.jobId = jobId; ++ } ++ ++ @Override ++ public synchronized boolean isFinished() { ++ if (finished) return true; ++ if (jobId != null && app != null) { ++ try { ++ StatusOutputType status = app.queryStatus(jobId); ++ if (status != null) { ++ switch (status.getCode()) { ++ case GramJob.STATUS_UNSUBMITTED: ++ case GramJob.STATUS_PENDING: ++ case GramJob.STATUS_STAGE_IN: ++ case GramJob.STATUS_ACTIVE: ++ case GramJob.STATUS_STAGE_OUT: ++ case GramJob.STATUS_SUSPENDED: ++ return false; ++ case GramJob.STATUS_FAILED: ++ case GramJob.STATUS_DONE: ++ finished = true; ++ return true; ++ } ++ } ++ } catch (RemoteException e) { /* ignore */ } ++ } ++ return false; ++ } ++ } ++ ++ /** ++ * Tracks information about a job to tell if it has finished or not. ++ */ ++ public static class Tracker { ++ // the start time of the job ++ protected final Date time; ++ // the status of the job ++ protected boolean finished; ++ ++ /** ++ * Create a new job tracker ++ */ ++ public Tracker() { ++ time = new Date(); ++ finished = false; ++ } ++ ++ /** ++ * Check if the contained date is after the given date. ++ * @param other the date to compare with. ++ * @return true if the contained date is after the given date. ++ */ ++ public boolean after(Date other) { ++ return time.after(other); ++ } ++ ++ /** ++ * Get the timestamp in milliseconds since the epoch of midnight, Jan 1 1970, UTC. ++ * @return the timestamp. ++ */ ++ public long getTimeMillis() { ++ return time.getTime(); ++ } ++ ++ /** ++ * Check if the job is truly finished. ++ * This method will only be called if, after checking for expiry, the job table is full. ++ * Subclasses will probably want to override this method. ++ * @return true if the job is known to be finished. ++ */ ++ public synchronized boolean isFinished() { ++ return finished; ++ } ++ ++ /** ++ * Sets the job state to finished ++ */ ++ public synchronized void setFinished() { ++ finished = true; ++ } ++ } ++ ++ /** ++ * Factory for constructing non-standard job objects. ++ */ ++ public static interface TrackerFactory { ++ /** ++ * Construct a job object. ++ * @return the constructed job object. ++ */ ++ public Tracker constructTracker(); ++ } ++ ++ /** ++ * This class tracks the number of jobs submitted from a ID. ++ * If the number of jobs from the ID reaches the count parameter ++ * no more jobs be added. Jobs that are older then the duration ++ * parameter (in seconds) are deleted from the record for the ID. ++ * When all the jobs for an ID have deleted, the record for that ID ++ * will be deleted. ++ */ ++ public static class TimeLimitedJobTable { ++ private Date lastFlush; // last time all job records were flushed ++ private Map> jobTable; ++ private long duration; // In seconds ++ private int count; // number of jobs per user ++ private int tests; // maximum number of jobs to test for finished status ++ ++ public TimeLimitedJobTable(long duration, int count) { ++ this.lastFlush = new Date(); ++ this.jobTable = new LinkedHashMap>(); ++ this.duration = duration; ++ this.count = count; ++ this.tests = this.count; ++ } ++ ++ /** ++ * The time that the jobs are tracked for. ++ * @return time to track jobs in seconds. ++ */ ++ public long getDuration() { ++ return duration; ++ } ++ ++ /** ++ * The maximum number of jobs to allow in the duration. ++ * @return maximum job submissions allowed in the tracking time. ++ */ ++ public int getCount() { ++ return count; ++ } ++ ++ /** ++ * Add a job to the job table unless the user has too many jobs in the time interval. ++ * Old jobs related to the user will be flushed. ++ * @param userID a unique user identifier. ++ * @param factory a method to generate a tracker. ++ * @return the tracker. ++ * @throws QuotaException when the user has already submitted too many jobs. ++ */ ++ public synchronized Tracker addJob(String userID, TrackerFactory factory) throws QuotaException { ++ // if we don't have any limits then just return a new job object ++ if (duration <= 0 || count <= 0) return (factory == null ? new Tracker() : factory.constructTracker()); ++ // flush all expired jobs every hour ++ if ((System.currentTimeMillis() - lastFlush.getTime()) >= TimeUnit.HOURS.toMillis(1)) flushOldJobs(); ++ // try to clear space for new jobs ++ long timeRemaining = attemptMakeSpace(userID); ++ // get the jobs for the user ++ List trackers = jobTable.get(userID); ++ if (trackers == null) { ++ trackers = new ArrayList(count); ++ jobTable.put(userID, trackers); ++ } ++ // if possible create a new job ++ if (trackers.size() < count) { ++ Tracker tracker = (factory == null ? new Tracker() : factory.constructTracker()); ++ trackers.add(tracker); ++ return tracker; ++ } ++ throw new QuotaException(timeRemaining); ++ } ++ ++ /** ++ * Add a job to the job table unless the user has too many jobs in the time interval. ++ * Old jobs related to the user will be flushed. ++ * @param userID a unique user identifier ++ * @return the tracker if accepted or null if rejected. ++ */ ++ public synchronized Tracker addJob(String userID) throws QuotaException { ++ return addJob(userID, null); ++ } ++ ++ /** ++ * Removes any job entries related to the userID that are expired. ++ * If the users' job quota is still full then try to find a job that has finished. ++ * @param userID a unique user identifier. ++ * @return time until space available. ++ */ ++ public synchronized long attemptMakeSpace(String userID) { ++ List trackers = jobTable.get(userID); ++ if (trackers != null) { ++ int i; ++ // calculate a date that has just expired ++ Date expiredDate = new Date(System.currentTimeMillis() - TimeUnit.SECONDS.toMillis(duration)); ++ // Loop over all jobs for the user ID stopping at the first that hasn't expired ++ for (i = 0; i < trackers.size(); i++) if (trackers.get(i).after(expiredDate)) break; ++ if (i != 0) { ++ // Remove all the expired jobs from the list ++ trackers.subList(0, i).clear(); ++ } else if (trackers.size() >= count) { ++ // we want to clear at least one space so test jobs ++ // to see if they qualify for early removal ++ for (i = 0; i < Math.min(tests, trackers.size()); i++) { ++ if (trackers.get(i).isFinished()) { ++ // after finding one job then remove it and exit loop ++ trackers.remove(i); ++ break; ++ } ++ } ++ } ++ if (trackers.isEmpty()) { ++ // When no jobs for user ID drop this user ID from the table ++ jobTable.remove(userID); ++ } else if (trackers.size() >= count) { ++ // when table full return the time left until it is not full ++ return TimeUnit.MILLISECONDS.toSeconds( ++ trackers.get(0).getTimeMillis() - expiredDate.getTime()) + 1; ++ } ++ } ++ return 0; ++ } ++ ++ /** ++ * Removes all job entries that are expired. ++ */ ++ public synchronized void flushOldJobs() { ++ // update the flush time ++ lastFlush = new Date(); ++ // calculate a date that has just expired ++ Date expiredDate = new Date(lastFlush.getTime() - TimeUnit.SECONDS.toMillis(duration)); ++ // Loop over jobs per all known user IDs ++ Iterator> iter = jobTable.values().iterator(); ++ while (iter.hasNext()) { ++ int i; ++ List trackers = iter.next(); ++ // Loop over all jobs for the user ID stopping at the first that hasn't expired ++ for (i = 0; i < trackers.size(); i++) if (trackers.get(i).after(expiredDate)) break; ++ // Remove all the expired jobs from the list ++ trackers.subList(0, i).clear(); ++ // When no jobs for user ID drop this user ID from the table ++ if (trackers.isEmpty()) iter.remove(); ++ } ++ } ++ } ++ ++ public static class QuotaException extends Exception { ++ protected long timeout; ++ public QuotaException(long timeout) { ++ super("Job submission quota reached! Oldest job will expire in " + timeout + " seconds."); ++ this.timeout = timeout; ++ } ++ public long getTimeout() { ++ return timeout; ++ } ++ } + } + +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/servlet/Tomtom.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/Tomtom.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/Tomtom.java Mon Jun 15 19:01:40 2015 +1000 +@@ -169,7 +169,7 @@ + target = new ComponentMotifs(context, tmplMain.getSubtemplate("target_motifs")); + jobDetails = new ComponentJobDetails(cache); + advBtn = new ComponentAdvancedOptions(cache); +- submitReset = new ComponentSubmitReset(cache); ++ submitReset = new ComponentSubmitReset(cache, jobTable.getCount(), jobTable.getDuration()); + footer = new ComponentFooter(cache, msp); + } + +@@ -194,7 +194,7 @@ + } + + @Override +- protected void displayForm(HttpServletRequest request, HttpServletResponse response) throws IOException { ++ protected void displayForm(HttpServletRequest request, HttpServletResponse response, long quotaMinWait) throws IOException { + HTMLSub main = tmplMain.toSub(); + main.set("help", new HTMLSub[]{header.getHelp(), query.getHelp(), + jobDetails.getHelp(), advBtn.getHelp(), +@@ -204,7 +204,7 @@ + main.set("target_motifs", target.getComponent()); + main.set("job_details", jobDetails.getComponent()); + main.set("advanced_options", advBtn.getComponent()); +- main.set("submit_reset", submitReset.getComponent()); ++ main.set("submit_reset", submitReset.getComponent(quotaMinWait)); + main.set("footer", footer.getComponent()); + response.setContentType("text/html; charset=UTF-8"); + main.output(response.getWriter()); +@@ -307,10 +307,12 @@ + + @Override + protected void submitOpalJob(UUID uuid, Data data, HttpServletResponse response) +- throws ServletException, IOException { ++ throws ServletException, IOException, QuotaException { + if (!data.immediateRun) { + super.submitOpalJob(uuid, data, response); + } else { ++ // test the job quota ++ Tracker tracker = jobTable.addJob(uuid.toString()); + // skip sending to opal, just run tomtom_webservice and redirect + File resultDir = null; + try { +@@ -319,6 +321,7 @@ + for (DataSource source : data.files()) storeSource(resultDir, source); + if (data.description != null) storeString(resultDir, "description", data.description()); + storeString(resultDir, "uuid", uuid.toString()); ++ storeString(resultDir, "submit_time_file", loggableDate(new Date())); + // run the script + List tomtom_args = data.args(); + tomtom_args.add(0, new File(msp.getBinDir(), "tomtom_webservice").toString()); +@@ -378,6 +381,7 @@ + closeQuietly(input); + } + } finally { ++ tracker.setFinished(); + if (resultDir != null) FileUtils.deleteDirectory(resultDir); + } + } +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/servlet/util/ComponentSubmitReset.java +--- a/website/src/au/edu/uq/imb/memesuite/servlet/util/ComponentSubmitReset.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/servlet/util/ComponentSubmitReset.java Mon Jun 15 19:01:40 2015 +1000 +@@ -13,17 +13,28 @@ + private HTMLTemplate tmplSubmitReset; + private String submitTitle; + private String resetTitle; ++ private int quotaCount; ++ private long quotaDuration; + +- public ComponentSubmitReset(HTMLTemplateCache cache) throws ServletException { ++ public ComponentSubmitReset(HTMLTemplateCache cache, int quotaCount, long quotaDuration) throws ServletException { + tmplSubmitReset = cache.loadAndCache("/WEB-INF/templates/component_submit_reset.tmpl"); + submitTitle = "Start Search"; + resetTitle = "Clear Input"; ++ this.quotaCount = quotaCount; ++ this.quotaDuration = quotaDuration; + } + + public HTMLSub getComponent() { ++ return getComponent(0); ++ } ++ ++ public HTMLSub getComponent(long quotaMinWait) { + HTMLSub sub = tmplSubmitReset.getSubtemplate("component").toSub(); + sub.set("submit_title", submitTitle); + sub.set("reset_title", resetTitle); ++ sub.set("submit_wait", quotaMinWait); ++ sub.set("quota_count", quotaCount); ++ sub.set("quota_duration", quotaDuration); + return sub; + } + +diff -r cd5970c6318f -r eb3670af8100 website/src/au/edu/uq/imb/memesuite/updatedb/UpdateSequenceDB.java +--- a/website/src/au/edu/uq/imb/memesuite/updatedb/UpdateSequenceDB.java Mon May 25 18:19:58 2015 +1000 ++++ b/website/src/au/edu/uq/imb/memesuite/updatedb/UpdateSequenceDB.java Mon Jun 15 19:01:40 2015 +1000 +@@ -509,13 +509,36 @@ + logger.log(Level.INFO, "Finished update of sequence databases in " + dbDir); + } + ++ public static void markFilesObsolete(SQLiteDataSource ds, String globFileNames) { ++ Connection conn = null; ++ try { ++ conn = ds.getConnection(); ++ PreparedStatement pstmt; ++ pstmt = conn.prepareStatement(SQL.MARK_GLOB_SEQUENCE_FILES); ++ pstmt.setInt(1, 1); ++ pstmt.setString(2, globFileNames); ++ int count = pstmt.executeUpdate(); ++ pstmt.close(); ++ conn.close(); conn = null; ++ logger.log(Level.INFO, "Marked obsolete " + count + " sequence files matching glob: " + globFileNames); ++ } catch (SQLException e) { ++ logger.log(Level.SEVERE, "Failed to mark obsolete sequence files matching glob: " + globFileNames, e); ++ } finally { ++ if (conn != null) { ++ try { ++ conn.close(); ++ } catch (SQLException e) {/* ignore */} ++ } ++ ++ } ++ } ++ + /** + * Removes all sequences marked as obsolete. + * @param ds the database data source. + * @param dbDir the directory containing the fasta files. +- * @param status the status display manager. + */ +- public static void removeObsolete(SQLiteDataSource ds, File dbDir, MultiSourceStatus status) { ++ public static void removeObsolete(SQLiteDataSource ds, File dbDir) { + Connection conn = null; + try { + conn = ds.getConnection(); +@@ -525,8 +548,8 @@ + pstmt = conn.prepareStatement(SQL.SELECT_ALL_OBSOLETE_SEQUENCE_FILES); + rset = pstmt.executeQuery(); + while (rset.next()) { +- String seqFileName = rset.getString(2); +- String bgFileName = rset.getString(3); ++ String seqFileName = rset.getString(1); ++ String bgFileName = rset.getString(2); + File seqFile = new File(dbDir, seqFileName); + File bgFile = new File(dbDir, bgFileName); + logger.log(Level.FINE, "Removing obsolete sequence file " + seqFile); +@@ -954,6 +977,12 @@ + .setHelp("Specify the classname of a custom updater [experimental].") + ); + parameters.add( ++ new FlaggedOption("obsolete") ++ .setLongFlag("obsolete") ++ .setAllowMultipleDeclarations(true) ++ .setHelp("Mark all sequence databases matching the GLOB pattern file name(s) as obsolete and exit.") ++ ); ++ parameters.add( + new Switch("remove_obsolete") + .setLongFlag("delete_old").setShortFlag('d') + .setHelp("Sequence databases marked as obsolete (on a previous update) will be deleted.") +@@ -1000,8 +1029,6 @@ + if (jsap.messagePrinted()) { + System.exit(1); + } +- // should missing files be removed from the database or only warned about (default remove) +- boolean retainMissing = config.getBoolean("retain_missing", false); + + // See if any specified updaters are given. + Boolean specified_only = false; +@@ -1064,19 +1091,28 @@ + try { + // load the database + SQLiteDataSource ds = getInitialisedDatabase(dbDir); +- // purge missing databases +- purge(ds, binDir, dbDir, retainMissing, status); +- // remove obsolete databases +- if (config.getBoolean("remove_obsolete")) { +- removeObsolete(ds, dbDir, status); +- } +- // run the selected updaters +- update(ds, binDir, dbDir, updaters, status); +- // create the optional backwards compatibility views +- if (config.getBoolean("csv_dir")) { +- File csv_dir = config.getFile("csv_dir", dbDir); +- generateCSV(ds, new File(csv_dir, "fasta_db.csv"), status); +- generateCSVIndex(ds, new File(csv_dir, "fasta_db.index"), status); ++ // are we marking obsolete databases? ++ String[] obsoleteGlobs = config.getStringArray("obsolete"); ++ if (obsoleteGlobs != null && obsoleteGlobs.length > 0) { ++ Progress progress = new Progress(status, "Marking files obsolete"); ++ for (String obsoleteGlob : obsoleteGlobs) { ++ progress.setTask("GLOB " + obsoleteGlob); ++ markFilesObsolete(ds, obsoleteGlob); ++ } ++ progress.complete(); ++ } else { ++ // purge missing databases ++ purge(ds, binDir, dbDir, config.getBoolean("retain_missing", false), status); ++ // remove obsolete databases ++ if (config.getBoolean("remove_obsolete")) removeObsolete(ds, dbDir); ++ // run the selected updaters ++ update(ds, binDir, dbDir, updaters, status); ++ // create the optional backwards compatibility views ++ if (config.getBoolean("csv_dir")) { ++ File csv_dir = config.getFile("csv_dir", dbDir); ++ generateCSV(ds, new File(csv_dir, "fasta_db.csv"), status); ++ generateCSVIndex(ds, new File(csv_dir, "fasta_db.index"), status); ++ } + } + status.addStatusSource("Done").done(); + } finally { +diff -r cd5970c6318f -r eb3670af8100 website/templates/component_submit_reset.tmpl +--- a/website/templates/component_submit_reset.tmpl Mon May 25 18:19:58 2015 +1000 ++++ b/website/templates/component_submit_reset.tmpl Mon Jun 15 19:01:40 2015 +1000 +@@ -17,13 +17,124 @@ + +
    + ++

    Warning: ++ Your maximum job quota has been reached! You will need to wait until ++ one of your jobs completes or 1 second has ++ elapsed before submitting another job.
    ++
    ++ This server has the job quota set to 10 unfinished jobs ++ every 1 hour.

    +

    Note: if the combined form inputs exceed 80MB the job will be rejected.

    + +
    +- ++ +     + +
    ++ + +
    + diff --git a/tools/meme-suite/sources/patch_4.11.2_1 b/tools/meme-suite/sources/patch_4.11.2_1 new file mode 100644 index 0000000000000000000000000000000000000000..62fb3e2e8e7982ac0380c22221940401b6f32867 --- /dev/null +++ b/tools/meme-suite/sources/patch_4.11.2_1 @@ -0,0 +1,401 @@ +diff -r 2aada1579554 doc/alphabet-format.html +--- doc/alphabet-format.html ++++ doc/alphabet-format.html +@@ -233,7 +233,7 @@ + providing a reference on the meaning of the symbols used. If present, the + symbol name must be the second field.

    +

    The "name" follows the rules of +- quoted text.

    ++ quoted text.

    +
    +
    color
    +
    +diff -r 2aada1579554 doc/release-notes.html +--- doc/release-notes.html ++++ doc/release-notes.html +@@ -14,8 +14,26 @@ +

    Motif-based sequence analysis tools

    +
    +

    MEME Suite Release Notes

    ++
    ++ MEME version 4.11.2 patch 1 -- June 16, 2016 ++
      ++
    • ++ Bug fixes ++
        ++
      • ++ Fixed bug in MCAST 4.11.2 that caused it to prematurely truncate ++ reading the sequence file. ++
      • ++
      • ++ Modified MEME to fall back to a simple Dirichlet prior when ++ using DNA or a custom alphabet with a prior that requires ++ a prior library, but no prior libray is specified. ++
      • ++
      ++
    ++

    +


    +-

    + MEME version 4.11.2 -- May 5 2016 +

    +
      +diff -r 2aada1579554 src/fasta-io.c +--- src/fasta-io.c ++++ src/fasta-io.c +@@ -14,6 +14,7 @@ + #include "alphabet.h" + #include "fasta-io.h" + #include "io.h" ++#include "seq-reader-from-fasta.h" + #include "prior-reader-from-psp.h" + #include "seq.h" + +@@ -159,61 +160,6 @@ + } + + /**************************************************************************** +- * Read raw sequence until a new sequence is encountered or too many letters +- * are read. The new sequence is appended to the end of the given +- * sequence. +- * +- * Return: Was the sequence read completely? +- ****************************************************************************/ +-static BOOLEAN_T read_raw_sequence_from_reader( +- DATA_BLOCK_READER_T *fasta_reader, // Sequence source +- char* name, // Sequence ID (used in error messages). +- ALPH_T* alph, // Alphabet in use +- unsigned int offset, // Current position in raw_sequence. +- unsigned int max_chars, // Maximum chars in raw_sequence. +- char* raw_sequence // Pre-allocated sequence. +-) { +- // tlb; change a_char to integer so it will compile on SGI +- int a_char; +- int start_update; +- BOOLEAN_T return_value = TRUE; +- +- // Start at the end of the given sequence. +- assert(offset < max_chars); +- +- DATA_BLOCK_T *seq_block = new_sequence_block(max_chars - offset); +- return_value = !fasta_reader->get_next_block(fasta_reader, seq_block); +- +- char *seq_buffer = get_sequence_from_data_block(seq_block); +- size_t seq_buffer_size = get_num_read_into_data_block(seq_block); +- int i; +- for (i = 0; i < seq_buffer_size; ++i) { +- a_char = seq_buffer[i]; +- // Skip non-alphabetic characters. +- if (!isalnum(a_char) && a_char != '-' && a_char != '*' && a_char != '.') { +- if ((a_char != ' ') && (a_char != '\t') && (a_char != '\n') && (a_char != '\r')) { +- fprintf(stderr, "Warning: Skipping character %c in sequence %s.\n", +- a_char, name); +- } +- } else { +- // skip check if unknown alph +- if (alph != NULL && !alph_is_known(alph, a_char)) { +- fprintf(stderr, "Warning: Converting illegal character %c to %c ", +- a_char, alph_wildcard(alph)); +- fprintf(stderr, "in sequence %s.\n", name); +- a_char = alph_wildcard(alph); +- } +- raw_sequence[offset] = (char) a_char; +- ++offset; +- } +- } +- +- raw_sequence[offset] = '\0'; +- free_data_block(seq_block); +- return(return_value); +-} +- +-/**************************************************************************** + * Read one sequence from a file in Fasta format. + * + * Return: Was a sequence successfully read? +@@ -320,44 +266,6 @@ + } + + /**************************************************************************** +- * Read up to max_chars letters of one sequence from a DATA_BLOCK_T readder +- * and copy them in to the raw sequence in the SEQ_T object starting at the +- * given buffer offset. +- ****************************************************************************/ +-void read_one_fasta_segment_from_reader( +- DATA_BLOCK_READER_T *fasta_reader, +- size_t max_size, +- size_t buffer_offset, +- SEQ_T *sequence +-) { +- +- assert(sequence != NULL); +- assert(get_seq_length(sequence) <= max_size); +- +- // Get the raw sequence buffer from the SEQ_T +- char *raw_sequence = get_raw_sequence(sequence); +- if (raw_sequence == NULL) { +- // Allocate space for raw sequence if not done yet. +- raw_sequence = mm_malloc(sizeof(char) * max_size + 1); +- raw_sequence[0] = 0; +- } +- +- // Read a block of sequence charaters into the +- // raw sequence buffer for the SEQ_T. +- char *name = get_seq_name(sequence); +- BOOLEAN_T is_complete = read_raw_sequence_from_reader( +- fasta_reader, +- name, +- NULL, //FIXME this is dodgy, need a proper way of getting the alphabet. The fasta_reader has it but it is not accessable! +- buffer_offset, +- max_size, +- raw_sequence +- ); +- set_raw_sequence(raw_sequence, is_complete, sequence); +- +-} +- +-/**************************************************************************** + * Read all the sequences from a FASTA file at once. + Multiple files can be appended by calling this more than once. + ****************************************************************************/ +diff -r 2aada1579554 src/fasta-io.h +--- src/fasta-io.h ++++ src/fasta-io.h +@@ -43,19 +43,6 @@ + ); + + /**************************************************************************** +- * Read up to max_chars letters of one sequence from a DATA_BLOCK_T readder +- * and copy them in to the raw sequence in the SEQ_T object starting at the +- * given buffer offset. +- ****************************************************************************/ +-void read_one_fasta_segment_from_reader( +- DATA_BLOCK_READER_T *fasta_reader, +- size_t max_size, +- size_t buffer_offset, +- SEQ_T* sequence +-); +- +- +-/**************************************************************************** + * Read all the sequences from a file in Fasta format. + ****************************************************************************/ + void read_many_fastas +diff -r 2aada1579554 src/init.c +--- src/init.c ++++ src/init.c +@@ -767,10 +767,16 @@ + if (alph_is_builtin_protein(alph)) { // default mixture prior for proteins + plib_name = make_path_to_file(get_meme_etc_dir(), PROTEIN_PLIB); + } else { +- fprintf(stderr, "The prior library must be specified for DNA or custom " +- "alphabets when specifiying a prior type of 'dmix', 'mega' " +- "or 'megap'."); +- exit(1); ++ fprintf( ++ stderr, ++ "WARNING: When using DNA or a custom alphabet, " ++ "and specifiying a prior type of\n" ++ "'dmix', 'mega' or 'megap', a prior library must be provided.\n" ++ "No prior library was provided, so a simple Dirichlet prior will be used.\n" ++ ); ++ prior = "dirichlet"; ++ ptype = Dirichlet; ++ if (beta <= 0) beta = 0.01; // default b = 0.01 for simple Dirichlet + } + } + } +diff -r 2aada1579554 src/mcast.c +--- src/mcast.c ++++ src/mcast.c +@@ -968,7 +968,6 @@ + if (start_pos < 0) { + start_pos = 0; + } +- + read_one_fasta_segment_from_reader( + fasta_reader, + options->max_chars, +diff -r 2aada1579554 src/seq-reader-from-fasta.c +--- src/seq-reader-from-fasta.c ++++ src/seq-reader-from-fasta.c +@@ -639,11 +639,140 @@ + return fasta_reader->current_position; + } + ++ ++/**************************************************************************** ++ * Read up to max_chars letters of one sequence from a DATA_BLOCK_T readder ++ * and copy them in to the raw sequence in the SEQ_T object starting at the ++ * given buffer offset. ++ ****************************************************************************/ ++void read_one_fasta_segment_from_reader( ++ DATA_BLOCK_READER_T *fasta_reader, ++ size_t max_size, ++ size_t offset, ++ SEQ_T *sequence ++) { ++ ++ ++ assert(sequence != NULL); ++ assert(offset < max_size); ++ ++ // Get the raw sequence buffer from the SEQ_T ++ char *raw_sequence = get_raw_sequence(sequence); ++ if (raw_sequence == NULL) { ++ // Allocate space for raw sequence if not done yet. ++ raw_sequence = mm_malloc(sizeof(char) * max_size + 1); ++ raw_sequence[0] = 0; ++ } ++ ++ // Read a block of sequence charaters into the ++ // raw sequence buffer for the SEQ_T, starting at offset. ++ BOOLEAN_T is_complete = read_raw_sequence_from_reader( ++ fasta_reader, ++ max_size - offset, ++ raw_sequence + offset ++ ); ++ set_raw_sequence(raw_sequence, is_complete, sequence); ++} ++ ++/**************************************************************************** ++ * Read raw sequence until a new sequence is encountered or too many letters ++ * are read. ++ * ++ * Return: Was the sequence read completely? ++ ****************************************************************************/ ++BOOLEAN_T read_raw_sequence_from_reader( ++ DATA_BLOCK_READER_T *reader, // Sequence source ++ unsigned int max_chars, // Maximum chars in raw_sequence. ++ char* raw_sequence // Pre-allocated sequence buffer. ++) { ++ ++ SEQ_READER_FROM_FASTA_T *fasta_reader ++ = (SEQ_READER_FROM_FASTA_T *) get_data_block_reader_data(reader); ++ ++ // Read sequence into temp. buffer from the sequence file. ++ char buffer[max_chars]; ++ long start_file_pos = ftell(fasta_reader->fasta_file); ++ size_t seq_index = 0; ++ size_t total_read = 0; ++ while (seq_index < max_chars) { ++ ++ size_t num_char_read = fread( ++ buffer, ++ sizeof(char), ++ max_chars - seq_index, ++ fasta_reader->fasta_file ++ ); ++ fasta_reader->current_position += num_char_read; ++ total_read += num_char_read; ++ ++ if (feof(fasta_reader->fasta_file)) { ++ fasta_reader->at_end_of_file = TRUE; ++ } ++ else if (num_char_read < (max_chars - seq_index)) { ++ die( ++ "Error while reading sequence from file:%s.\nError message: %s\n", ++ fasta_reader->filename, ++ strerror(ferror(fasta_reader->fasta_file)) ++ ); ++ } ++ ++ size_t i; ++ for(i = 0; i < num_char_read; ++i) { ++ char c = buffer[i]; ++ assert(c != 0); ++ if (isspace(c)) { ++ // Skip over white space ++ fasta_reader->at_start_of_line = (c == '\n'); ++ } ++ else if (c == '>' && fasta_reader->at_start_of_line == TRUE) { ++ // We found the start of a new sequence while trying ++ // to fill the buffer. Leave the buffer incomplete. ++ // and wind back the file ++ fseek(fasta_reader->fasta_file, start_file_pos + i - 1, SEEK_SET); ++ fasta_reader->current_position = start_file_pos + i - 1; ++ fasta_reader->at_end_of_seq = TRUE; ++ fasta_reader->at_start_of_line = FALSE; ++ fasta_reader->at_end_of_file = FALSE; ++ break; ++ } ++ else { ++ fasta_reader->at_start_of_line = FALSE; ++ // Check that character is legal in alphabet. ++ // If not, replace with wild card character. ++ if (alph_is_known(fasta_reader->alphabet, c)) { ++ raw_sequence[seq_index] = c; ++ } ++ else { ++ raw_sequence[seq_index] = alph_wildcard(fasta_reader->alphabet); ++ fprintf( ++ stderr, ++ "Warning: %c is not a valid character in %s alphabet.\n" ++ " Converting %c to %c.\n", ++ c, ++ alph_name(fasta_reader->alphabet), ++ c, ++ raw_sequence[i] ++ ); ++ } ++ ++seq_index; ++ } ++ } ++ if (fasta_reader->at_end_of_seq | fasta_reader->at_end_of_file) { ++ break; ++ } ++ } ++ ++ raw_sequence[seq_index] = '\0'; ++ return(fasta_reader->at_end_of_seq | fasta_reader->at_end_of_file); ++} ++ + /****************************************************************************** +- * Fills in the next data block for the sequence. +- * During the first call for the sequence it fills in the full data block. +- * On successive calls, shifts the sequence in the block down one position +- * and reads one more character. ++ * Populates the data block for the with the next block of sequence. ++ * ++ * During the first call for the sequence it fills in a buffer from a file, ++ * The sequence pointer in the data block is set to point at the start of the buffer. ++ * On successive calls, the sequence pointer in the block is shifted down one position ++ * in the buffer. When the end of the buffer is reached, it is filled again from the file. + * + * Returns TRUE if it was able to completely fill the block, FALSE if + * the next sequence or EOF was reached before the block was filled. +diff -r 2aada1579554 src/seq-reader-from-fasta.h +--- src/seq-reader-from-fasta.h ++++ src/seq-reader-from-fasta.h +@@ -37,5 +37,30 @@ + int * end_ptr // end position of sequence (chr:\d+-(\d+)) + ); + ++/**************************************************************************** ++ * Read raw sequence until a new sequence is encountered or too many letters ++ * are read. ++ * ++ * Return: Was the sequence read completely? ++ ****************************************************************************/ ++BOOLEAN_T read_raw_sequence_from_reader( ++ DATA_BLOCK_READER_T *fasta_reader, // Sequence source ++ unsigned int max_chars, // Maximum chars in raw_sequence. ++ char* raw_sequence // Pre-allocated sequence. ++); ++ ++/**************************************************************************** ++ * Read up to max_chars letters of one sequence from a DATA_BLOCK_T readder ++ * and copy them in to the raw sequence in the SEQ_T object starting at the ++ * given buffer offset. ++ ****************************************************************************/ ++void read_one_fasta_segment_from_reader( ++ DATA_BLOCK_READER_T *reader, ++ size_t max_size, ++ size_t offset, ++ SEQ_T *sequence ++); ++ ++ + size_t get_current_pos_from_seq_reader_from_fasta(DATA_BLOCK_READER_T *reader); + #endif diff --git a/tools/meme-suite/sources/patch_4.11.2_2 b/tools/meme-suite/sources/patch_4.11.2_2 new file mode 100644 index 0000000000000000000000000000000000000000..9a90c13098c3ec57a2553bf5307538a1a96dc0fd --- /dev/null +++ b/tools/meme-suite/sources/patch_4.11.2_2 @@ -0,0 +1,57 @@ +diff -r b7c0ea3ce0e3 doc/release-notes.html +--- a/doc/release-notes.html Fri Jun 17 12:40:32 2016 -0700 ++++ b/doc/release-notes.html Mon Oct 24 12:27:25 2016 -0700 +@@ -15,6 +15,21 @@ +
    +

    MEME Suite Release Notes

    +
    ++ MEME version 4.11.2 patch 2 -- October 24, 2016 ++
      ++
    • ++ Bug fixes ++
        ++
      • ++ Fixed bug in handling of RNA-like custom alphabets. ++
      • ++
      • ++ Fixed bug in MAST -comp option. ++
      • ++
      ++
    ++
    + MEME version 4.11.2 patch 1 -- June 16, 2016 +