Add model card with paper link and sample usage (#1)
Browse files- Add model card with paper link and sample usage (4c93018f13fefd755a8be34e66a2d8706d847787)
Co-authored-by: Niels Rogge <nielsr@users.noreply.huggingface.co>
README.md
CHANGED
|
@@ -1,9 +1,70 @@
|
|
| 1 |
-
---
|
| 2 |
-
|
| 3 |
-
|
| 4 |
-
|
| 5 |
-
|
| 6 |
-
|
| 7 |
-
|
| 8 |
-
|
| 9 |
-
-
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
| 1 |
+
---
|
| 2 |
+
base_model:
|
| 3 |
+
- facebook/esm2_t36_3B_UR50D
|
| 4 |
+
- facebook/esm2_t33_650M_UR50D
|
| 5 |
+
- facebook/esm2_t30_150M_UR50D
|
| 6 |
+
- facebook/esm2_t12_35M_UR50D
|
| 7 |
+
- facebook/esm2_t6_8M_UR50D
|
| 8 |
+
license: mit
|
| 9 |
+
pipeline_tag: feature-extraction
|
| 10 |
+
---
|
| 11 |
+
|
| 12 |
+
# PLM Reverse Distillation
|
| 13 |
+
|
| 14 |
+
This repository contains the weights for the protein language models presented in the paper [Reverse Distillation: Consistently Scaling Protein Language Model Representations](https://huggingface.co/papers/2603.07710).
|
| 15 |
+
|
| 16 |
+
Reverse Distillation is a principled framework that decomposes large Protein Language Model (PLM) representations into orthogonal subspaces guided by smaller models of the same family. The resulting embeddings have a Matryoshka-style nested structure, ensuring that larger reverse-distilled models consistently outperform smaller ones.
|
| 17 |
+
|
| 18 |
+
- **GitHub Repository**: [rohitsinghlab/plm_reverse_distillation](https://github.com/rohitsinghlab/plm_reverse_distillation)
|
| 19 |
+
|
| 20 |
+
## Quick Start
|
| 21 |
+
|
| 22 |
+
Reverse Distilled ESM-2 models are designed to be a drop-in replacement for ESM-2 for most embedding-generation tasks.
|
| 23 |
+
|
| 24 |
+
```python
|
| 25 |
+
import esm
|
| 26 |
+
import torch
|
| 27 |
+
import reverse_distillation
|
| 28 |
+
|
| 29 |
+
# Load ESM-2 model and the reverse distillation version
|
| 30 |
+
esm2_model, alphabet = esm.pretrained.esm2_t33_650M_UR50D()
|
| 31 |
+
rd_model, alphabet = reverse_distillation.pretrained.esm2_rd_650M()
|
| 32 |
+
|
| 33 |
+
batch_converter = alphabet.get_batch_converter()
|
| 34 |
+
esm2_model.eval() # disables dropout for deterministic results
|
| 35 |
+
rd_model.eval() # disables dropout for deterministic results
|
| 36 |
+
|
| 37 |
+
# Prepare data
|
| 38 |
+
data = [
|
| 39 |
+
("protein1", "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"),
|
| 40 |
+
("protein2", "KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE"),
|
| 41 |
+
]
|
| 42 |
+
batch_labels, batch_strs, batch_tokens = batch_converter(data)
|
| 43 |
+
batch_lens = (batch_tokens != alphabet.padding_idx).sum(1)
|
| 44 |
+
|
| 45 |
+
# Extract per-residue representations
|
| 46 |
+
with torch.no_grad():
|
| 47 |
+
results_esm = esm2_model(batch_tokens, repr_layers=[33], return_contacts=True)
|
| 48 |
+
results_rd = rd_model(batch_tokens)
|
| 49 |
+
|
| 50 |
+
esm_token_representations = results_esm["representations"][33]
|
| 51 |
+
rd_token_representations = results_rd["representations"]["650M"]
|
| 52 |
+
|
| 53 |
+
# Generate per-sequence representations via averaging
|
| 54 |
+
for i, tokens_len in enumerate(batch_lens):
|
| 55 |
+
print(f"esm representation size: {esm_token_representations[i, 1 : tokens_len - 1].size()}")
|
| 56 |
+
print(f"rd representation size: {rd_token_representations[i, 1 : tokens_len - 1].size()}")
|
| 57 |
+
```
|
| 58 |
+
|
| 59 |
+
## Citation
|
| 60 |
+
|
| 61 |
+
If you use reverse distillation, please cite:
|
| 62 |
+
|
| 63 |
+
```bibtex
|
| 64 |
+
@inproceedings{catrina2026reverse,
|
| 65 |
+
title = {Reverse Distillation: Consistently Scaling Protein Language Model Representations},
|
| 66 |
+
author = {Catrina, Darius and Bepler, Christian and Sledzieski, Samuel and Singh, Rohit},
|
| 67 |
+
booktitle = {International Conference on Learning Representations},
|
| 68 |
+
year = {2026}
|
| 69 |
+
}
|
| 70 |
+
```
|