Cosmetique gradio

app.py

@@ -71,10 +71,40 @@ def compute_Chai1(
 reps = [{"model": 0,"style": "cartoon","color": "whiteCarbon"}]
 
 with gr.Blocks() as demo:
+    
+    gr.Markdown(
+    """
+    # Chai1 Simulation Interface
+    This interface allows you to run Chai1 simulations on a given Fasta sequence file.     
+    """) 
     inp = gr.Textbox(placeholder="Fasta Sequence file", label="Input Fasta file")
     btn = gr.Button("Run")
     out = Molecule3D(label="Molecule3D", reps=reps)
     btn.click(fn=compute_Chai1, inputs=[inp], outputs=[out])
+    
+       gr.Markdown(
+    """
+    You can input a Fasta file containing the sequence of the molecule you want to simulate.
+    The output will be a 3D representation of the molecule based on the Chai1 model.
+    ## Instructions
+    1. Upload a Fasta sequence file containing the molecule sequence.
+    2. Click the "Run" button to start the simulation.
+    3. The output will be a 3D visualization of the molecule.
+    ## Example Input
+    You can use the default Fasta file provided in the inputs directory, or upload your own.
+    ## Output
+    The output will be a 3D representation of the molecule, which you can interact with.
+    ## Note
+    Make sure to have the necessary dependencies installed and the Chai1 model available in the specified directory.
+    ## Disclaimer
+    This interface is for educational and research purposes only. The results may vary based on the input sequence and the Chai1 model's capabilities.
+    ## Contact
+    For any issues or questions, please contact the developer or refer to the documentation.
+    ## Example Fasta File
+    ```
+    >sp|P12345|EXAMPLE_HUMAN Example protein
+    MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVQKLLLQGQGQGQGQGQGQGQGQGQGQ       
+    """) 
 
 # Launch both the Gradio web interface and the MCP server
 if __name__ == "__main__":