MCP_Chai1_Modal / app.py
PhDFlo's picture
Merge branch 'dev_Florian'
becdabd
raw
history blame
9.24 kB
# Import librairies
from pathlib import Path
from typing import Optional
from uuid import uuid4
import hashlib
import json
import gradio as gr
import gemmi
from gradio_molecule3d import Molecule3D
from modal_app import app, chai1_inference, download_inference_dependencies, here
# Definition of the tools for the MCP server
# Function to return a fasta file
def create_fasta_file(sequence: str, name: Optional[str] = None) -> str:
"""Create a FASTA file from a protein sequence string with a unique name.
Args:
sequence (str): The protein sequence string with optional line breaks
name (str, optional): The name/identifier for the sequence. Defaults to "PROTEIN"
Returns:
str: Name of the created FASTA file
"""
# Remove any trailing/leading whitespace but preserve line breaks
lines = sequence.strip().split('\n')
# Check if the first line is a FASTA header
if not lines[0].startswith('>'):
# If no header provided, add one
if name is None:
name = "PROTEIN"
sequence = f">{name}\n{sequence}"
# Create FASTA content (preserving line breaks)
fasta_content = sequence
# Generate a unique file name
unique_id = hashlib.sha256(uuid4().bytes).hexdigest()[:8]
file_name = f"chai1_{unique_id}_input.fasta"
file_path = here / "inputs" / file_name
# Write the FASTA file
with open(file_path, "w") as f:
f.write(fasta_content)
return file_name
# Function to create a JSON file
def create_json_config(
num_diffn_timesteps: int,
num_trunk_recycles: int,
seed: int,
options: list
) -> str:
"""Create a JSON configuration file from the Gradio interface inputs.
Args:
num_diffn_timesteps (int): Number of diffusion timesteps from slider
num_trunk_recycles (int): Number of trunk recycles from slider
seed (int): Random seed from slider
options (list): List of selected options from checkbox group
Returns:
str: Name of the created JSON file
"""
# Convert checkbox options to boolean flags
use_esm_embeddings = "ESM_embeddings" in options
use_msa_server = "MSA_server" in options
# Create config dictionary
config = {
"num_trunk_recycles": num_trunk_recycles,
"num_diffn_timesteps": num_diffn_timesteps,
"seed": seed,
"use_esm_embeddings": use_esm_embeddings,
"use_msa_server": use_msa_server
}
# Generate a unique file name
unique_id = hashlib.sha256(uuid4().bytes).hexdigest()[:8]
file_name = f"chai1_{unique_id}_config.json"
file_path = here / "inputs" / file_name
# Write the JSON file
with open(file_path, "w") as f:
json.dump(config, f, indent=4)
return file_name
# Function to compute Chai1 inference
def compute_Chai1(
fasta_file: Optional[str] = "",
inference_config_file: Optional[str] = "",
):
"""Compute a Chai1 simulation.
Args:
x (float | int): The number to square.
Returns:
float: The square of the input number.
"""
with app.run():
force_redownload = False
print("🧬 checking inference dependencies")
download_inference_dependencies.remote(force=force_redownload)
# Define fasta file
if not fasta_file:
fasta_file = here / "inputs" / "chai1_default_input.fasta"
print(f"🧬 running Chai inference on {fasta_file}")
fasta_file = here / "inputs" / fasta_file
print(fasta_file)
fasta_content = Path(fasta_file).read_text()
# Define inference config file
if not inference_config_file:
inference_config_file = here / "inputs" / "chai1_quick_inference.json"
inference_config_file = here / "inputs" / inference_config_file
print(f"🧬 loading Chai inference config from {inference_config_file}")
inference_config = json.loads(Path(inference_config_file).read_text())
# Generate a unique run ID
run_id = hashlib.sha256(uuid4().bytes).hexdigest()[:8] # short id
print(f"🧬 running inference with {run_id=}")
results = chai1_inference.remote(fasta_content, inference_config, run_id)
# Define output directory
output_dir = Path("./results")
output_dir.mkdir(parents=True, exist_ok=True)
print(f"🧬 saving results to disk locally in {output_dir}")
for ii, (scores, cif) in enumerate(results):
(Path(output_dir) / f"{run_id}-scores.model_idx_{ii}.npz").write_bytes(scores)
(Path(output_dir) / f"{run_id}-preds.model_idx_{ii}.cif").write_text(cif)
# Take the last cif file and convert it to pdb
cif_name = str(output_dir)+"/"+str(run_id)+"-preds.model_idx_"+str(ii)+".cif"
pdb_name = cif_name.split('.cif')[0] + '.pdb'
st = gemmi.read_structure(cif_name)
st.write_minimal_pdb(pdb_name)
return pdb_name
# Create the Gradio interface
reps = [{"model": 0,"style": "cartoon","color": "hydrophobicity"}]
with gr.Blocks() as demo:
gr.Markdown(
"""
# Chai1 Simulation Interface
This interface allows you to run Chai1 simulations on a given Fasta sequence file.
""")
with gr.Tab("Introduction 🔭"):
gr.Markdown(
"""
## Chai1 Simulation Interface
This interface allows you to run Chai1 simulations on a given Fasta sequence file.
The Chai1 model is designed to predict the 3D structure of proteins based on their amino acid sequences.
You can input a Fasta file containing the sequence of the molecule you want to simulate, and the output will be a 3D representation of the molecule based on the Chai1 model.
""")
with gr.Tab("Configuration 📦"):
with gr.Row():
with gr.Column(scale=1):
slider_nb = gr.Slider(1, 500, value=200, label="Number of diffusion time steps", info="Choose the number of diffusion time steps for the simulation", step=1, interactive=True, elem_id="num_iterations")
slider_trunk = gr.Slider(1, 5, value=3, label="Number of trunk recycles", info="Choose the number of iterations for the simulation", step=1, interactive=True, elem_id="trunk_number")
slider_seed = gr.Slider(1, 100, value=42, label="Seed", info="Choose the seed", step=1, interactive=True, elem_id="seed")
check_options = gr.CheckboxGroup(["ESM_embeddings", "MSA_server"], value=["ESM_embeddings",], label="Additionnal options", info="Options to use ESM embeddings and MSA server", elem_id="options")
json_output = gr.Textbox(placeholder="Config file name", label="Config file name")
button_json = gr.Button("Create Config file")
button_json.click(fn=create_json_config, inputs=[slider_nb, slider_trunk, slider_seed, check_options], outputs=[json_output])
with gr.Column(scale=1):
text_input = gr.Textbox(placeholder="Fasta format sequences", label="Fasta content", lines=10)
text_output = gr.Textbox(placeholder="Fasta file name", label="Fasta file name")
text_button = gr.Button("Create Fasta file")
text_button.click(fn=create_fasta_file, inputs=[text_input], outputs=[text_output])
gr.Markdown(
"""
You can input a Fasta file containing the sequence of the molecule you want to simulate.
The output will be a 3D representation of the molecule based on the Chai1 model.
## Instructions
1. Upload a Fasta sequence file containing the molecule sequence.
2. Click the "Run" button to start the simulation.
3. The output will be a 3D visualization of the molecule.
## Example Input
You can use the default Fasta file provided in the inputs directory, or upload your own.
## Output
The output will be a 3D representation of the molecule, which you can interact with.
## Note
Make sure to have the necessary dependencies installed and the Chai1 model available in the specified directory.
## Disclaimer
This interface is for educational and research purposes only. The results may vary based on the input sequence and the Chai1 model's capabilities.
## Contact
For any issues or questions, please contact the developer or refer to the documentation.
## Example Fasta File
```
>protein|name=example-protein
AGSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFD
""")
with gr.Tab("Run folding simulation 🚀"):
inp1 = gr.Textbox(placeholder="Fasta Sequence file", label="Input Fasta file")
inp2 = gr.Textbox(placeholder="Config file", label="JSON Config file")
btn = gr.Button("Run")
out = Molecule3D(label="Molecule3D", reps=reps)
btn.click(fn=compute_Chai1, inputs=[inp1 , inp2], outputs=[out])
# Launch both the Gradio web interface and the MCP server
if __name__ == "__main__":
demo.launch(mcp_server=True)