Spaces:
Running
on
Zero
Running
on
Zero
File size: 32,430 Bytes
7968cb0 |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 |
import sys; sys.path.append('/huyuqi/xmyu/DiffSDS')
import inspect
import torch
from src.tools.utils import cuda
import torch.nn as nn
import os
from torcheval.metrics.text import Perplexity
from src.interface.model_interface import MInterface_base
import math
import torch.nn.functional as F
from omegaconf import OmegaConf
from src.tools.utils import load_yaml_config
import torchmetrics
class MInterface(MInterface_base):
def __init__(self, model_name=None, loss=None, lr=None, **kwargs):
super().__init__()
self.save_hyperparameters()
self.load_model()
self.use_dynamics = kwargs.get('use_dynamics', 0)
self.flex_loss_coeff = torch.Tensor([kwargs.get('flex_loss_coeff', 0)]).to('cuda:0').to(torch.float)
self.flex_loss_coeff.requires_grad = False
if self.use_dynamics:
self.load_flex_predictor()
self.flex_loss_type = kwargs.get('loss_fn', 0)
if self.flex_loss_type == 'MSE':
self.flex_loss_fn = nn.MSELoss(reduction='none')
elif self.flex_loss_type == 'L1':
self.flex_loss_fn = nn.L1Loss(reduction='none')
elif self.flex_loss_type == 'DPO':
self.flex_loss_fn = ...
else:
raise ValueError(f"Not recognized type of loss function {self.flex_loss_type}")
self.cross_entropy = nn.NLLLoss(reduction='none')
os.makedirs(os.path.join(self.hparams.res_dir, self.hparams.ex_name), exist_ok=True)
self.control_sum_recovery = 0
self.control_sum_batch_sizes = 0
self.grad_normalization = kwargs.get('grad_normalization', 0)
self.use_pmpnn_checkpoint = kwargs.get('use_pmpnn_checkpoint',0)
if self.use_pmpnn_checkpoint:
print('Loading pmpnn checkpoint from {}'.format(self.model.pmpnn_init_weights_path))
state_dict = torch.load(self.model.pmpnn_init_weights_path)['state_dict'] #['module']
state_dict = {key: value for key, value in state_dict.items() if 'model.' in key[:6]}
state_dict = {key.replace("model.", ""): value for key, value in state_dict.items()}
self.model.load_state_dict(state_dict)
self.MSE = nn.MSELoss(reduction='none')
self.automatic_optimization = False
if self.hparams.use_dynamics:
self.pearson = torchmetrics.PearsonCorrCoef()
self.spearman = torchmetrics.SpearmanCorrCoef()
self.validation_step_outputs = []
self.test_step_outputs = []
#### setting forward hook
# def forward_hook(module, input, output):
# def check_nan(tensor):
# if isinstance(tensor, torch.Tensor):
# if torch.isnan(tensor).any():
# print(f"NaN detected in the output of {type(module).__name__}")
# print(f"Tensor shape: {tensor.shape}")
# print(f"Tensor stats: mean={tensor.mean()}, std={tensor.std()}, min={tensor.min()}, max={tensor.max()}, all={torch.isnan(tensor).all()}")
# elif isinstance(tensor, tuple):
# for i, t in enumerate(tensor):
# if isinstance(t, torch.Tensor):
# if torch.isnan(t).any():
# print(f"NaN detected in the output[{i}] of {type(module).__name__}")
# print(f"Tensor shape: {t.shape}")
# print(f"Tensor stats: mean={t.mean()}, std={t.std()}, min={t.min()}, max={t.max()}, all={torch.isnan(tensor).all()}")
# if isinstance(output, tuple):
# for i, out in enumerate(output):
# check_nan(out)
# else:
# check_nan(output)
# for name, module in self.model.named_modules():
# module.register_forward_hook(forward_hook)
# for name, module in self.flex_model.named_modules():
# module.register_forward_hook(forward_hook)
####
def forward(self, batch, mode='train', temperature=1.0):
if self.hparams.augment_eps>0:
batch['X'] = batch['X'] + self.hparams.augment_eps * torch.randn_like(batch['X'])
batch = self.model._get_features(batch)
results = self.model(batch)
log_probs, mask = results['log_probs'], batch['mask']
if len(log_probs.shape) == 3:
if self.hparams.use_dynamics:
loss = self.combined_flex_aware_loss(batch, pred_log_probs=log_probs)
#loss = loss_dict['combined_loss']
else:
loss = self.cross_entropy(log_probs.permute(0,2,1), batch['S'])
loss = (loss*mask).sum()/(mask.sum())
elif len(log_probs.shape) == 2:
if self.hparams.model_name == 'GVP':
loss = self.cross_entropy(log_probs, batch.seq)
else:
loss = self.cross_entropy(log_probs, batch['S'])
if self.hparams.model_name == 'AlphaDesign':
loss += self.cross_entropy(results['log_probs0'], batch['S'])
loss = (loss*mask).sum()/(mask.sum())
cmp = log_probs.argmax(dim=-1)==batch['S']
recovery = (cmp*mask).sum()/(mask.sum())
if mode == 'predict':
return {'original_sequence':batch['S'],'correct_positions': cmp, 'mask':mask,'loss':loss, 'recovery':recovery, 'title':batch['title'], 'log_probs': log_probs, 'batch':batch} #, 'gt_bfactors': batch['norm_bfactors'], 'batch':batch}
elif mode == 'eval':
return {'original_sequence':batch['S'],'correct_positions': cmp, 'mask':mask,'loss':loss, 'recovery':recovery, 'title':batch['title'], 'log_probs': log_probs, 'batch':batch}
else:
return loss, recovery
def avgCorrelations(self, preds, gts, masks):
pearson_R = 0
spearman_R = 0
valid_datapoints = 0
for pred, gt, mask in zip(preds, gts, masks):
dpR = self.pearson(pred[torch.where(mask)], gt[torch.where(mask)])
if torch.isnan(dpR):
continue
else:
pearson_R += dpR
spearman_R += self.spearman(pred[torch.where(mask)], gt[torch.where(mask)])
valid_datapoints += 1
return pearson_R/valid_datapoints, spearman_R/valid_datapoints
def temperature_schedular(self, batch_idx):
total_steps = self.hparams.steps_per_epoch*self.hparams.epoch
initial_lr = 1.0
circle_steps = total_steps//100
x = batch_idx / total_steps
threshold = 0.48
if x<threshold:
linear_decay = 1 - 2*x
else:
K = 1 - 2*threshold
linear_decay = K - K*(x-threshold)/(1-threshold)
new_lr = (1+math.cos(batch_idx/circle_steps*math.pi))/2*linear_decay*initial_lr
return new_lr
# def get_grad_norm(self):
# total_norm = 0
# parameters = [p for p in self.parameters() if p.grad is not None and p.requires_grad]
# for p in parameters:
# param_norm = p.grad.detach().data.norm(2)
# total_norm += param_norm.item() ** 2
# total_norm = total_norm ** 0.5
# return total_norm
#https://lightning.ai/docs/pytorch/1.9.0/notebooks/lightning_examples/basic-gan.html
def training_step(self, batch, batch_idx, **kwargs):
if self.use_dynamics:
raw_loss, recovery = self(batch)
if type(raw_loss) == dict:
flex_loss = raw_loss['flex_loss']
seq_loss = raw_loss['seq_loss']
opt = self.optimizers()
opt.zero_grad()
_params_for_optimization = [p for p in self.model.parameters() if p.requires_grad]
_params_for_optimization += [p for p in self.flex_model.parameters() if p.requires_grad]
grads_flex = torch.autograd.grad(flex_loss, _params_for_optimization, create_graph=True)
grads_seq = torch.autograd.grad(seq_loss, _params_for_optimization, create_graph=True)
if self.grad_normalization:
norm_grads_flex = [g / (g.norm() + 1e-10) for g in grads_flex]
norm_grads_seq = [g / (g.norm() + 1e-10) for g in grads_seq]
else:
norm_grads_flex = grads_flex
norm_grads_seq = grads_seq
combined_grads = [self.flex_loss_coeff * gflex + (1-self.flex_loss_coeff) * gseq for gflex, gseq in zip(norm_grads_flex, norm_grads_seq)]
#maybe track the angle between the gradients?
self.log_dict({'flex_grad_norm':torch.mean(torch.tensor([g.detach().norm() for g in norm_grads_flex])), 'seq_grad_norm': torch.mean(torch.tensor([g.detach().norm() for g in norm_grads_seq])), 'combined_grad_norm': torch.mean(torch.tensor([g.detach().norm() for g in combined_grads]))}, on_step=True, on_epoch=False, prog_bar=True)
for param, grad in zip(_params_for_optimization, combined_grads):
if param.grad is None:
param.grad = grad.detach()
else:
param.grad += grad.detach()
self.clip_gradients(opt, gradient_clip_val=1., gradient_clip_algorithm="norm")
opt.step()
# Update learning rate
sch = self.lr_schedulers()
if sch is not None:
sch.step()
loss = flex_loss + seq_loss
self.log_dict({'train_flex_loss':flex_loss, 'train_seq_loss':seq_loss}, on_step=True, on_epoch=False, prog_bar=True)
# Log the current learning rate
if sch is not None:
current_lr = sch.get_last_lr()[0]
self.log('learning_rate', current_lr, on_step=True, on_epoch=False, prog_bar=True)
else:
loss = raw_loss
self.log('loss', loss, on_step=True, on_epoch=True, prog_bar=True)
return loss
else:
raw_loss, recovery = self(batch)
if type(raw_loss) == dict:
loss = raw_loss['combined_loss']
_ = raw_loss.pop('pred_flex')
# _ = raw_loss.pop('gt_bfactors')
_ = raw_loss.pop('gt_flex')
_ = raw_loss.pop('flex_mask')
self.log_dict(raw_loss, on_step=True, on_epoch=True, prog_bar=True)
else:
loss = raw_loss
self.log('loss', loss, on_step=True, on_epoch=True, prog_bar=True)
return loss
def validation_step(self, batch, batch_idx):
raw_loss, recovery = self(batch)
if type(raw_loss) == dict:
loss = raw_loss['flex_loss']+raw_loss['seq_loss'] #raw_loss['combined_loss']
raw_loss['recovery'] = recovery
pred_flex = raw_loss.pop('pred_flex')
gt_flex = batch['gt_flex']
flex_mask = raw_loss.pop('flex_mask')
#epoch_metric_ingredients = {'pred_bfactors':pred_bfactors, 'gt_bfactors':gt_bfactors, 'flex_mask':flex_mask}
epoch_metric_ingredients = {'pred_flex': pred_flex,'gt_flex':gt_flex, 'flex_mask':flex_mask}
self.validation_step_outputs.append(epoch_metric_ingredients)
self.log_dict({ "val_combined_loss":loss,
"val_seq_loss":raw_loss['seq_loss'],
"val_flex_loss":raw_loss['flex_loss'],
"recovery": recovery})
else:
loss = raw_loss
self.log_dict({"val_loss":loss,
"recovery": recovery})
#if there is issue with validation metrics - see the test_step below
return self.log_dict
def on_validation_epoch_end(self):
if self.hparams.use_dynamics:
# all_preds = [b['pred_bfactors'] for b in self.validation_step_outputs]
# all_gts = [b['gt_bfactors'] for b in self.validation_step_outputs]
all_preds = [b['pred_flex'] for b in self.validation_step_outputs]
all_gts = [b['gt_flex'] for b in self.validation_step_outputs]
all_masks = [b['flex_mask'] for b in self.validation_step_outputs]
max_seq_length = max([pred.size()[1] for pred in all_preds])
for set_of_tensors in [all_preds, all_gts, all_masks]:
for i in range(len(set_of_tensors)):
set_of_tensors[i] = F.pad(set_of_tensors[i], (0, max_seq_length - set_of_tensors[i].shape[1],0,0), value=float(0))
all_preds = torch.cat(all_preds, dim=0)
all_gts = torch.cat(all_gts, dim=0)
all_masks = torch.cat(all_masks, dim=0)
# print(all_preds.shape, all_gts.shape, all_masks.shape)
# do something with all preds
# pearson_R = self.pearson(all_preds[torch.where(all_masks)], all_gts[torch.where(all_masks)])
pearson_R, spearman_R = self.avgCorrelations(all_preds, all_gts, all_masks)
# try:
# spearman_R = self.spearman(all_preds[torch.where(all_masks)], all_gts[torch.where(all_masks)])
# except IndexError:
# spearman_R = pearson_R
self.log_dict({"val_pearson_R":pearson_R, "val_spearman_R":spearman_R})
self.validation_step_outputs.clear() # free memory
return super().on_validation_epoch_end()
def on_test_epoch_end(self):
import pickle #use pickle to save the self.test_step_outputs to a file
with open(f'rebuttal_experiments/test_step_outputs_{self.hparams.starting_checkpoint_path.split("/")[-3]}_initFF{self.hparams.init_flex_features}_{self.hparams.test_eng_data_path.split("/")[-1][:-5]}.pkl', 'wb') as f:
pickle.dump(self.test_step_outputs, f)
if self.hparams.test_engineering and self.hparams.use_dynamics:
all_preds = [b['pred_flex'] for b in self.test_step_outputs]
all_eng_gts = [b['gt_flex'] for b in self.test_step_outputs]
all_masks = [b['flex_mask'] for b in self.test_step_outputs]
all_eng_masks = [b['eng_mask'] for b in self.test_step_outputs]
all_original_gt_flex = [b['original_gt_flex'] for b in self.test_step_outputs]
avg_sequence_recovery = sum([b['sequence_recovery'] for b in self.test_step_outputs]) / len(self.test_step_outputs)
avg_sequence_recovery = avg_sequence_recovery.cpu().tolist()
max_seq_length = max([pred.size()[1] for pred in all_preds])
_pred_flex_pool = []
_eng_gt_flex_pool = []
_original_gt_flex_pool = []
_original_gt_flex_ranks_pool = []
_eng_gt_flex_ranks_pool = []
_pred_flex_ranks_pool = []
import numpy as np
for eng_mask, flex_mask, original_gt_flex, eng_gt_flex, pred_flex in zip(all_eng_masks, all_masks, all_original_gt_flex, all_eng_gts, all_preds):
#select only the values where the engineering mask is 1 and flex mask is 1
_original_gt_flex = original_gt_flex[eng_mask == 1]
_eng_gt_flex = eng_gt_flex[eng_mask == 1]
_pred_flex = pred_flex[eng_mask == 1]
_pred_flex_pool.append(_pred_flex.cpu().numpy())
_eng_gt_flex_pool.append(_eng_gt_flex.cpu().numpy())
_original_gt_flex_pool.append(_original_gt_flex.cpu().numpy())
_original_gt_flex_ranks = torch.argsort(torch.argsort(torch.nan_to_num(original_gt_flex, nan=0)))[eng_mask == 1].cpu().numpy()
_eng_gt_flex_ranks = torch.argsort(torch.argsort(torch.nan_to_num(eng_gt_flex, nan=0)))[eng_mask == 1].cpu().numpy()
_pred_flex_ranks = torch.argsort(torch.argsort(torch.nan_to_num(pred_flex, nan=0)))[eng_mask == 1].cpu().numpy()
_original_gt_flex_ranks_pool.append(_original_gt_flex_ranks)
_eng_gt_flex_ranks_pool.append(_eng_gt_flex_ranks)
_pred_flex_ranks_pool.append(_pred_flex_ranks)
import matplotlib.pyplot as plt
import os
# # Create 'paper_figures' folder if it doesn't exist
# if not os.path.exists('paper_figures'):
# os.makedirs('paper_figures')
#pool the numpy arrays in the lists into one numpy array
_pred_flex_pool = np.concatenate(_pred_flex_pool)
_eng_gt_flex_pool = np.concatenate(_eng_gt_flex_pool)
_original_gt_flex_pool = np.concatenate(_original_gt_flex_pool)
############################################################################
all_gt_seqs = [b['gt_seq'] for b in self.test_step_outputs]
all_pred_logprobs = [b['pred_logprobs'] for b in self.test_step_outputs]
_gt_seq_pool = []
_pred_seq_pool = []
_outside_eng_region_pred_seq_pool = []
_outside_eng_region_gt_seq_pool = []
for eng_mask, gt_seq, pred_logprobs in zip(all_eng_masks, all_gt_seqs, all_pred_logprobs):
#select only the values where the engineering mask is 1
_outside_eng_region_pred_seq_pool.append(torch.argmax(pred_logprobs[(eng_mask == 0) & (flex_mask == 1)], dim=1).cpu().numpy())
_outside_eng_region_gt_seq_pool.append(gt_seq[(eng_mask == 0) & (flex_mask == 1)].cpu().numpy())
_pred_seq = torch.argmax(pred_logprobs[eng_mask == 1], dim=1)
_gt_seq = gt_seq[eng_mask == 1]
# create and add to the pools the numpy arrays
_gt_seq_pool.append(_gt_seq.cpu().numpy())
_pred_seq_pool.append(_pred_seq.cpu().numpy())
_gt_seq_pool = np.concatenate(_gt_seq_pool)
_pred_seq_pool = np.concatenate(_pred_seq_pool)
_outside_eng_region_pred_seq_pool = np.concatenate(_outside_eng_region_pred_seq_pool)
_outside_eng_region_gt_seq_pool = np.concatenate(_outside_eng_region_gt_seq_pool)
#output these pools together with the other pools to a json_file
import json
with open(f'paper_figures/pools_{self.hparams.starting_checkpoint_path.split("/")[-3]}_initFF{self.hparams.init_flex_features}_{self.hparams.test_eng_data_path.split("/")[-1][:-5]}.json', 'w') as f:
json.dump({
'_pred_flex_pool': _pred_flex_pool.tolist(),
'_eng_gt_flex_pool': _eng_gt_flex_pool.tolist(),
'_original_gt_flex_pool': _original_gt_flex_pool.tolist(),
'_pred_seq_pool': _pred_seq_pool.tolist(),
'_gt_seq_pool': _gt_seq_pool.tolist(),
'_sequence_recovery': avg_sequence_recovery,
'_outside_eng_region_pred_seq_pool': _outside_eng_region_pred_seq_pool.tolist(),
'_outside_eng_region_gt_seq_pool': _outside_eng_region_gt_seq_pool.tolist()
}, f)
############################################################################
self.test_step_outputs.clear()
else:
# all_preds = [b['pred_bfactors'] for b in self.test_step_outputs]
# all_gts = [b['gt_bfactors'] for b in self.test_step_outputs]
all_preds = [b['pred_flex'] for b in self.test_step_outputs]
all_gts = [b['gt_flex'] for b in self.test_step_outputs]
all_masks = [b['flex_mask'] for b in self.test_step_outputs]
max_seq_length = max([pred.size()[1] for pred in all_preds])
for set_of_tensors in [all_preds, all_gts, all_masks]:
for i in range(len(set_of_tensors)):
set_of_tensors[i] = F.pad(set_of_tensors[i], (0, max_seq_length - set_of_tensors[i].shape[1],0,0), value=float(0))
all_preds = torch.cat(all_preds, dim=0)
all_gts = torch.cat(all_gts, dim=0)
all_masks = torch.cat(all_masks, dim=0)
# print(all_preds.shape, all_gts.shape, all_masks.shape)
# do something with all preds
# pearson_R = self.pearson(all_preds[torch.where(all_masks)], all_gts[torch.where(all_masks)])
pearson_R, spearman_R = self.avgCorrelations(all_preds, all_gts, all_masks)
try:
spearman_R = self.spearman(all_preds[torch.where(all_masks)], all_gts[torch.where(all_masks)])
except IndexError:
spearman_R = pearson_R
self.log_dict({"test_pearson_R":pearson_R, "test_spearman_R":spearman_R})
self.test_step_outputs.clear() # free memory
return super().on_test_epoch_end()
def test_step(self, batch, batch_idx):
# Here we just reuse the validation_step for testing
#return self.validation_step(batch, batch_idx)
raw_loss, recovery = self(batch)
if type(raw_loss) == dict:
#loss = raw_loss['combined_loss']
loss = raw_loss['flex_loss']+raw_loss['seq_loss'] #raw_loss['combined_loss']
raw_loss['recovery'] = recovery
# pred_bfactors = raw_loss.pop('pred_bfactors')
pred_flex = raw_loss.pop('pred_flex')
# gt_bfactors = raw_loss.pop('gt_bfactors')
gt_flex = raw_loss.pop('gt_flex')
flex_mask = raw_loss.pop('flex_mask')
epoch_metric_ingredients = {'pred_flex':pred_flex, 'gt_flex':gt_flex, 'flex_mask':flex_mask}
if self.hparams.test_engineering and self.hparams.use_dynamics:
eng_mask = raw_loss.pop('eng_mask')
original_gt_flex = raw_loss.pop('original_gt_flex')
epoch_metric_ingredients['eng_mask'] = eng_mask
epoch_metric_ingredients['original_gt_flex'] = original_gt_flex
epoch_metric_ingredients['gt_seq'] = raw_loss['gt_seq']
epoch_metric_ingredients['pred_logprobs'] = raw_loss['pred_logprobs']
epoch_metric_ingredients['sequence_recovery'] = raw_loss['recovery']
epoch_metric_ingredients['id'] = batch['title']
self.test_step_outputs.append(epoch_metric_ingredients)
out_dict = {"val_combined_loss":loss,
"val_seq_loss":raw_loss['seq_loss'],
"val_flex_loss":raw_loss['flex_loss'],
"recovery": recovery}
else:
out_dict = {"val_loss":raw_loss, "recovery": recovery}
self.log_dict(out_dict,on_step=True,on_epoch=True, sync_dist=True)
#print(out_dict) #This print statement is fixing it - ultimately fixed by setting 'n_step=True' above
#Below validation of the correctness of the above loging
self.control_sum_batch_sizes += len(batch['X'])
self.control_sum_recovery += len(batch['X'])*recovery
return out_dict
def predict_step(self, batch, batch_idx):
predict_out = self(batch, mode=self.hparams.stage)
return predict_out
def combined_flex_aware_loss(self, batch, pred_log_probs):
_mask = batch['mask']
gt_seq = batch['S']
gt_flex = batch['gt_flex']
anm_input = batch['enm_vals'] #TODO: manage the loading of the anm input
trail_idcs = torch.argmax((batch['S'] == 0).int(), dim=1)
trail_idcs[trail_idcs == 0] = batch['S'].shape[1] # For sequences without padding
# # #TODO: test on one example - remove later
# # trail_idcs = trail_idcs[0].unsqueeze(0)
# # # ###########################################################################
# # # #### TODO: change back to precomputed GT_FLEX once debugged ###############
# dl_gtseq = batch['S']
# dl_anm = batch['enm_vals']
# attention_mask = torch.zeros_like(batch['mask'])
# for i in range(attention_mask.size(0)):
# attention_mask[i, :trail_idcs[i]] = 1
# dl_predflex_bs4 = self.flex_model(None, dl_anm, trail_idcs, attention_mask = attention_mask, sampled_pmpnn_sequence = dl_gtseq, alphabet='pmpnn') #['predicted_flex'][:,:-1,0]
# dl_predflex_bs1 = self.flex_model(None, dl_anm[0].unsqueeze(0), trail_idcs[0].unsqueeze(0) , attention_mask = attention_mask[0].unsqueeze(0), sampled_pmpnn_sequence = dl_gtseq[0].unsqueeze(0), alphabet='pmpnn') #['predicted_flex'][:,:-1,0]
# testseq = 'MKKAVINGEQIRSISDLHQTLKKELALPEYYGENLDALWDCLTGWVEYPLVLEWRQFEQSKQLTENGAESVLQVFREAKAEGADITIILS'
# tokenizer_predflex_bs4 = self.flex_model(None, dl_anm[0,:90].unsqueeze(0), trail_idcs[0].unsqueeze(0) , attention_mask = attention_mask[0,:90].unsqueeze(0), sampled_pmpnn_sequence = testseq, alphabet='aa') #['predicted_flex'][:,:-1,0] #['predicted_flex'][:,:-1,0]
# import pdb; pdb.set_trace()
# input_ids_predflex_bs4 = self.flex_model(dl_gtseq, dl_anm, trail_idcs, attention_mask = attention_mask, sampled_pmpnn_sequence = None, alphabet='aa') #['predicted_flex'][:,:-1,0]
# gt_flex = batch['gt_flex']
# # ####
# import pdb; pdb.set_trace() #check the mask and the gt_flex vs. onthefly computed gt_flex
# #TODO: here fix the mask for the prottrans and clean this,
# # the mask should have all 1s where there is sequence or eos token
# attention_mask = ...
# if self.hparams.get_gt_flex_onthefly:
# cache_keys = list(batch['title'])
# # Check if all cache_keys are in self.gt_flex_cache
# all_keys_in_cache = all(cache_key in self.model.gt_flex_cache for cache_key in cache_keys)
# if not all_keys_in_cache:
# gt_flex = self.flex_model(None, anm_input, trail_idcs, attention_mask=attention_mask, sampled_pmpnn_sequence=gt_seq, alphabet='pmpnn')['predicted_flex'][:,:-1,0]
# for key, val in zip(cache_keys, gt_flex):
# #TODO: iteruje to spravne?
# self.model.gt_flex_cache[key] = val
# else:
# retrieved_gt_flexs = []
# for key in cache_keys:
# _gt_flex = self.model.gt_flex_cache[key]
# retrieved_gt_flexs.append(_gt_flex)
# gt_flex = torch.cat(retrieved_gt_flexs, dim=0) #TODO: concat spravne?
# else:
# raise NotImplementedError('The precomputed data were not realiable.')
# gt_flex = batch['gt_flex']
# ###########################################################################
attention_mask = torch.zeros_like(batch['mask'])
for i in range(attention_mask.size(0)):
attention_mask[i, :trail_idcs[i]] = 1
#Original sequence loss
seq_loss = self.cross_entropy(pred_log_probs.permute(0,2,1), gt_seq)
seq_loss = (seq_loss*_mask).sum()/(_mask.sum())
#New Dynamics-aware loss
flex_model_input = pred_log_probs.permute(0,2,1)
pred_flex = self.flex_model(flex_model_input, anm_input, trail_idcs, attention_mask=attention_mask)['predicted_flex'][:,:-1,0]
#check here that the loss function is working properly (with the masking and all)
# import pdb; pdb.set_trace()
_filter_nans_mask = ~torch.isnan(pred_flex) & ~torch.isnan(gt_flex)
flex_loss = self.flex_loss_fn(pred_flex[_filter_nans_mask]*_mask[_filter_nans_mask], gt_flex[_filter_nans_mask]*_mask[_filter_nans_mask])
_flex_mask = _mask*_filter_nans_mask
_flex_mask = _flex_mask.int()
flex_loss = flex_loss.sum()/_flex_mask.sum()
retVal ={'seq_loss':seq_loss, 'flex_loss':flex_loss, 'pred_flex':pred_flex, 'flex_mask':_flex_mask, 'gt_flex':gt_flex}
if self.hparams.test_engineering and self.hparams.use_dynamics:
retVal['eng_mask'] = batch['eng_mask']
retVal['original_gt_flex'] = batch['original_gt_flex']
retVal['gt_seq'] = batch['S']
retVal['pred_logprobs'] = pred_log_probs
return retVal
def configure_loss(self):
def loss_function(pred_angle, angles, pred_seq, seqs, seq_loss_mask, angle_loss_mask):
angle_loss = self.MSE(torch.cat([angles[...,:1],torch.sin(angles[...,1:3]), torch.cos(angles[...,1:3])],dim=-1),
torch.cat([pred_angle[...,:1],torch.sin(pred_angle[...,1:3]), torch.cos(pred_angle[...,1:3])],dim=-1))
angle_loss = angle_loss[angle_loss_mask].sum(dim=-1).mean()
logits = pred_seq.permute(0,2,1)
seq_loss = self.cross_entropy(logits, seqs)
seq_loss = seq_loss[seq_loss_mask].mean()
metric=Perplexity()
metric.update(pred_seq[seq_loss_mask][None,...].cpu(), seqs[seq_loss_mask][None,...].cpu())
perp = metric.compute()
return {"angle_loss": angle_loss, "seq_loss": seq_loss, "perp":perp}
self.loss_function = loss_function
def load_model(self):
params = OmegaConf.load(f'configs/{self.hparams.model_name}.yaml')
params.update(self.hparams)
if self.hparams.model_name == 'GraphTrans':
from src.models.graphtrans_model import GraphTrans_Model
self.model = GraphTrans_Model(params)
if self.hparams.model_name == 'StructGNN':
from src.models.structgnn_model import StructGNN_Model
self.model = StructGNN_Model(params)
if self.hparams.model_name == 'GVP':
from src.models.gvp_model import GVP_Model
self.model = GVP_Model(params)
if self.hparams.model_name == 'GCA':
from src.models.gca_model import GCA_Model
self.model = GCA_Model(params)
if self.hparams.model_name == 'AlphaDesign':
from src.models.alphadesign_model import AlphaDesign_Model
self.model = AlphaDesign_Model(params)
if self.hparams.model_name == 'ProteinMPNN':
from src.models.proteinmpnn_model import ProteinMPNN_Model
self.model = ProteinMPNN_Model(params)
if self.hparams.model_name == 'ESMIF':
pass
if self.hparams.model_name == 'PiFold':
from src.models.pifold_model import PiFold_Model
self.model = PiFold_Model(params)
if self.hparams.model_name == 'KWDesign':
from src.models.kwdesign_model import KWDesign_model#Design_Model
self.model = KWDesign_model(params) #Design_Model(params) - this required to significantly change the constructor of Design_Model
if self.hparams.model_name == 'E3PiFold':
from src.models.E3PiFold_model import E3PiFold
self.model = E3PiFold(params)
def load_flex_predictor(self):
from src.models.anm_prottrans import ANMAwareFlexibilityProtTrans
flex_params = load_yaml_config(f'configs/ANMAwareFlexibilityProtTrans.yaml')
# flex_params_dict = OmegaConf.to_container(flex_params, resolve=True)
self.flex_model = ANMAwareFlexibilityProtTrans(**flex_params)
# consider turning on the gradients for debug purposes
self.flex_model.eval()
for params in self.flex_model.parameters():
params.requires_grad = False
#also pass it to proteinmpnn:
# self.model.flex_model = self.flex_model
def instancialize(self, Model, **other_args):
""" Instancialize a model using the corresponding parameters
from self.hparams dictionary. You can also input any args
to overwrite the corresponding value in self.hparams.
"""
class_args = inspect.getargspec(Model.__init__).args[1:]
inkeys = self.hparams.keys()
args1 = {}
for arg in class_args:
if arg in inkeys:
args1[arg] = getattr(self.hparams, arg)
args1.update(other_args)
return Model(**args1) |