--- datasets: - EvaKlimentova/knots_AF metrics: - accuracy base_model: ProtBert-BFD --- # Knots ProtBert-BFD AlphaFold Fine-tuned [ProtBert-BFD](https://huggingface.co/Rostlab/prot_bert_bfd) to classify proteins as knotted vs. unknotted. ## Model Details - **Model type:** Bert - **Language:** proteins (amino acid sequences) - **Finetuned from model:** [Rostlab/prot_bert_bfd](https://huggingface.co/Rostlab/prot_bert_bfd) Model Sources: - **Repository:** [CEITEC](https://github.com/ML-Bioinfo-CEITEC/pknots_experiments) - **Paper:** TBD ## Usage Dataset format: ``` id,sequence,label A0A2W5F4Z7,MGGIFRVNTYYTDLEPYLQSTKLPIYGALLDGENIYELVDKSKGILVIGNESKGIRSTIQNFIQKPITIPRIGQAESLNAAVATGIIVGQLTL,1 ... ``` Load the dataset: ``` import pandas as pd from datasets import Dataset, load_dataset df = pd.read_csv(INPUT, sep=',') dss = Dataset.from_pandas(df) ``` Predict: ``` import torch import numpy as np from transformers import AutoModelForSequenceClassification, AutoTokenizer, Trainer, TrainingArguments from math import exp def tokenize_function(s): seq_split = ' '.join(s['Sequence']) return tokenizerM1(seq_split) tokenizer = AutoTokenizer.from_pretrained('roa7n/knots_protbertBFD_alphafold') model = AutoModelForSequenceClassification.from_pretrained('roa7n/knots_protbertBFD_alphafold') tokenized_dataset = dss.map(tokenize_function, num_proc=4) tokenized_dataset.set_format('pt') tokenized_dataset training_args = TrainingArguments(, fp16=True, per_device_eval_batch_size=50, report_to='none') trainer = Trainer( model, training_args, train_dataset=tokenized_dataset, eval_dataset=tokenized_dataset, tokenizer=tokenizerM1 ) predictions, _, _ = trainer.predict(tokenized_dataset) predictions = [np.exp(p[1]) / np.sum(np.exp(p), axis=0) for p in predictions] df['preds'] = predictions ``` ## Evaluation Per protein family metrics: | M1 ProtBert-BFD | Dataset size | Unknotted set size | Accuracy | TPR | TNR | |:----------------------------:|:------------:|:------------------:|:--------:|:------:|:------:| | All | 39412 | 19718 | **0.9845** | 0.9865 | 0.9825 | | SPOUT | 7371 | 550 | 0.9887 | 0.9951 | 0.9090 | | TDD | 612 | 24 | 0.9901 | 0.9965 | 0.8333 | | DUF | 716 | 429 | 0.9748 | 0.9721 | 0.9766 | | AdoMet synthase | 1794 | 240 | 0.9899 | 0.9929 | 0.9708 | | Carbonic anhydrase | 1531 | 539 | 0.9588 | 0.9737 | 0.9313 | | UCH | 477 | 125 | 0.9056 | 0.9602 | 0.7520 | | ATCase/OTCase | 3799 | 3352 | 0.9994 | 0.9977 | 0.9997 | | ribosomal-mitochondrial | 147 | 41 | 0.8571 | 1.0000 | 0.4878 | | membrane | 8225 | 1493 | 0.9811 | 0.9904 | 0.9390 | | VIT | 14262 | 12555 | 0.9872 | 0.9420 | 0.9933 | | biosynthesis of lantibiotics | 392 | 286 | 0.9642 | 0.9528 | 0.9685 | ## Citation [optional] **BibTeX:** TODO ## Model Authors Simecek: simecek@mail.muni.cz Klimentova: vae@mail.muni.cz Sramkova: denisa.sramkova@mail.muni.cz