Gradio app modifs

app.py

@@ -117,35 +117,43 @@ with gr.Blocks() as demo:
     # Chai1 Simulation Interface
     This interface allows you to run Chai1 simulations on a given Fasta sequence file.     
     """) 
-    inp1 = gr.Textbox(placeholder="Fasta Sequence file", label="Input Fasta file")
-    inp2 = gr.Textbox(placeholder="Config file", label="JSON Config file")
-    btn = gr.Button("Run")
-    out = Molecule3D(label="Molecule3D", reps=reps)
-    btn.click(fn=compute_Chai1, inputs=[inp1 , inp2], outputs=[out])
     
-    gr.Markdown(
-    """
-    You can input a Fasta file containing the sequence of the molecule you want to simulate.
-    The output will be a 3D representation of the molecule based on the Chai1 model.
-    ## Instructions
-    1. Upload a Fasta sequence file containing the molecule sequence.
-    2. Click the "Run" button to start the simulation.
-    3. The output will be a 3D visualization of the molecule.
-    ## Example Input
-    You can use the default Fasta file provided in the inputs directory, or upload your own.
-    ## Output
-    The output will be a 3D representation of the molecule, which you can interact with.
-    ## Note
-    Make sure to have the necessary dependencies installed and the Chai1 model available in the specified directory.
-    ## Disclaimer
-    This interface is for educational and research purposes only. The results may vary based on the input sequence and the Chai1 model's capabilities.
-    ## Contact
-    For any issues or questions, please contact the developer or refer to the documentation.
-    ## Example Fasta File
-    ```
-    >sp|P12345|EXAMPLE_HUMAN Example protein
-    MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVQKLLLQGQGQGQGQGQGQGQGQGQGQ       
-    """) 
+    with gr.Tab("Configuration 📦"):
+        text_input = gr.Textbox()
+        text_output = gr.Textbox()
+        text_button = gr.Button("Generate Configuration")
+        text_button.click(fn=create_custom_config, inputs=[text_input], outputs=[text_output])
+        
+        gr.Markdown(
+        """
+        You can input a Fasta file containing the sequence of the molecule you want to simulate.
+        The output will be a 3D representation of the molecule based on the Chai1 model.
+        ## Instructions
+        1. Upload a Fasta sequence file containing the molecule sequence.
+        2. Click the "Run" button to start the simulation.
+        3. The output will be a 3D visualization of the molecule.
+        ## Example Input
+        You can use the default Fasta file provided in the inputs directory, or upload your own.
+        ## Output
+        The output will be a 3D representation of the molecule, which you can interact with.
+        ## Note
+        Make sure to have the necessary dependencies installed and the Chai1 model available in the specified directory.
+        ## Disclaimer
+        This interface is for educational and research purposes only. The results may vary based on the input sequence and the Chai1 model's capabilities.
+        ## Contact
+        For any issues or questions, please contact the developer or refer to the documentation.
+        ## Example Fasta File
+        ```
+        >sp|P12345|EXAMPLE_HUMAN Example protein
+        MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVQKLLLQGQGQGQGQGQGQGQGQGQGQ       
+        """) 
+       
+    with gr.Tab("Run folding simulation 🚀"): 
+        inp1 = gr.Textbox(placeholder="Fasta Sequence file", label="Input Fasta file")
+        inp2 = gr.Textbox(placeholder="Config file", label="JSON Config file")
+        btn = gr.Button("Run")
+        out = Molecule3D(label="Molecule3D", reps=reps)
+        btn.click(fn=compute_Chai1, inputs=[inp1 , inp2], outputs=[out])
 
 # Launch both the Gradio web interface and the MCP server
 if __name__ == "__main__":