Update README.md

README.md

@@ -20,11 +20,11 @@ paired TCR-petide-HLA-I binding based on amino acid sequence inputs. It is a tra
 
 
 
-- **Developed by:** [Justin Barton and Trupti Gore]
+- **Developed by:** Justin Barton and Trupti Gore
 - **Funded by [optional]:** [More Information Needed]
 - **Shared by [optional]:** [More Information Needed]
-- **Model type:** [DeBERTa Transformer]
-- **Language(s) (NLP):** [More Information Needed]
+- **Model type:** DeBERTa Transformer
+- **Language(s) (NLP):** Python
 - **License:** [More Information Needed]
 - **Finetuned from model [optional]:** [More Information Needed]
 
@@ -40,7 +40,17 @@ paired TCR-petide-HLA-I binding based on amino acid sequence inputs. It is a tra
 
 <!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
 
-### Direct Use
+### How to Use 
+```
+from transformers import (DebertaForSequenceClassification,DebertaTokenizerFast)
+model = DebertaForSequenceClassification.from_pretrained(f'shepherdgroup/nuTCRacker', num_labels=2)
+tokenizer=DebertaTokenizerFast.from_pretrained('shepherdgroup/nuTCRacker')
+example="'[cdra1]SSVPPY[cdra2]YTSAATLV[cdra3]CAVSAGDYKLSF[cdrb1]KGHDR[cdrb2]SFDVKD[cdrb3]CATSDSVAGNQPQHF','[peptide]ATDALMTGF[mhc]YFAMYQENMAHTDANTLYIIYRDYTWVARVYRGY'"
+encoded_example=tokenizer(example,return_tensors='pt')
+output=model(**encoded_example)
+output
+
+```
 
 <!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->