grammar

app.py

@@ -377,7 +377,7 @@ with gr.Blocks(theme=theme) as demo:
         # What's next?
         1. Expose additional tools to post-process the results of the simulations (ex: Plot images of the molecule structure from a file). 
         The current post-processing tools are suited for the Gradio interface.
-        2. Continue the pipeline by adding softawres like [OpenMM](https://openmm.org/) or [Gromacs](https://www.gromacs.org/) for molecular dynamics simulations.
+        2. Continue the pipeline by adding software like [OpenMM](https://openmm.org/) or [Gromacs](https://www.gromacs.org/) for molecular dynamics simulations.
         3. Perform full simulation plans including loops over parameters fully automated by the LLM.
         
         # Contact

introduction_page.md

@@ -60,7 +60,7 @@ CCCCCCCCCCCCCC(=O)O
 </div>
 <small>For a peptide, use `protein` as the molecule type.</small>
 
-**Other examples:**
+**Other example:**
 <div style="background-color:#ffffff; border-radius:8px; padding:18px 24px; margin-bottom:24px; border:1px solid #cccccc;">
 
 ```fasta
@@ -68,12 +68,6 @@ CCCCCCCCCCCCCC(=O)O
 MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPDLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCAAINQVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPDRAKRVITTFRTGTWDAYKNL
 ```
 
-```fasta
->rna|Chain B
-UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUACUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
-MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPDLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCAAINQVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPDRAKRVITTFRTGTWDAYKNL
-```
-
 </div>
 
 ### 3. <span style="color:#e98935;">Select your config and FASTA files</span>