| |
| from pathlib import Path |
| from typing import Optional |
| from uuid import uuid4 |
| import hashlib |
| import json |
| import gradio as gr |
| import gemmi |
| from gradio_molecule3d import Molecule3D |
| from modal_app import app, chai1_inference, download_inference_dependencies, here |
|
|
| |
|
|
| |
| def create_fasta_file(sequence: str, name: Optional[str] = None) -> str: |
| """Create a FASTA file from a protein sequence string with a unique name. |
| |
| Args: |
| sequence (str): The protein sequence string with optional line breaks |
| name (str, optional): The name/identifier for the sequence. Defaults to "PROTEIN" |
| |
| Returns: |
| str: Name of the created FASTA file |
| """ |
| |
| lines = sequence.strip().split('\n') |
| |
| |
| if not lines[0].startswith('>'): |
| |
| if name is None: |
| name = "PROTEIN" |
| sequence = f">{name}\n{sequence}" |
| |
| |
| fasta_content = sequence |
| |
| |
| unique_id = hashlib.sha256(uuid4().bytes).hexdigest()[:8] |
| file_name = f"chai1_{unique_id}_input.fasta" |
| file_path = here / "inputs" / file_name |
| |
| |
| with open(file_path, "w") as f: |
| f.write(fasta_content) |
| |
| return file_name |
|
|
| |
| def create_json_config( |
| num_diffn_timesteps: int, |
| num_trunk_recycles: int, |
| seed: int, |
| options: list |
| ) -> str: |
| """Create a JSON configuration file from the Gradio interface inputs. |
| |
| Args: |
| num_diffn_timesteps (int): Number of diffusion timesteps from slider |
| num_trunk_recycles (int): Number of trunk recycles from slider |
| seed (int): Random seed from slider |
| options (list): List of selected options from checkbox group |
| |
| Returns: |
| str: Name of the created JSON file |
| """ |
| |
| use_esm_embeddings = "ESM_embeddings" in options |
| use_msa_server = "MSA_server" in options |
| |
| |
| config = { |
| "num_trunk_recycles": num_trunk_recycles, |
| "num_diffn_timesteps": num_diffn_timesteps, |
| "seed": seed, |
| "use_esm_embeddings": use_esm_embeddings, |
| "use_msa_server": use_msa_server |
| } |
| |
| |
| unique_id = hashlib.sha256(uuid4().bytes).hexdigest()[:8] |
| file_name = f"chai1_{unique_id}_config.json" |
| file_path = here / "inputs" / file_name |
| |
| |
| with open(file_path, "w") as f: |
| json.dump(config, f, indent=4) |
| |
| return file_name |
|
|
|
|
| |
| def compute_Chai1( |
| fasta_file: Optional[str] = "", |
| inference_config_file: Optional[str] = "", |
| ): |
| """Compute a Chai1 simulation. |
| |
| Args: |
| x (float | int): The number to square. |
| |
| Returns: |
| float: The square of the input number. |
| """ |
| with app.run(): |
| |
| force_redownload = False |
| |
| print("🧬 checking inference dependencies") |
| download_inference_dependencies.remote(force=force_redownload) |
|
|
| |
| if not fasta_file: |
| fasta_file = here / "inputs" / "chai1_default_input.fasta" |
| print(f"🧬 running Chai inference on {fasta_file}") |
| fasta_file = here / "inputs" / fasta_file |
| print(fasta_file) |
| fasta_content = Path(fasta_file).read_text() |
|
|
| |
| if not inference_config_file: |
| inference_config_file = here / "inputs" / "chai1_quick_inference.json" |
| inference_config_file = here / "inputs" / inference_config_file |
| print(f"🧬 loading Chai inference config from {inference_config_file}") |
| inference_config = json.loads(Path(inference_config_file).read_text()) |
|
|
| |
| run_id = hashlib.sha256(uuid4().bytes).hexdigest()[:8] |
| print(f"🧬 running inference with {run_id=}") |
|
|
| results = chai1_inference.remote(fasta_content, inference_config, run_id) |
|
|
| |
| output_dir = Path("./results") |
| output_dir.mkdir(parents=True, exist_ok=True) |
|
|
| print(f"🧬 saving results to disk locally in {output_dir}") |
| for ii, (scores, cif) in enumerate(results): |
| (Path(output_dir) / f"{run_id}-scores.model_idx_{ii}.npz").write_bytes(scores) |
| (Path(output_dir) / f"{run_id}-preds.model_idx_{ii}.cif").write_text(cif) |
| |
| |
| cif_name = str(output_dir)+"/"+str(run_id)+"-preds.model_idx_"+str(ii)+".cif" |
| pdb_name = cif_name.split('.cif')[0] + '.pdb' |
| st = gemmi.read_structure(cif_name) |
| st.write_minimal_pdb(pdb_name) |
| |
| return pdb_name |
|
|
|
|
| |
| reps = [{"model": 0,"style": "cartoon","color": "hydrophobicity"}] |
|
|
| with gr.Blocks() as demo: |
| |
| gr.Markdown( |
| """ |
| # Chai1 Simulation Interface |
| This interface allows you to run Chai1 simulations on a given Fasta sequence file. |
| """) |
| |
| with gr.Tab("Introduction 🔭"): |
| |
| gr.Markdown( |
| """ |
| ## Chai1 Simulation Interface |
| This interface allows you to run Chai1 simulations on a given Fasta sequence file. |
| The Chai1 model is designed to predict the 3D structure of proteins based on their amino acid sequences. |
| You can input a Fasta file containing the sequence of the molecule you want to simulate, and the output will be a 3D representation of the molecule based on the Chai1 model. |
| """) |
| |
| with gr.Tab("Configuration 📦"): |
| |
| with gr.Row(): |
| with gr.Column(scale=1): |
| slider_nb = gr.Slider(1, 500, value=200, label="Number of diffusion time steps", info="Choose the number of diffusion time steps for the simulation", step=1, interactive=True, elem_id="num_iterations") |
| slider_trunk = gr.Slider(1, 5, value=3, label="Number of trunk recycles", info="Choose the number of iterations for the simulation", step=1, interactive=True, elem_id="trunk_number") |
| slider_seed = gr.Slider(1, 100, value=42, label="Seed", info="Choose the seed", step=1, interactive=True, elem_id="seed") |
| check_options = gr.CheckboxGroup(["ESM_embeddings", "MSA_server"], value=["ESM_embeddings",], label="Additionnal options", info="Options to use ESM embeddings and MSA server", elem_id="options") |
| json_output = gr.Textbox(placeholder="Config file name", label="Config file name") |
| button_json = gr.Button("Create Config file") |
| button_json.click(fn=create_json_config, inputs=[slider_nb, slider_trunk, slider_seed, check_options], outputs=[json_output]) |
| |
| with gr.Column(scale=1): |
| text_input = gr.Textbox(placeholder="Fasta format sequences", label="Fasta content", lines=10) |
| text_output = gr.Textbox(placeholder="Fasta file name", label="Fasta file name") |
| text_button = gr.Button("Create Fasta file") |
| text_button.click(fn=create_fasta_file, inputs=[text_input], outputs=[text_output]) |
| |
|
|
| gr.Markdown( |
| """ |
| You can input a Fasta file containing the sequence of the molecule you want to simulate. |
| The output will be a 3D representation of the molecule based on the Chai1 model. |
| ## Instructions |
| 1. Upload a Fasta sequence file containing the molecule sequence. |
| 2. Click the "Run" button to start the simulation. |
| 3. The output will be a 3D visualization of the molecule. |
| ## Example Input |
| You can use the default Fasta file provided in the inputs directory, or upload your own. |
| ## Output |
| The output will be a 3D representation of the molecule, which you can interact with. |
| ## Note |
| Make sure to have the necessary dependencies installed and the Chai1 model available in the specified directory. |
| ## Disclaimer |
| This interface is for educational and research purposes only. The results may vary based on the input sequence and the Chai1 model's capabilities. |
| ## Contact |
| For any issues or questions, please contact the developer or refer to the documentation. |
| ## Example Fasta File |
| ``` |
| >protein|name=example-protein |
| AGSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFD |
| """) |
| |
| with gr.Tab("Run folding simulation 🚀"): |
| inp1 = gr.Textbox(placeholder="Fasta Sequence file", label="Input Fasta file") |
| inp2 = gr.Textbox(placeholder="Config file", label="JSON Config file") |
| btn = gr.Button("Run") |
| out = Molecule3D(label="Molecule3D", reps=reps) |
| btn.click(fn=compute_Chai1, inputs=[inp1 , inp2], outputs=[out]) |
|
|
| |
| if __name__ == "__main__": |
| demo.launch(mcp_server=True) |
|
|