# Import librairies
from pathlib import Path
from typing import Optional
from uuid import uuid4
import hashlib
import json
import gradio as gr
import gemmi
from gradio_molecule3d import Molecule3D
from modal_app import app, chai1_inference, download_inference_dependencies, here

# Definition of the tools for the MCP server 

# Function to compute Chai1 inference
def compute_Chai1(
    fasta_file: Optional[str] = None,
    inference_config_file: Optional[str] = None,
):
    """Compute a Chai1 simulation.

    Args:
        x (float | int): The number to square.

    Returns:
        float: The square of the input number.
    """
    with app.run():
        
        force_redownload = False
        output_dir = None
        run_id = None
        
        print("🧬 checking inference dependencies")
        download_inference_dependencies.remote(force=force_redownload)

        if fasta_file is None:
            fasta_file = here / "inputs" / "chai1_default_input.fasta"
        print(f"🧬 running Chai inference on {fasta_file}")
        fasta_content = Path(fasta_file).read_text()

        if inference_config_file is None:
            inference_config_file = here / "inputs" / "chai1_quick_inference.json"
        print(f"🧬 loading Chai inference config from {inference_config_file}")
        inference_config = json.loads(Path(inference_config_file).read_text())

        if run_id is None:
            run_id = hashlib.sha256(uuid4().bytes).hexdigest()[:8]  # short id
        print(f"🧬 running inference with {run_id=}")

        results = chai1_inference.remote(fasta_content, inference_config, run_id)

        if output_dir is None:
            output_dir = Path("./results")
            output_dir.mkdir(parents=True, exist_ok=True)

        print(f"🧬 saving results to disk locally in {output_dir}")
        for ii, (scores, cif) in enumerate(results):
            (Path(output_dir) / f"{run_id}-scores.model_idx_{ii}.npz").write_bytes(scores)
            (Path(output_dir) / f"{run_id}-preds.model_idx_{ii}.cif").write_text(cif)
        
        # Take the last cif file and convert it to pdb
        cif_name = str(output_dir)+"/"+str(run_id)+"-preds.model_idx_"+str(ii)+".cif"
        pdb_name = cif_name.split('.cif')[0] + '.pdb'
        st = gemmi.read_structure(cif_name)
        st.write_minimal_pdb(pdb_name)
        
        return pdb_name


# Create the Gradio interface
reps = [{"model": 0,"style": "cartoon","color": "whiteCarbon"}]

with gr.Blocks() as demo:
    
    gr.Markdown(
    """
    # Chai1 Simulation Interface
    This interface allows you to run Chai1 simulations on a given Fasta sequence file.     
    """) 
    inp = gr.Textbox(placeholder="Fasta Sequence file", label="Input Fasta file")
    btn = gr.Button("Run")
    out = Molecule3D(label="Molecule3D", reps=reps)
    btn.click(fn=compute_Chai1, inputs=[inp], outputs=[out])
    
       gr.Markdown(
    """
    You can input a Fasta file containing the sequence of the molecule you want to simulate.
    The output will be a 3D representation of the molecule based on the Chai1 model.
    ## Instructions
    1. Upload a Fasta sequence file containing the molecule sequence.
    2. Click the "Run" button to start the simulation.
    3. The output will be a 3D visualization of the molecule.
    ## Example Input
    You can use the default Fasta file provided in the inputs directory, or upload your own.
    ## Output
    The output will be a 3D representation of the molecule, which you can interact with.
    ## Note
    Make sure to have the necessary dependencies installed and the Chai1 model available in the specified directory.
    ## Disclaimer
    This interface is for educational and research purposes only. The results may vary based on the input sequence and the Chai1 model's capabilities.
    ## Contact
    For any issues or questions, please contact the developer or refer to the documentation.
    ## Example Fasta File
    ```
    >sp|P12345|EXAMPLE_HUMAN Example protein
    MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVQKLLLQGQGQGQGQGQGQGQGQGQGQ       
    """) 

# Launch both the Gradio web interface and the MCP server
if __name__ == "__main__":
    demo.launch(mcp_server=True)