Spaces:
Running
Running
File size: 50,819 Bytes
9397da2 8b5664f 9397da2 7d966d7 9397da2 d61f366 9397da2 d61f366 9397da2 d61f366 9397da2 8b5664f 9397da2 8b5664f 9397da2 8b5664f 9397da2 8b5664f 9397da2 abb17a0 9397da2 a40c3c7 9397da2 a40c3c7 9397da2 a40c3c7 9397da2 a40c3c7 9397da2 a40c3c7 9397da2 a40c3c7 9397da2 a40c3c7 9397da2 a40c3c7 9397da2 a40c3c7 9397da2 a40c3c7 9397da2 a40c3c7 9397da2 a40c3c7 9397da2 a40c3c7 9397da2 a40c3c7 abb17a0 a40c3c7 abb17a0 a40c3c7 9397da2 a40c3c7 9397da2 e744c31 24a9c81 9397da2 24a9c81 9397da2 24a9c81 9397da2 24a9c81 9397da2 24a9c81 9397da2 24a9c81 9397da2 24a9c81 9397da2 24a9c81 9397da2 24a9c81 9397da2 24a9c81 9397da2 24a9c81 9397da2 24a9c81 9397da2 24a9c81 9397da2 a40c3c7 9397da2 a40c3c7 9397da2 abb17a0 24a9c81 9397da2 a40c3c7 9397da2 a40c3c7 9397da2 a40c3c7 24a9c81 9397da2 5d29d5a 9397da2 5d29d5a 9397da2 5d29d5a 9397da2 5d29d5a 9397da2 5d29d5a 9397da2 5d29d5a 9397da2 5d29d5a 9397da2 5d29d5a 9397da2 5d29d5a 9397da2 5d29d5a 9397da2 5d29d5a 9397da2 5d29d5a 9397da2 5d29d5a 9397da2 abb17a0 ae50e4e 3cb50fc ae50e4e abb17a0 5d29d5a ae50e4e abb17a0 ae50e4e 5d29d5a 188dada a40c3c7 24a9c81 a40c3c7 9397da2 b8ba622 abb17a0 9397da2 5ed1412 9397da2 ae50e4e 5d29d5a 5ed1412 ae50e4e e767e04 ae50e4e 01d9e59 ae50e4e 5d29d5a ae50e4e 5ed1412 ae50e4e 9397da2 a40c3c7 e744c31 9397da2 a40c3c7 9397da2 e744c31 9397da2 a40c3c7 9397da2 e744c31 9397da2 a40c3c7 9397da2 fe60374 a40c3c7 9397da2 fe60374 9397da2 fe60374 9397da2 fe60374 9397da2 fe60374 a40c3c7 fe60374 a40c3c7 fe60374 5d6779c a40c3c7 5d6779c 24a9c81 5d6779c fe60374 9397da2 fe60374 9397da2 a40c3c7 9397da2 866022d 9397da2 5d6779c 9397da2 a40c3c7 fe60374 24a9c81 a40c3c7 fe60374 9397da2 2f25706 24a9c81 9397da2 24a9c81 a40c3c7 9397da2 a40c3c7 9397da2 a40c3c7 b8ba622 ae50e4e | 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000 1001 1002 1003 1004 1005 1006 1007 1008 1009 1010 1011 1012 1013 1014 1015 1016 1017 1018 1019 1020 1021 1022 1023 1024 1025 1026 1027 1028 1029 1030 1031 1032 1033 1034 1035 1036 1037 1038 1039 1040 1041 1042 1043 1044 1045 1046 1047 1048 1049 1050 1051 1052 1053 1054 1055 1056 1057 1058 1059 1060 1061 1062 1063 1064 1065 1066 1067 1068 1069 1070 1071 1072 1073 1074 1075 1076 1077 1078 1079 1080 1081 1082 1083 1084 1085 1086 1087 1088 1089 1090 1091 1092 1093 1094 1095 1096 1097 1098 1099 1100 1101 1102 1103 1104 1105 1106 1107 1108 1109 1110 1111 1112 1113 1114 1115 1116 1117 1118 1119 1120 1121 1122 1123 1124 1125 1126 1127 1128 1129 1130 1131 1132 1133 1134 1135 1136 1137 1138 1139 1140 1141 1142 1143 1144 1145 1146 1147 1148 1149 1150 1151 1152 1153 1154 1155 1156 1157 1158 1159 1160 1161 1162 1163 1164 1165 1166 1167 1168 1169 1170 1171 1172 1173 1174 1175 1176 1177 1178 1179 1180 1181 1182 1183 1184 1185 1186 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201 1202 1203 1204 1205 1206 1207 1208 1209 1210 1211 1212 1213 1214 1215 1216 1217 1218 1219 1220 1221 1222 1223 1224 1225 1226 1227 1228 1229 1230 1231 1232 1233 1234 1235 1236 1237 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283 1284 1285 1286 1287 1288 1289 1290 1291 1292 1293 1294 1295 1296 1297 1298 1299 1300 1301 1302 1303 1304 1305 1306 1307 1308 1309 1310 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 1323 1324 1325 1326 1327 1328 1329 1330 1331 1332 1333 1334 1335 1336 1337 1338 1339 1340 1341 1342 1343 1344 1345 1346 1347 1348 1349 1350 1351 1352 | import gradio_client.utils as _gc_utils
_orig_get_type = _gc_utils.get_type
_orig_json2py = _gc_utils._json_schema_to_python_type
def _patched_get_type(schema):
if isinstance(schema, bool):
schema = {}
return _orig_get_type(schema)
def _patched_json_schema_to_python_type(schema, defs=None):
if isinstance(schema, bool):
schema = {}
return _orig_json2py(schema, defs)
_gc_utils.get_type = _patched_get_type
_gc_utils._json_schema_to_python_type = _patched_json_schema_to_python_type
# βββ Imports βββββββββββββββββββββββββββββββββββββββββββββββββββββββββββββββββββ
import os
import io
import base64
import argparse
from typing import Optional, List, Tuple
import numpy as np
import torch
from torch.utils.data import DataLoader
import selfies
# from rdkit import Chem
import matplotlib
matplotlib.use("Agg")
import matplotlib.pyplot as plt
from matplotlib import cm
from transformers import EsmForMaskedLM, EsmTokenizer, AutoModel, AutoTokenizer
from Bio.PDB import PDBParser, MMCIFParser
from Bio.Data import IUPACData
import gradio as gr
# Project utils (ensure these exist in your repository)
from utils.metric_learning_models_att_maps import Pre_encoded, ExplainBind
from utils.foldseek_util import get_struc_seq
# βββββββββββββββββββββ Paths & Logos βββββββββββββββββββββ
ROOT = os.path.dirname(os.path.abspath(__file__))
ASSET_DIR = os.path.join(ROOT, "utils")
LOSCAZLO_LOGO = os.path.join(ASSET_DIR, "loscalzo.png")
def _load_logo_b64(path):
if not os.path.exists(path):
return ""
with open(path, "rb") as f:
return base64.b64encode(f.read()).decode("utf-8")
LOSCAZLO_B64 = _load_logo_b64(LOSCAZLO_LOGO)
# βββββββββββββββββββββ Configurable constants βββββββββββββββββββββ
# UI-visible names (Halogen bonding removed)
INTERACTION_NAMES = [
"Hydrogen bonding",
"Salt Bridging",
"ΟβΟ Stacking",
"CationβΟ",
"Hydrophobic",
"Van der Waals",
"Overall Interaction",
]
# Map visible indices (0..5 = specific, 6 = combined) to underlying channel indices
# Underlying channels originally had Halogen at index=5 (0-based). We skip 5 entirely.
VISIBLE2UNDERLYING = [1, 2, 3, 4, 6, 0] # HB, Salt, Pi, Cation-Pi, Hydro, VdW
N_VISIBLE_SPEC = len(VISIBLE2UNDERLYING) # 6
# βββββ Helper utilities βββββββββββββββββββββββββββββββββββββββββββ
three2one = {k.upper(): v for k, v in IUPACData.protein_letters_3to1.items()}
three2one.update({"MSE": "M", "SEC": "C", "PYL": "K"})
STANDARD_AA_SET = set("ACDEFGHIKLMNPQRSTVWY") # Uppercase FASTA amino acids
def simple_seq_from_structure(path: str) -> str:
"""Extract the longest chain and return standard 1-letter amino acid sequence."""
parser = MMCIFParser(QUIET=True) if path.endswith(".cif") else PDBParser(QUIET=True)
structure = parser.get_structure("P", path)
chains = list(structure.get_chains())
if not chains:
return ""
chain = max(chains, key=lambda c: len(list(c.get_residues())))
seq = []
for res in chain:
resname = res.get_resname().upper()
if resname in three2one:
seq.append(three2one[resname])
# else: skip non-standard residues
return "".join(seq)
# def smiles_to_selfies(smiles_text: str) -> Optional[str]:
# """Validate and convert SMILES to SELFIES; return None if invalid."""
# try:
# mol = Chem.MolFromSmiles(smiles_text)
# if mol is None:
# return None
# return selfies.encoder(smiles_text)
# except Exception:
# return None
def smiles_to_selfies(smiles_text: str) -> Optional[str]:
try:
sf = selfies.encoder(smiles_text)
smiles_back = selfies.decoder(sf)
if not smiles_back:
return None
return sf
except Exception:
return None
def detect_protein_type(seq: str) -> str:
"""
Heuristic for protein input:
- All uppercase and only the standard 20 amino acids β 'fasta'
- Otherwise (contains lowercase or non-standard characters) β 'sa'
"""
s = (seq or "").strip()
if not s:
return "fasta"
up = s.upper()
only_aa = all(ch in STANDARD_AA_SET for ch in up)
all_upper = (s == up)
return "fasta" if (only_aa and all_upper) else "sa"
def detect_ligand_type(text: str) -> str:
"""
Heuristic for ligand input:
- Starts with '[' and contains ']' β 'selfies'
- Otherwise β 'smiles'
"""
t = (text or "").strip()
if not t:
return "smiles"
return "selfies" if (t.startswith("[") and ("]" in t)) else "smiles"
def parse_config():
"""Parse command-line options."""
p = argparse.ArgumentParser()
p.add_argument("--agg_mode", type=str, default="mean_all_tok")
p.add_argument("--group_size", type=int, default=1)
p.add_argument("--fusion", default="CAN")
p.add_argument("--device", default="cuda" if torch.cuda.is_available() else "cpu")
p.add_argument("--save_path_prefix", default="save_model_ckp/") # Root folder containing checkpoints
p.add_argument("--dataset", default="Human")
return p.parse_args()
args = parse_config()
DEVICE = args.device
# βββββ Dynamic model registry βββββββββββββββββββββββββββββββββββββ
PROT_MODELS = {
"sa": "westlake-repl/SaProt_650M_AF2",
"fasta": "facebook/esm2_t33_650M_UR50D",
}
DRUG_MODELS = {
"selfies": "HUBioDataLab/SELFormer",
# "smiles": "ibm/MoLFormer-XL-both-10pct",
}
def load_encoders(ptype: str, ltype: str, args):
"""
Dynamically load encoders and tokenisers based on input types.
Returns: (prot_tokenizer, prot_model, drug_tokenizer, drug_model, encoding_module)
"""
# Protein encoder
if ptype == "fasta":
prot_path = PROT_MODELS["fasta"]
prot_tokenizer = EsmTokenizer.from_pretrained(prot_path, do_lower_case=False)
prot_model = EsmForMaskedLM.from_pretrained(prot_path)
else: # 'sa'
prot_path = PROT_MODELS["sa"]
prot_tokenizer = EsmTokenizer.from_pretrained(prot_path)
prot_model = EsmForMaskedLM.from_pretrained(prot_path)
drug_path = DRUG_MODELS["selfies"]
drug_tokenizer = AutoTokenizer.from_pretrained(drug_path)
drug_model = AutoModel.from_pretrained(drug_path)
# Ligand encoder
# if ltype == "smiles":
# drug_path = DRUG_MODELS["smiles"]
# drug_tokenizer = AutoTokenizer.from_pretrained(drug_path, trust_remote_code=True)
# drug_model = AutoModel.from_pretrained(drug_path, deterministic_eval=True, trust_remote_code=True)
# else: # 'selfies'
# drug_path = DRUG_MODELS["selfies"]
# drug_tokenizer = AutoTokenizer.from_pretrained(drug_path)
# drug_model = AutoModel.from_pretrained(drug_path)
# Wrap encoders with Pre_encoded module
encoding = Pre_encoded(prot_model, drug_model, args).to(DEVICE)
return prot_tokenizer, prot_model, drug_tokenizer, drug_model, encoding
def make_collate_fn(prot_tokenizer, drug_tokenizer):
"""Create a batch collation function using the given tokenisers."""
def _collate_fn(batch):
query1, query2, scores = zip(*batch)
query_encodings1 = prot_tokenizer(
list(query1), max_length=512, padding="max_length", truncation=True,
add_special_tokens=True, return_tensors="pt",
)
query_encodings2 = drug_tokenizer(
list(query2), max_length=512, padding="max_length", truncation=True,
add_special_tokens=True, return_tensors="pt",
)
scores = torch.tensor(list(scores))
attention_mask1 = query_encodings1["attention_mask"].bool()
attention_mask2 = query_encodings2["attention_mask"].bool()
return (query_encodings1["input_ids"], attention_mask1,
query_encodings2["input_ids"], attention_mask2, scores)
return _collate_fn
def get_case_feature(model, loader):
"""Generate features for one proteinβligand pair using the provided model."""
model.eval()
with torch.no_grad():
for p_ids, p_mask, d_ids, d_mask, _ in loader:
p_ids, p_mask = p_ids.to(DEVICE), p_mask.to(DEVICE)
d_ids, d_mask = d_ids.to(DEVICE), d_mask.to(DEVICE)
p_emb, d_emb = model.encoding(p_ids, p_mask, d_ids, d_mask)
return [(p_emb.cpu(), d_emb.cpu(),
p_ids.cpu(), d_ids.cpu(),
p_mask.cpu(), d_mask.cpu(), None)]
# βββββββββββββββ SELFIES grouping by ORIGINAL string βββββββββββββ
def _group_rows_by_selfies_string(n_rows: int, selfies_str: str):
"""
Partition the attention matrix's n_rows along ligand axis into groups per SELFIES token '[ ... ]'.
Each group is a contiguous row span; we assign rows β equally using linspace.
Returns:
groups: List[(start_row, end_row)] inclusive
labels: List['[X]','[=O]', ...]
"""
if n_rows <= 0:
return [], []
try:
toks = list(selfies.split_selfies((selfies_str or "").strip()))
except Exception:
toks = []
if not toks:
# Fallback: treat whole ligand as one token
return [(0, n_rows - 1)], [selfies_str or "[?]"]
g = len(toks)
edges = np.linspace(0, n_rows, g + 1, dtype=int)
groups = []
for i in range(g):
s, e = edges[i], edges[i + 1] - 1
if e < s:
e = s
groups.append((s, e))
return groups, toks
def _connected_components_2d(mask: torch.Tensor) -> List[List[Tuple[int, int]]]:
"""4-connected components over a 2D boolean mask (rows=ligand tokens, cols=protein residues)."""
h, w = mask.shape
visited = torch.zeros_like(mask, dtype=torch.bool)
comps: List[List[Tuple[int,int]]] = []
for i in range(h):
for j in range(w):
if mask[i, j] and not visited[i, j]:
stack = [(i, j)]
visited[i, j] = True
comp = []
while stack:
r, c = stack.pop()
comp.append((r, c))
for dr, dc in ((1,0), (-1,0), (0,1), (0,-1)):
rr, cc = r + dr, c + dc
if 0 <= rr < h and 0 <= cc < w and mask[rr, cc] and not visited[rr, cc]:
visited[rr, cc] = True
stack.append((rr, cc))
comps.append(comp)
return comps
def _format_component_table(
components,
p_tokens,
d_tokens,
*,
mode: str = "pair", # "pair" | "residue"
):
"""
Render HTML table for highlighted interaction components.
Parameters
----------
components : List[List[Tuple[int,int]]]
Each component is a list of (ligand_index, protein_index) pairs.
p_tokens : List[str]
Protein token strings.
d_tokens : List[str]
Ligand token strings.
mode : str
"pair" -> show Protein range + Ligand range
"residue" -> show Protein residue(s) only
"""
# ----------------------------
# Residue-only mode
# ----------------------------
if mode == "residue":
if not components:
return (
"<h4 style='margin:12px 0 6px'>Highlighted protein residues</h4>"
"<p>No residues selected.</p>"
)
rows = []
for comp in components:
# comp = [(lig_idx, prot_idx), ...]
prot_indices = [j for (_, j) in comp]
p_start, p_end = min(prot_indices), max(prot_indices)
p_s_idx, p_e_idx = p_start + 1, p_end + 1
p_s_tok = p_tokens[p_start] if p_start < len(p_tokens) else "?"
p_e_tok = p_tokens[p_end] if p_end < len(p_tokens) else "?"
if p_start == p_end:
label = f"{p_s_idx}:{p_s_tok}"
else:
label = f"{p_s_idx}:{p_s_tok} β {p_e_idx}:{p_e_tok}"
rows.append(
f"<tr>"
f"<td style='border:1px solid #ddd;padding:6px'>"
f"<strong>{label}</strong>"
f"</td>"
f"</tr>"
)
return (
"<h4 style='margin:12px 0 6px'>Highlighted protein residues</h4>"
"<table style='border-collapse:collapse;margin:6px 0 16px;width:60%'>"
"<thead><tr style='background:#f5f5f5'>"
"<th style='border:1px solid #ddd;padding:6px'>Protein residue(s)</th>"
"</tr></thead>"
f"<tbody>{''.join(rows)}</tbody></table>"
)
# ----------------------------
# Pair mode (default behaviour)
# ----------------------------
if not components:
return (
"<h4 style='margin:12px 0 6px'>Highlighted interaction segments</h4>"
"<p>No interaction pairs selected.</p>"
)
rows = []
for comp in components:
lig_indices = [i for (i, _) in comp]
prot_indices = [j for (_, j) in comp]
d_start, d_end = min(lig_indices), max(lig_indices)
p_start, p_end = min(prot_indices), max(prot_indices)
d_s_idx, d_e_idx = d_start + 1, d_end + 1
p_s_idx, p_e_idx = p_start + 1, p_end + 1
d_s_tok = d_tokens[d_start] if d_start < len(d_tokens) else "?"
d_e_tok = d_tokens[d_end] if d_end < len(d_tokens) else "?"
p_s_tok = p_tokens[p_start] if p_start < len(p_tokens) else "?"
p_e_tok = p_tokens[p_end] if p_end < len(p_tokens) else "?"
rows.append(
f"<tr>"
f"<td style='border:1px solid #ddd;padding:6px'>Protein: "
f"<strong>{p_s_idx}:{p_s_tok}</strong>"
f"{' β <strong>'+str(p_e_idx)+':'+p_e_tok+'</strong>' if p_end > p_start else ''}"
f"</td>"
f"<td style='border:1px solid #ddd;padding:6px'>Ligand: "
f"<strong>{d_s_idx}:{d_s_tok}</strong>"
f"{' β <strong>'+str(d_e_idx)+':'+d_e_tok+'</strong>' if d_end > d_start else ''}"
f"</td>"
f"</tr>"
)
return (
"<h4 style='margin:12px 0 6px'>Highlighted Binding site</h4>"
"<table style='border-collapse:collapse;margin:6px 0 16px;width:100%'>"
"<thead><tr style='background:#f5f5f5'>"
"<th style='border:1px solid #ddd;padding:6px'>Protein range</th>"
"<th style='border:1px solid #ddd;padding:6px'>Ligand range</th>"
"</tr></thead>"
f"<tbody>{''.join(rows)}</tbody></table>"
)
def visualize_attention_and_ranges(
model,
feats,
head_idx: int,
*,
mode: str = "pair", # "pair" | "residue"
topk_pairs: int = 1, # Top-K interaction pairs (default=1)
topk_residues: int = 1, # Top-K residues (1β20, default=1)
prot_tokenizer=None,
drug_tokenizer=None,
ligand_type: str = "selfies",
raw_selfies: Optional[str] = None,
) -> Tuple[str, str]:
"""
Visualise interaction attention with two complementary Top-K modes.
Modes
-----
mode="pair":
- Select Top-K highest-scoring (ligand token, protein residue) pairs
- Project selected pairs onto protein axis (evaluation-aligned)
- Default K = 1 (user-controlled)
mode="residue":
- Aggregate attention over ligand dimension
- Rank residues by aggregated score
- Select Top-K residues (1β100)
- Default K = 1 (binding pocket discovery)
Notes
-----
- Per-head GLOBAL SUM normalisation (matches test()).
- Specific heads mapped exactly to GT channels.
- Combined head = sum of 6 specific heads (NOT overall=7).
"""
assert mode in {"pair", "residue"}
assert topk_pairs >= 1
assert 1 <= topk_residues <= 100
model.eval()
with torch.no_grad():
# --------------------------------------------------
# Unpack features
# --------------------------------------------------
p_emb, d_emb, p_ids, d_ids, p_mask, d_mask, _ = feats[0]
p_emb, d_emb = p_emb.to(DEVICE), d_emb.to(DEVICE)
p_mask, d_mask = p_mask.to(DEVICE), d_mask.to(DEVICE)
# --------------------------------------------------
# Forward
# --------------------------------------------------
prob, att_pd = model(p_emb, d_emb, p_mask, d_mask)
att = att_pd.squeeze(0)
prob = prob.item()
# expected: [Ld, Lp, 8] or [8, Ld, Lp]
# --------------------------------------------------
# Channel mapping (must match test())
# --------------------------------------------------
VISIBLE2UNDERLYING = [1, 2, 3, 4, 6, 0] # HB, Salt, Pi, Cat-Pi, Hydro, VdW
N_VISIBLE_SPEC = 6
def select_channel_map(att_):
if att_.dim() == 3 and att_.shape[-1] >= 8:
if head_idx < N_VISIBLE_SPEC:
return att_[:, :, VISIBLE2UNDERLYING[head_idx]].cpu()
return att_[:, :, VISIBLE2UNDERLYING].sum(dim=2).cpu()
if att_.dim() == 3 and att_.shape[0] >= 8:
if head_idx < N_VISIBLE_SPEC:
return att_[VISIBLE2UNDERLYING[head_idx]].cpu()
return att_[VISIBLE2UNDERLYING].sum(dim=0).cpu()
return att_.squeeze().cpu()
att2d_raw = select_channel_map(att) # [Ld, Lp]
# --------------------------------------------------
# Per-head GLOBAL SUM normalisation (critical)
# --------------------------------------------------
att2d_raw = att2d_raw / (att2d_raw.sum() + 1e-8)
# --------------------------------------------------
# Token decoding & trimming
# --------------------------------------------------
def clean_tokens(ids, tokenizer):
toks = tokenizer.convert_ids_to_tokens(ids.tolist())
if hasattr(tokenizer, "all_special_tokens"):
toks = [t for t in toks if t not in tokenizer.all_special_tokens]
return toks
p_tokens_full = clean_tokens(p_ids[0], prot_tokenizer)
d_tokens_full = clean_tokens(d_ids[0], drug_tokenizer)
n_d = min(len(d_tokens_full), att2d_raw.size(0))
n_p = min(len(p_tokens_full), att2d_raw.size(1))
att2d = att2d_raw[:n_d, :n_p]
p_tokens = p_tokens_full[:n_p]
d_tokens = d_tokens_full[:n_d]
p_indices = list(range(1, n_p + 1))
d_indices = list(range(1, n_d + 1))
# --------------------------------------------------
# SELFIES row merging (for interpretability)
# --------------------------------------------------
if ligand_type == "selfies" and raw_selfies:
groups, labels = _group_rows_by_selfies_string(att2d.size(0), raw_selfies)
if groups:
merged = []
for s, e in groups:
merged.append(att2d[s:e + 1].mean(dim=0, keepdim=True))
att2d = torch.cat(merged, dim=0)
d_tokens = labels
d_indices = list(range(1, len(labels) + 1))
# --------------------------------------------------
# Top-K selection (two modes, STRICT RANKING)
# --------------------------------------------------
if mode == "pair":
flat = att2d.reshape(-1)
k_eff = min(topk_pairs, flat.numel())
topk_vals, topk_idx = torch.topk(flat, k=k_eff)
mask_top = torch.zeros_like(flat, dtype=torch.bool)
mask_top[topk_idx] = True
mask_top = mask_top.view_as(att2d)
rows = []
n_cols = att2d.size(1)
for rank, (val, linear_idx) in enumerate(zip(topk_vals, topk_idx), start=1):
i = (linear_idx // n_cols).item()
j = (linear_idx % n_cols).item()
rows.append(
f"<tr>"
f"<td style='border:1px solid #ddd;padding:6px'><strong>Top {rank}</strong></td>"
f"<td style='border:1px solid #ddd;padding:6px'>Protein: <strong>{j+1}:{p_tokens[j]}</strong></td>"
f"<td style='border:1px solid #ddd;padding:6px'>Ligand: <strong>{i+1}:{d_tokens[i]}</strong></td>"
f"<td style='border:1px solid #ddd;padding:6px'>Score: <strong>{val.item():.6f}</strong></td>"
f"</tr>"
)
ranges_html = (
"<h4 style='margin:12px 0 6px'>Top-K Interaction Pairs (ranked by attention score)</h4>"
"<table style='border-collapse:collapse;margin:6px 0 16px;width:100%'>"
"<thead><tr style='background:#f5f5f5'>"
"<th style='border:1px solid #ddd;padding:6px'>Rank</th>"
"<th style='border:1px solid #ddd;padding:6px'>Protein</th>"
"<th style='border:1px solid #ddd;padding:6px'>Ligand</th>"
"<th style='border:1px solid #ddd;padding:6px'>Attention Score</th>"
"</tr></thead>"
f"<tbody>{''.join(rows)}</tbody></table>"
)
else:
# --- STRICT Top-K residue ranking ---
residue_score = att2d.sum(dim=0)
k_eff = min(topk_residues, residue_score.numel())
topk_vals, topk_res_idx = torch.topk(residue_score, k=k_eff)
mask_top = torch.zeros_like(att2d, dtype=torch.bool)
mask_top[:, topk_res_idx] = True
rows = []
for rank, (val, j) in enumerate(zip(topk_vals, topk_res_idx), start=1):
j = j.item()
rows.append(
f"<tr>"
f"<td style='border:1px solid #ddd;padding:6px'><strong>Top {rank}</strong></td>"
f"<td style='border:1px solid #ddd;padding:6px'>"
f"Protein residue: <strong>{j+1}:{p_tokens[j]}</strong>"
f"</td>"
f"<td style='border:1px solid #ddd;padding:6px'>"
f"Aggregated Score: <strong>{val.item():.6f}</strong>"
f"</td>"
f"</tr>"
)
ranges_html = (
"<h4 style='margin:12px 0 6px'>Top-K Residues (ranked by aggregated attention)</h4>"
"<table style='border-collapse:collapse;margin:6px 0 16px;width:100%'>"
"<thead><tr style='background:#f5f5f5'>"
"<th style='border:1px solid #ddd;padding:6px'>Rank</th>"
"<th style='border:1px solid #ddd;padding:6px'>Protein Residue</th>"
"<th style='border:1px solid #ddd;padding:6px'>Aggregated Score</th>"
"</tr></thead>"
f"<tbody>{''.join(rows)}</tbody></table>"
)
# --------------------------------------------------
# Connected components (visual coherence)
# --------------------------------------------------
# p_tokens_orig = p_tokens.copy()
# d_tokens_orig = d_tokens.copy()
# components = _connected_components_2d(mask_top)
# ranges_html = _format_component_table(
# components,
# p_tokens_orig,
# d_tokens_orig,
# mode=mode,
# )
# --------------------------------------------------
# Crop to union of selected rows / columns
# --------------------------------------------------
rows_keep = mask_top.any(dim=1)
cols_keep = mask_top.any(dim=0)
if not rows_keep.any():
rows_keep[:] = True
if not cols_keep.any():
cols_keep[:] = True
vis = att2d[rows_keep][:, cols_keep]
d_tokens_vis = [t for k, t in zip(rows_keep.tolist(), d_tokens) if k]
p_tokens_vis = [t for k, t in zip(cols_keep.tolist(), p_tokens) if k]
d_indices_vis = [i for k, i in zip(rows_keep.tolist(), d_indices) if k]
p_indices_vis = [i for k, i in zip(cols_keep.tolist(), p_indices) if k]
# Cap columns for readability
if vis.size(1) > 150:
topc = torch.topk(vis.sum(0), k=150).indices
vis = vis[:, topc]
p_tokens_vis = [p_tokens_vis[i] for i in topc]
p_indices_vis = [p_indices_vis[i] for i in topc]
# --------------------------------------------------
# Plot
# --------------------------------------------------
x_labels = [f"{i}:{t}" for i, t in zip(p_indices_vis, p_tokens_vis)]
y_labels = [f"{i}:{t}" for i, t in zip(d_indices_vis, d_tokens_vis)]
fig_w = min(22, max(6, len(x_labels) * 0.6))
fig_h = min(24, max(6, len(y_labels) * 0.8))
fig, ax = plt.subplots(figsize=(fig_w, fig_h))
im = ax.imshow(vis.numpy(), aspect="auto", cmap=cm.viridis)
title = INTERACTION_NAMES[head_idx]
suffix = "Top-K pairs" if mode == "pair" else "Top-K residues"
ax.set_title(f"Ligand Γ Protein β {title} ({suffix})", fontsize=10, pad=8)
ax.set_xlabel("Protein residues")
ax.set_ylabel("Ligand tokens")
ax.set_xticks(range(len(x_labels)))
ax.set_xticklabels(x_labels, rotation=90, fontsize=8)
ax.set_yticks(range(len(y_labels)))
ax.set_yticklabels(y_labels, fontsize=7)
ax.xaxis.tick_top()
ax.xaxis.set_label_position("top")
ax.tick_params(axis="x", bottom=False)
fig.colorbar(im, fraction=0.026, pad=0.01)
fig.tight_layout()
# --------------------------------------------------
# Export
# --------------------------------------------------
buf_png = io.BytesIO()
buf_pdf = io.BytesIO()
fig.savefig(buf_png, format="png", dpi=140)
fig.savefig(buf_pdf, format="pdf")
plt.close(fig)
png_b64 = base64.b64encode(buf_png.getvalue()).decode()
pdf_b64 = base64.b64encode(buf_pdf.getvalue()).decode()
heat_html = f"""
<div style='position:relative'>
<a href='data:application/pdf;base64,{pdf_b64}' download='attention_{head_idx+1}.pdf'
style='position:absolute;top:10px;right:10px;
background:#111;color:#fff;padding:8px 12px;
border-radius:10px;font-size:.85rem;text-decoration:none'>
Download PDF
</a>
<img src='data:image/png;base64,{png_b64}' />
</div>
"""
# ------------------------------
# Probability display card
# ------------------------------
if prob >= 0.8:
bg = "#ecfdf5"
border = "#10b981"
label = "High binding confidence"
elif prob >= 0.4:
bg = "#eff6ff"
border = "#3b82f6"
label = "Moderate binding confidence"
else:
bg = "#fef2f2"
border = "#ef4444"
label = "Low binding confidence"
prob_html = f"""
<div style='margin:10px 0 18px;
padding:14px 16px;
border-left:5px solid {border};
border-radius:12px;
background:{bg};
font-size:1rem'>
<div style='font-weight:600;margin-bottom:4px'>
Predicted Binding Probability
</div>
<div style='font-size:1.4rem;font-weight:700'>
{prob:.4f}
</div>
<div style='font-size:0.85rem;color:#64748b;margin-top:4px'>
{label}
</div>
</div>
"""
return prob_html, ranges_html, heat_html
# βββββ Gradio callbacks βββββββββββββββββββββββββββββββββββββββββ
ROOT = os.path.dirname(os.path.abspath(__file__))
FOLDSEEK_BIN = os.path.join(ROOT, "utils", "foldseek")
def extract_aa_seq_cb(structure_file, protein_text):
"""
Extract plain amino acid sequence from uploaded PDB/mmCIF.
"""
prot_seq_out = (protein_text or "").strip()
msgs = []
if structure_file is None:
return prot_seq_out, "<p style='color:red'>Please upload a structure file.</p>"
try:
seq = simple_seq_from_structure(structure_file.name)
if seq:
prot_seq_out = seq
msgs.append("<li>β
Extracted <b>amino acid sequence</b> from structure.</li>")
else:
msgs.append("<li>β No valid amino acid sequence found.</li>")
except Exception as e:
msgs.append(f"<li>β Extraction failed: <b>{e}</b></li>")
status_html = (
"<div style='margin:10px 0;padding:10px 12px;"
"border:1px solid #e5e7eb;border-radius:10px;"
"background:#f8fafc;color:#0f172a'>"
"<ul style='margin:0 0 0 18px;padding:0'>"
f"{''.join(msgs)}"
"</ul></div>"
)
return prot_seq_out, status_html
def extract_sa_seq_cb(structure_file, protein_text):
prot_seq_out = (protein_text or "").strip()
msgs = []
if structure_file is None:
return prot_seq_out, "<p style='color:red'>Please upload a structure file.</p>"
try:
parsed = get_struc_seq(
FOLDSEEK_BIN,
structure_file.name,
None,
plddt_mask=False,
)
first_chain = next(iter(parsed))
_, _, struct_seq = parsed[first_chain]
if struct_seq:
prot_seq_out = struct_seq
msgs.append("<li>β
Extracted <b>structure-aware sequence</b> (SA).</li>")
else:
msgs.append("<li>β Structure parsed but no SA sequence found.</li>")
except Exception as e:
msgs.append(f"<li>β SA extraction failed: <b>{e}</b></li>")
status_html = (
"<div style='margin:10px 0;padding:10px 12px;"
"border:1px solid #e5e7eb;border-radius:10px;"
"background:#f8fafc;color:#0f172a'>"
"<ul style='margin:0 0 0 18px;padding:0'>"
f"{''.join(msgs)}"
"</ul></div>"
)
return prot_seq_out, status_html
def _choose_ckpt_by_types(prot_seq: str, ligand_text: str) -> Tuple[str, str, str]:
"""Return (folder_name, protein_type, ligand_type) for checkpoint routing."""
ptype = detect_protein_type(prot_seq)
ltype = detect_ligand_type(ligand_text)
folder = f"{ptype}_{ltype}" # sa_selfies / fasta_selfies / sa_smiles / fasta_smiles
return folder, ptype, ltype
def inference_cb(prot_seq, drug_seq, head_choice, topk_choice):
"""
Inference callback supporting two Top-K modes:
- Top-K interaction pairs
- Top-K residues
"""
# ------------------------------
# Input validation
# ------------------------------
if not prot_seq or not prot_seq.strip():
return "<p style='color:red'>Please extract or enter a protein sequence first.</p>"
if not drug_seq or not drug_seq.strip():
return "<p style='color:red'>Please enter a ligand sequence (SELFIES or SMILES).</p>"
prot_seq = prot_seq.strip()
drug_seq_in = drug_seq.strip()
# ------------------------------
# Detect types & checkpoint routing
# ------------------------------
folder, ptype, ltype = _choose_ckpt_by_types(prot_seq, drug_seq_in)
# Ligand normalisation: always tokenise as SELFIES
if ltype == "smiles":
conv = smiles_to_selfies(drug_seq_in)
if conv is None:
return (
"<p style='color:red'>SMILESβSELFIES conversion failed. "
"The SMILES appears invalid.</p>",
"",
)
drug_seq_for_tokenizer = conv
else:
drug_seq_for_tokenizer = drug_seq_in
# π εΌΊεΆη»δΈη±»ε
ltype = "selfies"
ligand_type_flag = "selfies"
raw_selfies = drug_seq_for_tokenizer
folder = f"{ptype}_selfies"
# # Ligand normalisation: always tokenise as SELFIES
# if ltype == "smiles":
# conv = smiles_to_selfies(drug_seq_in)
# if conv is None:
# return (
# "<p style='color:red'>SMILESβSELFIES conversion failed. "
# "The SMILES appears invalid.</p>",
# "",
# )
# drug_seq_for_tokenizer = conv
# ligand_type_flag = "selfies"
# else:
# drug_seq_for_tokenizer = drug_seq_in
# ligand_type_flag = "selfies"
# raw_selfies = drug_seq_for_tokenizer if ligand_type_flag == "selfies" else None
# ------------------------------
# Load encoders
# ------------------------------
prot_tok, prot_m, drug_tok, drug_m, encoding = load_encoders(ptype, ltype, args)
loader = DataLoader(
[(prot_seq, drug_seq_for_tokenizer, 1)],
batch_size=1,
collate_fn=make_collate_fn(prot_tok, drug_tok),
)
feats = get_case_feature(encoding, loader)
# ------------------------------
# Load trained checkpoint (if exists)
# ------------------------------
ckpt = os.path.join(args.save_path_prefix, folder, "best_model.ckpt")
model = ExplainBind(1280, 768, args=args).to(DEVICE)
if os.path.isfile(ckpt):
model.load_state_dict(torch.load(ckpt, map_location=DEVICE))
warn_html = (
"<div style='margin:8px 0 14px;padding:8px 10px;"
"border-left:4px solid #10b981;background:#ecfdf5'>"
f"<b>Loaded model:</b> <code>{folder}/best_model.ckpt</code></div>"
)
else:
warn_html = (
"<div style='margin:8px 0 14px;padding:8px 10px;"
"border-left:4px solid #f59e0b;background:#fffbeb'>"
"<b>Warning:</b> checkpoint not found "
f"<code>{folder}/best_model.ckpt</code>. "
"Using randomly initialised weights for visualisation.</div>"
)
# ------------------------------
# Parse interaction head
# ------------------------------
sel = str(head_choice).strip()
if sel in INTERACTION_NAMES:
head_idx = INTERACTION_NAMES.index(sel)
else:
try:
n = int(sel.split(".", 1)[0])
head_idx = max(0, min(len(INTERACTION_NAMES) - 1, n - 1))
except Exception:
head_idx = len(INTERACTION_NAMES) - 1 # Combined Interaction
# ------------------------------
# Parse Top-K value
# ------------------------------
try:
topk = int(str(topk_choice).strip())
except Exception:
topk = 1
topk = max(1, topk)
mode = "residue"
topk_pairs = 1
topk_residues = min(100, topk)
# ------------------------------
# Visualisation
# ------------------------------
prob_html, table_html, heat_html = visualize_attention_and_ranges(
model,
feats,
head_idx,
mode=mode,
topk_pairs=topk_pairs,
topk_residues=topk_residues,
prot_tokenizer=prot_tok,
drug_tokenizer=drug_tok,
ligand_type=ligand_type_flag,
raw_selfies=raw_selfies,
)
full_html = prob_html + table_html + heat_html # β
εΌΊεΆδΈδΈι‘ΊεΊ
return full_html
def clear_cb():
return "", "", "", None, ""
# protein_seq, drug_seq, output_full, structure_file, status_box
# βββββ Gradio interface definition βββββββββββββββββββββββββββββββ
css = """
:root{
--bg:#f8fafc; --card:#f8fafc; --text:#0f172a;
--muted:#6b7280; --border:#e5e7eb; --shadow:0 6px 24px rgba(2,6,23,.06);
--radius:14px; --icon-size:20px;
}
*{box-sizing:border-box}
html,body{background:#fff!important;color:var(--text)!important}
.gradio-container{max-width:1120px;margin:0 auto}
/* Title and subtitle */
h1{
font-family:Inter,ui-sans-serif;letter-spacing:.2px;font-weight:700;
font-size:32px;margin:22px 0 12px;text-align:center
}
.subtle{color:var(--muted);font-size:14px;text-align:center;margin:-6px 0 18px}
/* Card style */
.card{
background:var(--card); border:1px solid var(--border); border-radius:var(--radius);
box-shadow:var(--shadow); padding:22px;
}
/* Top links */
.link-row{display:flex;justify-content:center;gap:14px;margin:0 auto 18px;flex-wrap:wrap}
/* Two-column grid: left=input, right=controls */
.grid-2{display:grid;grid-template-columns:1.4fr .9fr;gap:16px}
.grid-2 .col{display:flex;flex-direction:column;gap:12px}
/* Buttons */
.gr-button{border-radius:12px !important;font-weight:700 !important;letter-spacing:.2px}
#extract-btn{background:linear-gradient(90deg,#EFAFB2,#EFAFB2); color:#0f172a}
#inference-btn{background:linear-gradient(90deg,#B2CBDF,#B2CBDF); color:#0f172a}
#clear-btn{background:#FFE2B5; color:#0A0A0A; border:1px solid var(--border)}
/* Result spacing */
#result-table{margin-bottom:16px}
/* Figure container */
.figure-wrap{border:1px solid var(--border);border-radius:12px;overflow:hidden;box-shadow:var(--shadow)}
.figure-wrap img{display:block;width:100%;height:auto}
/* Right pane: vertical radio layout and full-width controls (kept for button styling) */
.right-pane .gr-button{
width:100% !important;
height:48px !important;
border-radius:12px !important;
font-weight:700 !important;
letter-spacing:.2px;
}
/* βββββββββ Publication links (Bulma-like) βββββββββ */
.publication-links {
display: flex;
justify-content: center;
gap: 14px;
flex-wrap: wrap;
margin: 6px 0 18px;
}
.link-block a {
display: inline-flex;
align-items: center;
gap: 8px;
padding: 10px 18px;
font-size: 14px;
font-weight: 600;
border-radius: 9999px;
text-decoration: none;
transition: all 0.15s ease-in-out;
}
/* colour variants */
.btn-danger { background:#e2e8f0; color:#0f172a; }
.btn-dark { background:#e2e8f0; color:#0f172a; }
.btn-link { background:#e2e8f0; color:#0f172a; }
.btn-warning { background:#e2e8f0; color:#0f172a; }
.link-block a:hover {
filter: brightness(0.95);
transform: translateY(-1px);
}
.loscalzo-block img {
height: 100px;
width: auto;
object-fit: contain;
}
.loscalzo-block {
display: flex;
align-items: center;
gap: 10px;
margin: 0 auto;
justify-content: center;
}
.link-btn{
display:inline-flex !important;
align-items:center !important;
gap:8px !important;
padding:10px 18px !important;
font-size:14px !important;
font-weight:600 !important;
border-radius:9999px !important;
background:#e2e8f0 !important;
color:#0f172a !important;
text-decoration:none !important;
border:1px solid #e5e7eb !important;
transition:all 0.15s ease-in-out !important;
}
.link-btn:hover{
filter:brightness(0.95);
transform:translateY(-1px);
}
.project-links{
display:flex !important;
justify-content:center !important;
gap:28px !important;
flex-wrap:wrap !important;
margin-bottom:32px !important;
}
#example-btn {
background: #979ea8 !important;
color: #1e293b !important;
}
#extract-aa-btn{
background:#DCE7F3 !important;
color:#0f172a !important;
}
#extract-sa-btn{
background:#EADCF8 !important;
color:#0f172a !important;
}
"""
with gr.Blocks() as demo:
gr.Markdown("<h1>ExplainBind: Token-level ProteinβLigand Interaction Visualiser</h1>")
# gr.HTML(f"""
# <div class="loscalzo-block">
# <img src="data:image/png;base64,{LOSCAZLO_B64}"
# alt="Loscalzo Research Group logo" />
# <a class="loscalzo-name"
# href="https://ogephd.hms.harvard.edu/people/joseph-loscalzo"
# target="_blank" rel="noopener">
# </a>
# </div>
# """)
# βββββββββββββββββββββββββββββββ
# Top links
# βββββββββββββββββββββββββββββββ
gr.HTML("""
<div class="project-links">
<a class="link-btn" href="https://zhaohanm.github.io/ExplainBind/" target="_blank" rel="noopener noreferrer" aria-label="Project Page">
<!-- globe icon -->
<svg xmlns="http://www.w3.org/2000/svg" width="18" height="18" viewBox="0 0 24 24" fill="currentColor" aria-hidden="true">
<path d="M12 2a10 10 0 1 0 10 10A10.012 10.012 0 0 0 12 2Zm7.93 9h-3.18a15.84 15.84 0 0 0-1.19-5.02A8.02 8.02 0 0 1 19.93 11ZM12 4c.86 0 2.25 1.86 3.01 6H8.99C9.75 5.86 11.14 4 12 4ZM4.07 13h3.18c.2 1.79.66 3.47 1.19 5.02A8.02 8.02 0 0 1 4.07 13Zm3.18-2H4.07A8.02 8.02 0 0 1 8.44 5.98 15.84 15.84 0 0 0 7.25 11Zm1.37 2h6.76c-.76 4.14-2.15 6-3.01 6s-2.25-1.86-3.01-6Zm9.05 0h3.18a8.02 8.02 0 0 1-4.37 5.02 15.84 15.84 0 0 0 1.19-5.02Z"/>
</svg>
Project Page
</a>
<a class="link-btn" href="https://doi.org/10.64898/2026.03.03.707476" target="_blank" rel="noopener noreferrer" aria-label="Biorxiv: 2406.01651">
<!-- arXiv-like paper icon -->
<svg xmlns="http://www.w3.org/2000/svg" width="18" height="18" viewBox="0 0 24 24" fill="currentColor" aria-hidden="true">
<path d="M6 2h9l5 5v13a2 2 0 0 1-2 2H6a2 2 0 0 1-2-2V4a2 2 0 0 1 2-2Zm8 1.5V8h4.5L14 3.5ZM7 12h10v2H7v-2Zm0 4h10v2H7v-2Zm0-8h6v2H7V8Z"/>
</svg>
biorXiv preprint
</a>
<a class="link-btn" href="https://github.com/ZhaohanM/ExplainBind" target="_blank" rel="noopener noreferrer" aria-label="GitHub Repo">
<!-- GitHub mark -->
<svg xmlns="http://www.w3.org/2000/svg" width="18" height="18" viewBox="0 0 24 24" fill="currentColor" aria-hidden="true">
<path d="M12 .5A12 12 0 0 0 0 12.76c0 5.4 3.44 9.98 8.2 11.6.6.12.82-.28.82-.6v-2.3c-3.34.74-4.04-1.44-4.04-1.44-.54-1.38-1.32-1.74-1.32-1.74-1.08-.76.08-.74.08-.74 1.2.08 1.84 1.26 1.84 1.26 1.06 1.86 2.78 1.32 3.46 1.02.1-.8.42-1.32.76-1.62-2.66-.32-5.46-1.36-5.46-6.02 0-1.34.46-2.44 1.22-3.3-.12-.32-.54-1.64.12-3.42 0 0 1-.34 3.32 1.26.96-.28 1.98-.42 3-.42s2.04.14 3 .42c2.32-1.6 3.32-1.26 3.32-1.26.66 1.78.24 3.1.12 3.42.76.86 1.22 1.96 1.22 3.3 0 4.68-2.8 5.68-5.48 6 .44.38.84 1.12.84 2.28v3.38c0 .32.22.74.84.6A12.02 12.02 0 0 0 24 12.76 12 12 0 0 0 12 .5Z"/>
</svg>
Source code
</a>
</div>
""")
# βββββββββββββββββββββββββββββββ
# Guidelines
# βββββββββββββββββββββββββββββββ
with gr.Accordion("Guidelines for Users", open=True, elem_classes=["card"]):
gr.HTML("""
<ol style="font-size:1rem;line-height:1.6;margin-left:22px;">
<li>
<strong>Input formats:</strong>
The system supports either <em>structure-aware (SA)</em> sequences derived from
protein structures or conventional <em>FASTA</em> sequences.
For structure-based analysis, users may upload <code>.pdb</code> or
<code>.cif</code> files to extract the corresponding sequence representation.
Ligands can be provided in <em>SMILES</em> or <em>SELFIES</em> format.
</li>
<li>
<strong>Interaction channel selection:</strong>
Users may select a specific non-covalent interaction type
(e.g., hydrogen bonding, hydrophobic interactions) or the
overall interaction channel to visualise the corresponding
token-level binding patterns.
</li>
<li>
<strong>Model outputs:</strong>
The system reports (i) a predicted binding probability for the
proteinβligand pair, (ii) a ranked Top-K residue table, and (iii) a token-level interaction
heat map illustrating spatial interaction patterns.
</li>
</ol>
""")
# βββββββββββββββββββββββββββββββ
# Inputs + Controls
# βββββββββββββββββββββββββββββββ
with gr.Row():
with gr.Column(elem_classes=["card", "grid-2"]):
# ββββββββββββββββ
# LEFT PANEL
# ββββββββββββββββ
with gr.Column(elem_id="left"):
protein_seq = gr.Textbox(
label="Protein structure-aware / FASTA sequence",
lines=3,
placeholder="Paste SA/FASTA sequence or click Extractβ¦",
elem_id="protein-seq",
render=False,
)
drug_seq = gr.Textbox(
label="Ligand (SELFIES / SMILES)",
lines=3,
placeholder="Paste SELFIES or SMILES",
elem_id="drug-seq",
render=False,
)
structure_file = gr.File(
label="Upload protein structure (.pdb / .cif)",
file_types=[".pdb", ".cif"],
elem_id="structure-file",
render=False,
)
with gr.Group():
gr.Markdown("### Example")
gr.Examples(
examples=[[
"SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTSHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPSYDLLLEMLDA",
"[C][=C][C][=Branch2][Branch1][#C][=C][C][=C][Ring1][=Branch1][C][=C][Branch2][Ring2][#Branch2][C@H1][C@@H1][Branch1][Branch2][C][C@@H1][Ring1][=Branch1][O][Ring1][Branch1][S][=Branch1][C][=O][=Branch1][C][=O][N][Branch1][#Branch2][C][C][Branch1][C][F][Branch1][C][F][F][C][=C][C][=C][Branch1][Branch1][C][=C][Ring1][=Branch1][Cl][C][=C][C][=C][Branch1][Branch1][C][=C][Ring1][=Branch1][O][O]"
]],
inputs=[protein_seq, drug_seq],
label="Click to load an example",
)
btn_load_example = gr.Button(
"Load Example",
elem_id="example-btn",
# variant="secondary"
)
structure_file.render()
with gr.Row():
btn_extract_aa = gr.Button(
"Extract amino acid sequence",
elem_id="extract-aa-btn"
)
btn_extract_sa = gr.Button(
"Extract structure-aware sequence",
elem_id="extract-sa-btn"
)
protein_seq.render()
drug_seq.render()
# ββββββββββββββββ
# RIGHT PANEL
# ββββββββββββββββ
with gr.Column(elem_id="right", elem_classes=["right-pane"]):
head_dd = gr.Dropdown(
label="Non-covalent interaction type/Overall",
choices=INTERACTION_NAMES,
value="Overall Interaction",
interactive=True,
)
top_k_dd = gr.Dropdown(
label="Top-K residue",
choices=[str(i) for i in range(1, 21)],
value="1",
interactive=True,
)
with gr.Row():
btn_infer = gr.Button(
"Inference",
elem_id="inference-btn"
)
clear_btn = gr.Button(
"Clear",
elem_id="clear-btn"
)
# βββββββββββββββββββββββββββββββ
# Outputs
# βββββββββββββββββββββββββββββββ
with gr.Column(elem_classes=["card"]):
status_box = gr.HTML(elem_id="status-box")
output_full = gr.HTML(elem_id="result-full")
# βββββββββββββββββββββββββββββββ
# Example Loader Callback
# βββββββββββββββββββββββββββββββ
def load_example_cb():
return (
"SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTSHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPSYDLLLEMLDA",
"[C][=C][C][=Branch2][Branch1][#C][=C][C][=C][Ring1][=Branch1][C][=C][Branch2][Ring2][#Branch2][C@H1][C@@H1][Branch1][Branch2][C][C@@H1][Ring1][=Branch1][O][Ring1][Branch1][S][=Branch1][C][=O][=Branch1][C][=O][N][Branch1][#Branch2][C][C][Branch1][C][F][Branch1][C][F][F][C][=C][C][=C][Branch1][Branch1][C][=C][Ring1][=Branch1][Cl][C][=C][C][=C][Branch1][Branch1][C][=C][Ring1][=Branch1][O][O]"
)
# βββββββββββββββββββββββββββββββ
# Wiring
# βββββββββββββββββββββββββββββββ
btn_load_example.click(
fn=load_example_cb,
inputs=[],
outputs=[protein_seq, drug_seq],
)
btn_extract_aa.click(
fn=extract_aa_seq_cb,
inputs=[structure_file, protein_seq],
outputs=[protein_seq, status_box],
)
btn_extract_sa.click(
fn=extract_sa_seq_cb,
inputs=[structure_file, protein_seq],
outputs=[protein_seq, status_box],
)
btn_infer.click(
fn=inference_cb,
inputs=[protein_seq, drug_seq, head_dd, top_k_dd],
outputs=[output_full],
)
clear_btn.click(
fn=clear_cb,
inputs=[],
outputs=[
protein_seq,
drug_seq,
output_full,
structure_file,
status_box,
],
)
demo.launch(
theme=gr.themes.Default(),
css=css,
show_error=True
) |