Spaces:
No application file
No application file
| # Copyright 2000 Andrew Dalke. | |
| # Copyright 2000-2002 Brad Chapman. | |
| # Copyright 2004-2005, 2010 by M de Hoon. | |
| # Copyright 2007-2020 by Peter Cock. | |
| # All rights reserved. | |
| # | |
| # This file is part of the Biopython distribution and governed by your | |
| # choice of the "Biopython License Agreement" or the "BSD 3-Clause License". | |
| # Please see the LICENSE file that should have been included as part of this | |
| # package. | |
| """Provide objects to represent biological sequences. | |
| See also the Seq_ wiki and the chapter in our tutorial: | |
| - `HTML Tutorial`_ | |
| - `PDF Tutorial`_ | |
| .. _Seq: http://biopython.org/wiki/Seq | |
| .. _`HTML Tutorial`: http://biopython.org/DIST/docs/tutorial/Tutorial.html | |
| .. _`PDF Tutorial`: http://biopython.org/DIST/docs/tutorial/Tutorial.pdf | |
| """ | |
| import array | |
| import numbers | |
| import warnings | |
| from abc import ABC | |
| from abc import abstractmethod | |
| from Bio import BiopythonDeprecationWarning | |
| from Bio import BiopythonWarning | |
| from Bio.Data import CodonTable | |
| from Bio.Data import IUPACData | |
| def _maketrans(complement_mapping): | |
| """Make a python string translation table (PRIVATE). | |
| Arguments: | |
| - complement_mapping - a dictionary such as ambiguous_dna_complement | |
| and ambiguous_rna_complement from Data.IUPACData. | |
| Returns a translation table (a bytes object of length 256) for use with | |
| the python string's translate method to use in a (reverse) complement. | |
| Compatible with lower case and upper case sequences. | |
| For internal use only. | |
| """ | |
| keys = "".join(complement_mapping.keys()).encode("ASCII") | |
| values = "".join(complement_mapping.values()).encode("ASCII") | |
| return bytes.maketrans(keys + keys.lower(), values + values.lower()) | |
| ambiguous_dna_complement = dict(IUPACData.ambiguous_dna_complement) | |
| ambiguous_dna_complement["U"] = ambiguous_dna_complement["T"] | |
| _dna_complement_table = _maketrans(ambiguous_dna_complement) | |
| del ambiguous_dna_complement | |
| ambiguous_rna_complement = dict(IUPACData.ambiguous_rna_complement) | |
| ambiguous_rna_complement["T"] = ambiguous_rna_complement["U"] | |
| _rna_complement_table = _maketrans(ambiguous_rna_complement) | |
| del ambiguous_rna_complement | |
| class SequenceDataAbstractBaseClass(ABC): | |
| """Abstract base class for sequence content providers. | |
| Most users will not need to use this class. It is used internally as a base | |
| class for sequence content provider classes such as _UndefinedSequenceData | |
| defined in this module, and _TwoBitSequenceData in Bio.SeqIO.TwoBitIO. | |
| Instances of these classes can be used instead of a ``bytes`` object as the | |
| data argument when creating a Seq object, and provide the sequence content | |
| only when requested via ``__getitem__``. This allows lazy parsers to load | |
| and parse sequence data from a file only for the requested sequence regions, | |
| and _UndefinedSequenceData instances to raise an exception when undefined | |
| sequence data are requested. | |
| Future implementations of lazy parsers that similarly provide on-demand | |
| parsing of sequence data should use a subclass of this abstract class and | |
| implement the abstract methods ``__len__`` and ``__getitem__``: | |
| * ``__len__`` must return the sequence length; | |
| * ``__getitem__`` must return | |
| * a ``bytes`` object for the requested region; or | |
| * a new instance of the subclass for the requested region; or | |
| * raise an ``UndefinedSequenceError``. | |
| Calling ``__getitem__`` for a sequence region of size zero should always | |
| return an empty ``bytes`` object. | |
| Calling ``__getitem__`` for the full sequence (as in data[:]) should | |
| either return a ``bytes`` object with the full sequence, or raise an | |
| ``UndefinedSequenceError``. | |
| Subclasses of SequenceDataAbstractBaseClass must call ``super().__init__()`` | |
| as part of their ``__init__`` method. | |
| """ | |
| __slots__ = () | |
| def __init__(self): | |
| """Check if ``__getitem__`` returns a bytes-like object.""" | |
| assert self[:0] == b"" | |
| def __len__(self): | |
| pass | |
| def __getitem__(self, key): | |
| pass | |
| def __bytes__(self): | |
| return self[:] | |
| def __hash__(self): | |
| return hash(bytes(self)) | |
| def __eq__(self, other): | |
| return bytes(self) == other | |
| def __lt__(self, other): | |
| return bytes(self) < other | |
| def __le__(self, other): | |
| return bytes(self) <= other | |
| def __gt__(self, other): | |
| return bytes(self) > other | |
| def __ge__(self, other): | |
| return bytes(self) >= other | |
| def __add__(self, other): | |
| try: | |
| return bytes(self) + bytes(other) | |
| except UndefinedSequenceError: | |
| return NotImplemented | |
| # will be handled by _UndefinedSequenceData.__radd__ or | |
| # by _PartiallyDefinedSequenceData.__radd__ | |
| def __radd__(self, other): | |
| return other + bytes(self) | |
| def __mul__(self, other): | |
| return other * bytes(self) | |
| def __contains__(self, item): | |
| return bytes(self).__contains__(item) | |
| def decode(self, encoding="utf-8"): | |
| """Decode the data as bytes using the codec registered for encoding. | |
| encoding | |
| The encoding with which to decode the bytes. | |
| """ | |
| return bytes(self).decode(encoding) | |
| def count(self, sub, start=None, end=None): | |
| """Return the number of non-overlapping occurrences of sub in data[start:end]. | |
| Optional arguments start and end are interpreted as in slice notation. | |
| This method behaves as the count method of Python strings. | |
| """ | |
| return bytes(self).count(sub, start, end) | |
| def find(self, sub, start=None, end=None): | |
| """Return the lowest index in data where subsection sub is found. | |
| Return the lowest index in data where subsection sub is found, | |
| such that sub is contained within data[start,end]. Optional | |
| arguments start and end are interpreted as in slice notation. | |
| Return -1 on failure. | |
| """ | |
| return bytes(self).find(sub, start, end) | |
| def rfind(self, sub, start=None, end=None): | |
| """Return the highest index in data where subsection sub is found. | |
| Return the highest index in data where subsection sub is found, | |
| such that sub is contained within data[start,end]. Optional | |
| arguments start and end are interpreted as in slice notation. | |
| Return -1 on failure. | |
| """ | |
| return bytes(self).rfind(sub, start, end) | |
| def index(self, sub, start=None, end=None): | |
| """Return the lowest index in data where subsection sub is found. | |
| Return the lowest index in data where subsection sub is found, | |
| such that sub is contained within data[start,end]. Optional | |
| arguments start and end are interpreted as in slice notation. | |
| Raises ValueError when the subsection is not found. | |
| """ | |
| return bytes(self).index(sub, start, end) | |
| def rindex(self, sub, start=None, end=None): | |
| """Return the highest index in data where subsection sub is found. | |
| Return the highest index in data where subsection sub is found, | |
| such that sub is contained within data[start,end]. Optional | |
| arguments start and end are interpreted as in slice notation. | |
| Raise ValueError when the subsection is not found. | |
| """ | |
| return bytes(self).rindex(sub, start, end) | |
| def startswith(self, prefix, start=None, end=None): | |
| """Return True if data starts with the specified prefix, False otherwise. | |
| With optional start, test data beginning at that position. | |
| With optional end, stop comparing data at that position. | |
| prefix can also be a tuple of bytes to try. | |
| """ | |
| return bytes(self).startswith(prefix, start, end) | |
| def endswith(self, suffix, start=None, end=None): | |
| """Return True if data ends with the specified suffix, False otherwise. | |
| With optional start, test data beginning at that position. | |
| With optional end, stop comparing data at that position. | |
| suffix can also be a tuple of bytes to try. | |
| """ | |
| return bytes(self).endswith(suffix, start, end) | |
| def split(self, sep=None, maxsplit=-1): | |
| """Return a list of the sections in the data, using sep as the delimiter. | |
| sep | |
| The delimiter according which to split the data. | |
| None (the default value) means split on ASCII whitespace characters | |
| (space, tab, return, newline, formfeed, vertical tab). | |
| maxsplit | |
| Maximum number of splits to do. | |
| -1 (the default value) means no limit. | |
| """ | |
| return bytes(self).split(sep, maxsplit) | |
| def rsplit(self, sep=None, maxsplit=-1): | |
| """Return a list of the sections in the data, using sep as the delimiter. | |
| sep | |
| The delimiter according which to split the data. | |
| None (the default value) means split on ASCII whitespace characters | |
| (space, tab, return, newline, formfeed, vertical tab). | |
| maxsplit | |
| Maximum number of splits to do. | |
| -1 (the default value) means no limit. | |
| Splitting is done starting at the end of the data and working to the front. | |
| """ | |
| return bytes(self).rsplit(sep, maxsplit) | |
| def strip(self, chars=None): | |
| """Strip leading and trailing characters contained in the argument. | |
| If the argument is omitted or None, strip leading and trailing ASCII whitespace. | |
| """ | |
| return bytes(self).strip(chars) | |
| def lstrip(self, chars=None): | |
| """Strip leading characters contained in the argument. | |
| If the argument is omitted or None, strip leading ASCII whitespace. | |
| """ | |
| return bytes(self).lstrip(chars) | |
| def rstrip(self, chars=None): | |
| """Strip trailing characters contained in the argument. | |
| If the argument is omitted or None, strip trailing ASCII whitespace. | |
| """ | |
| return bytes(self).rstrip(chars) | |
| def upper(self): | |
| """Return a copy of data with all ASCII characters converted to uppercase.""" | |
| return bytes(self).upper() | |
| def lower(self): | |
| """Return a copy of data with all ASCII characters converted to lowercase.""" | |
| return bytes(self).lower() | |
| def isupper(self): | |
| """Return True if all ASCII characters in data are uppercase. | |
| If there are no cased characters, the method returns False. | |
| """ | |
| return bytes(self).isupper() | |
| def islower(self): | |
| """Return True if all ASCII characters in data are lowercase. | |
| If there are no cased characters, the method returns False. | |
| """ | |
| return bytes(self).islower() | |
| def replace(self, old, new): | |
| """Return a copy with all occurrences of substring old replaced by new.""" | |
| return bytes(self).replace(old, new) | |
| def translate(self, table, delete=b""): | |
| """Return a copy with each character mapped by the given translation table. | |
| table | |
| Translation table, which must be a bytes object of length 256. | |
| All characters occurring in the optional argument delete are removed. | |
| The remaining characters are mapped through the given translation table. | |
| """ | |
| return bytes(self).translate(table, delete) | |
| def defined(self): | |
| """Return True if the sequence is defined, False if undefined or partially defined. | |
| Zero-length sequences are always considered to be defined. | |
| """ | |
| return True | |
| def defined_ranges(self): | |
| """Return a tuple of the ranges where the sequence contents is defined. | |
| The return value has the format ((start1, end1), (start2, end2), ...). | |
| """ | |
| length = len(self) | |
| if length > 0: | |
| return ((0, length),) | |
| else: | |
| return () | |
| class _SeqAbstractBaseClass(ABC): | |
| """Abstract base class for the Seq and MutableSeq classes (PRIVATE). | |
| Most users will not need to use this class. It is used internally as an | |
| abstract base class for Seq and MutableSeq, as most of their methods are | |
| identical. | |
| """ | |
| __slots__ = ("_data",) | |
| __array_ufunc__ = None # turn off numpy Ufuncs | |
| def __init__(self): | |
| pass | |
| def __bytes__(self): | |
| return bytes(self._data) | |
| def __repr__(self): | |
| """Return (truncated) representation of the sequence.""" | |
| data = self._data | |
| if isinstance(data, _UndefinedSequenceData): | |
| return f"Seq(None, length={len(self)})" | |
| if isinstance(data, _PartiallyDefinedSequenceData): | |
| d = {} | |
| for position, seq in data._data.items(): | |
| if len(seq) > 60: | |
| start = seq[:54].decode("ASCII") | |
| end = seq[-3:].decode("ASCII") | |
| seq = f"{start}...{end}" | |
| else: | |
| seq = seq.decode("ASCII") | |
| d[position] = seq | |
| return "Seq(%r, length=%d)" % (d, len(self)) | |
| if len(data) > 60: | |
| # Shows the last three letters as it is often useful to see if | |
| # there is a stop codon at the end of a sequence. | |
| # Note total length is 54+3+3=60 | |
| start = data[:54].decode("ASCII") | |
| end = data[-3:].decode("ASCII") | |
| return f"{self.__class__.__name__}('{start}...{end}')" | |
| else: | |
| data = data.decode("ASCII") | |
| return f"{self.__class__.__name__}('{data}')" | |
| def __str__(self): | |
| """Return the full sequence as a python string.""" | |
| return self._data.decode("ASCII") | |
| def __eq__(self, other): | |
| """Compare the sequence to another sequence or a string. | |
| Sequences are equal to each other if their sequence contents is | |
| identical: | |
| >>> from Bio.Seq import Seq, MutableSeq | |
| >>> seq1 = Seq("ACGT") | |
| >>> seq2 = Seq("ACGT") | |
| >>> mutable_seq = MutableSeq("ACGT") | |
| >>> seq1 == seq2 | |
| True | |
| >>> seq1 == mutable_seq | |
| True | |
| >>> seq1 == "ACGT" | |
| True | |
| Note that the sequence objects themselves are not identical to each | |
| other: | |
| >>> id(seq1) == id(seq2) | |
| False | |
| >>> seq1 is seq2 | |
| False | |
| Sequences can also be compared to strings, ``bytes``, and ``bytearray`` | |
| objects: | |
| >>> seq1 == "ACGT" | |
| True | |
| >>> seq1 == b"ACGT" | |
| True | |
| >>> seq1 == bytearray(b"ACGT") | |
| True | |
| """ | |
| if isinstance(other, _SeqAbstractBaseClass): | |
| return self._data == other._data | |
| elif isinstance(other, str): | |
| return self._data == other.encode("ASCII") | |
| else: | |
| return self._data == other | |
| def __lt__(self, other): | |
| """Implement the less-than operand.""" | |
| if isinstance(other, _SeqAbstractBaseClass): | |
| return self._data < other._data | |
| elif isinstance(other, str): | |
| return self._data < other.encode("ASCII") | |
| else: | |
| return self._data < other | |
| def __le__(self, other): | |
| """Implement the less-than or equal operand.""" | |
| if isinstance(other, _SeqAbstractBaseClass): | |
| return self._data <= other._data | |
| elif isinstance(other, str): | |
| return self._data <= other.encode("ASCII") | |
| else: | |
| return self._data <= other | |
| def __gt__(self, other): | |
| """Implement the greater-than operand.""" | |
| if isinstance(other, _SeqAbstractBaseClass): | |
| return self._data > other._data | |
| elif isinstance(other, str): | |
| return self._data > other.encode("ASCII") | |
| else: | |
| return self._data > other | |
| def __ge__(self, other): | |
| """Implement the greater-than or equal operand.""" | |
| if isinstance(other, _SeqAbstractBaseClass): | |
| return self._data >= other._data | |
| elif isinstance(other, str): | |
| return self._data >= other.encode("ASCII") | |
| else: | |
| return self._data >= other | |
| def __len__(self): | |
| """Return the length of the sequence.""" | |
| return len(self._data) | |
| def __iter__(self): | |
| """Return an iterable of the sequence.""" | |
| return self._data.decode("ASCII").__iter__() | |
| def __getitem__(self, index): | |
| """Return a subsequence as a single letter or as a sequence object. | |
| If the index is an integer, a single letter is returned as a Python | |
| string: | |
| >>> seq = Seq('ACTCGACGTCG') | |
| >>> seq[5] | |
| 'A' | |
| Otherwise, a new sequence object of the same class is returned: | |
| >>> seq[5:8] | |
| Seq('ACG') | |
| >>> mutable_seq = MutableSeq('ACTCGACGTCG') | |
| >>> mutable_seq[5:8] | |
| MutableSeq('ACG') | |
| """ | |
| if isinstance(index, numbers.Integral): | |
| # Return a single letter as a string | |
| return chr(self._data[index]) | |
| else: | |
| # Return the (sub)sequence as another Seq/MutableSeq object | |
| return self.__class__(self._data[index]) | |
| def __add__(self, other): | |
| """Add a sequence or string to this sequence. | |
| >>> from Bio.Seq import Seq, MutableSeq | |
| >>> Seq("MELKI") + "LV" | |
| Seq('MELKILV') | |
| >>> MutableSeq("MELKI") + "LV" | |
| MutableSeq('MELKILV') | |
| """ | |
| if isinstance(other, _SeqAbstractBaseClass): | |
| return self.__class__(self._data + other._data) | |
| elif isinstance(other, str): | |
| return self.__class__(self._data + other.encode("ASCII")) | |
| else: | |
| # If other is a SeqRecord, then SeqRecord's __radd__ will handle | |
| # this. If not, returning NotImplemented will trigger a TypeError. | |
| return NotImplemented | |
| def __radd__(self, other): | |
| """Add a sequence string on the left. | |
| >>> from Bio.Seq import Seq, MutableSeq | |
| >>> "LV" + Seq("MELKI") | |
| Seq('LVMELKI') | |
| >>> "LV" + MutableSeq("MELKI") | |
| MutableSeq('LVMELKI') | |
| Adding two sequence objects is handled via the __add__ method. | |
| """ | |
| if isinstance(other, str): | |
| return self.__class__(other.encode("ASCII") + self._data) | |
| else: | |
| return NotImplemented | |
| def __mul__(self, other): | |
| """Multiply sequence by integer. | |
| >>> from Bio.Seq import Seq, MutableSeq | |
| >>> Seq('ATG') * 2 | |
| Seq('ATGATG') | |
| >>> MutableSeq('ATG') * 2 | |
| MutableSeq('ATGATG') | |
| """ | |
| if not isinstance(other, numbers.Integral): | |
| raise TypeError(f"can't multiply {self.__class__.__name__} by non-int type") | |
| # we would like to simply write | |
| # data = self._data * other | |
| # here, but currently that causes a bug on PyPy if self._data is a | |
| # bytearray and other is a numpy integer. Using this workaround: | |
| data = self._data.__mul__(other) | |
| return self.__class__(data) | |
| def __rmul__(self, other): | |
| """Multiply integer by sequence. | |
| >>> from Bio.Seq import Seq | |
| >>> 2 * Seq('ATG') | |
| Seq('ATGATG') | |
| """ | |
| if not isinstance(other, numbers.Integral): | |
| raise TypeError(f"can't multiply {self.__class__.__name__} by non-int type") | |
| # we would like to simply write | |
| # data = self._data * other | |
| # here, but currently that causes a bug on PyPy if self._data is a | |
| # bytearray and other is a numpy integer. Using this workaround: | |
| data = self._data.__mul__(other) | |
| return self.__class__(data) | |
| def __imul__(self, other): | |
| """Multiply the sequence object by other and assign. | |
| >>> from Bio.Seq import Seq | |
| >>> seq = Seq('ATG') | |
| >>> seq *= 2 | |
| >>> seq | |
| Seq('ATGATG') | |
| Note that this is different from in-place multiplication. The ``seq`` | |
| variable is reassigned to the multiplication result, but any variable | |
| pointing to ``seq`` will remain unchanged: | |
| >>> seq = Seq('ATG') | |
| >>> seq2 = seq | |
| >>> id(seq) == id(seq2) | |
| True | |
| >>> seq *= 2 | |
| >>> seq | |
| Seq('ATGATG') | |
| >>> seq2 | |
| Seq('ATG') | |
| >>> id(seq) == id(seq2) | |
| False | |
| """ | |
| if not isinstance(other, numbers.Integral): | |
| raise TypeError(f"can't multiply {self.__class__.__name__} by non-int type") | |
| # we would like to simply write | |
| # data = self._data * other | |
| # here, but currently that causes a bug on PyPy if self._data is a | |
| # bytearray and other is a numpy integer. Using this workaround: | |
| data = self._data.__mul__(other) | |
| return self.__class__(data) | |
| def count(self, sub, start=None, end=None): | |
| """Return a non-overlapping count, like that of a python string. | |
| The number of occurrences of substring argument sub in the | |
| (sub)sequence given by [start:end] is returned as an integer. | |
| Optional arguments start and end are interpreted as in slice | |
| notation. | |
| Arguments: | |
| - sub - a string or another Seq object to look for | |
| - start - optional integer, slice start | |
| - end - optional integer, slice end | |
| e.g. | |
| >>> from Bio.Seq import Seq | |
| >>> my_seq = Seq("AAAATGA") | |
| >>> print(my_seq.count("A")) | |
| 5 | |
| >>> print(my_seq.count("ATG")) | |
| 1 | |
| >>> print(my_seq.count(Seq("AT"))) | |
| 1 | |
| >>> print(my_seq.count("AT", 2, -1)) | |
| 1 | |
| HOWEVER, please note because the ``count`` method of Seq and MutableSeq | |
| objects, like that of Python strings, do a non-overlapping search, this | |
| may not give the answer you expect: | |
| >>> "AAAA".count("AA") | |
| 2 | |
| >>> print(Seq("AAAA").count("AA")) | |
| 2 | |
| For an overlapping search, use the ``count_overlap`` method: | |
| >>> print(Seq("AAAA").count_overlap("AA")) | |
| 3 | |
| """ | |
| if isinstance(sub, MutableSeq): | |
| sub = sub._data | |
| elif isinstance(sub, Seq): | |
| sub = bytes(sub) | |
| elif isinstance(sub, str): | |
| sub = sub.encode("ASCII") | |
| elif not isinstance(sub, (bytes, bytearray)): | |
| raise TypeError( | |
| "a Seq, MutableSeq, str, bytes, or bytearray object is required, not '%s'" | |
| % type(sub) | |
| ) | |
| return self._data.count(sub, start, end) | |
| def count_overlap(self, sub, start=None, end=None): | |
| """Return an overlapping count. | |
| Returns an integer, the number of occurrences of substring | |
| argument sub in the (sub)sequence given by [start:end]. | |
| Optional arguments start and end are interpreted as in slice | |
| notation. | |
| Arguments: | |
| - sub - a string or another Seq object to look for | |
| - start - optional integer, slice start | |
| - end - optional integer, slice end | |
| e.g. | |
| >>> from Bio.Seq import Seq | |
| >>> print(Seq("AAAA").count_overlap("AA")) | |
| 3 | |
| >>> print(Seq("ATATATATA").count_overlap("ATA")) | |
| 4 | |
| >>> print(Seq("ATATATATA").count_overlap("ATA", 3, -1)) | |
| 1 | |
| For a non-overlapping search, use the ``count`` method: | |
| >>> print(Seq("AAAA").count("AA")) | |
| 2 | |
| Where substrings do not overlap, ``count_overlap`` behaves the same as | |
| the ``count`` method: | |
| >>> from Bio.Seq import Seq | |
| >>> my_seq = Seq("AAAATGA") | |
| >>> print(my_seq.count_overlap("A")) | |
| 5 | |
| >>> my_seq.count_overlap("A") == my_seq.count("A") | |
| True | |
| >>> print(my_seq.count_overlap("ATG")) | |
| 1 | |
| >>> my_seq.count_overlap("ATG") == my_seq.count("ATG") | |
| True | |
| >>> print(my_seq.count_overlap(Seq("AT"))) | |
| 1 | |
| >>> my_seq.count_overlap(Seq("AT")) == my_seq.count(Seq("AT")) | |
| True | |
| >>> print(my_seq.count_overlap("AT", 2, -1)) | |
| 1 | |
| >>> my_seq.count_overlap("AT", 2, -1) == my_seq.count("AT", 2, -1) | |
| True | |
| HOWEVER, do not use this method for such cases because the | |
| count() method is much for efficient. | |
| """ | |
| if isinstance(sub, MutableSeq): | |
| sub = sub._data | |
| elif isinstance(sub, Seq): | |
| sub = bytes(sub) | |
| elif isinstance(sub, str): | |
| sub = sub.encode("ASCII") | |
| elif not isinstance(sub, (bytes, bytearray)): | |
| raise TypeError( | |
| "a Seq, MutableSeq, str, bytes, or bytearray object is required, not '%s'" | |
| % type(sub) | |
| ) | |
| data = self._data | |
| overlap_count = 0 | |
| while True: | |
| start = data.find(sub, start, end) + 1 | |
| if start != 0: | |
| overlap_count += 1 | |
| else: | |
| return overlap_count | |
| def __contains__(self, item): | |
| """Return True if item is a subsequence of the sequence, and False otherwise. | |
| e.g. | |
| >>> from Bio.Seq import Seq, MutableSeq | |
| >>> my_dna = Seq("ATATGAAATTTGAAAA") | |
| >>> "AAA" in my_dna | |
| True | |
| >>> Seq("AAA") in my_dna | |
| True | |
| >>> MutableSeq("AAA") in my_dna | |
| True | |
| """ | |
| if isinstance(item, _SeqAbstractBaseClass): | |
| item = bytes(item) | |
| elif isinstance(item, str): | |
| item = item.encode("ASCII") | |
| return item in self._data | |
| def find(self, sub, start=None, end=None): | |
| """Return the lowest index in the sequence where subsequence sub is found. | |
| With optional arguments start and end, return the lowest index in the | |
| sequence such that the subsequence sub is contained within the sequence | |
| region [start:end]. | |
| Arguments: | |
| - sub - a string or another Seq or MutableSeq object to search for | |
| - start - optional integer, slice start | |
| - end - optional integer, slice end | |
| Returns -1 if the subsequence is NOT found. | |
| e.g. Locating the first typical start codon, AUG, in an RNA sequence: | |
| >>> from Bio.Seq import Seq | |
| >>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG") | |
| >>> my_rna.find("AUG") | |
| 3 | |
| The next typical start codon can then be found by starting the search | |
| at position 4: | |
| >>> my_rna.find("AUG", 4) | |
| 15 | |
| """ | |
| if isinstance(sub, _SeqAbstractBaseClass): | |
| sub = bytes(sub) | |
| elif isinstance(sub, str): | |
| sub = sub.encode("ASCII") | |
| elif not isinstance(sub, (bytes, bytearray)): | |
| raise TypeError( | |
| "a Seq, MutableSeq, str, bytes, or bytearray object is required, not '%s'" | |
| % type(sub) | |
| ) | |
| return self._data.find(sub, start, end) | |
| def rfind(self, sub, start=None, end=None): | |
| """Return the highest index in the sequence where subsequence sub is found. | |
| With optional arguments start and end, return the highest index in the | |
| sequence such that the subsequence sub is contained within the sequence | |
| region [start:end]. | |
| Arguments: | |
| - sub - a string or another Seq or MutableSeq object to search for | |
| - start - optional integer, slice start | |
| - end - optional integer, slice end | |
| Returns -1 if the subsequence is NOT found. | |
| e.g. Locating the last typical start codon, AUG, in an RNA sequence: | |
| >>> from Bio.Seq import Seq | |
| >>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG") | |
| >>> my_rna.rfind("AUG") | |
| 15 | |
| The location of the typical start codon before that can be found by | |
| ending the search at position 15: | |
| >>> my_rna.rfind("AUG", end=15) | |
| 3 | |
| """ | |
| if isinstance(sub, _SeqAbstractBaseClass): | |
| sub = bytes(sub) | |
| elif isinstance(sub, str): | |
| sub = sub.encode("ASCII") | |
| elif not isinstance(sub, (bytes, bytearray)): | |
| raise TypeError( | |
| "a Seq, MutableSeq, str, bytes, or bytearray object is required, not '%s'" | |
| % type(sub) | |
| ) | |
| return self._data.rfind(sub, start, end) | |
| def index(self, sub, start=None, end=None): | |
| """Return the lowest index in the sequence where subsequence sub is found. | |
| With optional arguments start and end, return the lowest index in the | |
| sequence such that the subsequence sub is contained within the sequence | |
| region [start:end]. | |
| Arguments: | |
| - sub - a string or another Seq or MutableSeq object to search for | |
| - start - optional integer, slice start | |
| - end - optional integer, slice end | |
| Raises a ValueError if the subsequence is NOT found. | |
| e.g. Locating the first typical start codon, AUG, in an RNA sequence: | |
| >>> from Bio.Seq import Seq | |
| >>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG") | |
| >>> my_rna.index("AUG") | |
| 3 | |
| The next typical start codon can then be found by starting the search | |
| at position 4: | |
| >>> my_rna.index("AUG", 4) | |
| 15 | |
| This method performs the same search as the ``find`` method. However, | |
| if the subsequence is not found, ``find`` returns -1 which ``index`` | |
| raises a ValueError: | |
| >>> my_rna.index("T") | |
| Traceback (most recent call last): | |
| ... | |
| ValueError: ... | |
| >>> my_rna.find("T") | |
| -1 | |
| """ | |
| if isinstance(sub, MutableSeq): | |
| sub = sub._data | |
| elif isinstance(sub, Seq): | |
| sub = bytes(sub) | |
| elif isinstance(sub, str): | |
| sub = sub.encode("ASCII") | |
| elif not isinstance(sub, (bytes, bytearray)): | |
| raise TypeError( | |
| "a Seq, MutableSeq, str, bytes, or bytearray object is required, not '%s'" | |
| % type(sub) | |
| ) | |
| return self._data.index(sub, start, end) | |
| def rindex(self, sub, start=None, end=None): | |
| """Return the highest index in the sequence where subsequence sub is found. | |
| With optional arguments start and end, return the highest index in the | |
| sequence such that the subsequence sub is contained within the sequence | |
| region [start:end]. | |
| Arguments: | |
| - sub - a string or another Seq or MutableSeq object to search for | |
| - start - optional integer, slice start | |
| - end - optional integer, slice end | |
| Returns -1 if the subsequence is NOT found. | |
| e.g. Locating the last typical start codon, AUG, in an RNA sequence: | |
| >>> from Bio.Seq import Seq | |
| >>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG") | |
| >>> my_rna.rindex("AUG") | |
| 15 | |
| The location of the typical start codon before that can be found by | |
| ending the search at position 15: | |
| >>> my_rna.rindex("AUG", end=15) | |
| 3 | |
| This method performs the same search as the ``rfind`` method. However, | |
| if the subsequence is not found, ``rfind`` returns -1 which ``rindex`` | |
| raises a ValueError: | |
| >>> my_rna.rindex("T") | |
| Traceback (most recent call last): | |
| ... | |
| ValueError: ... | |
| >>> my_rna.rfind("T") | |
| -1 | |
| """ | |
| if isinstance(sub, MutableSeq): | |
| sub = sub._data | |
| elif isinstance(sub, Seq): | |
| sub = bytes(sub) | |
| elif isinstance(sub, str): | |
| sub = sub.encode("ASCII") | |
| elif not isinstance(sub, (bytes, bytearray)): | |
| raise TypeError( | |
| "a Seq, MutableSeq, str, bytes, or bytearray object is required, not '%s'" | |
| % type(sub) | |
| ) | |
| return self._data.rindex(sub, start, end) | |
| def startswith(self, prefix, start=None, end=None): | |
| """Return True if the sequence starts with the given prefix, False otherwise. | |
| Return True if the sequence starts with the specified prefix | |
| (a string or another Seq object), False otherwise. | |
| With optional start, test sequence beginning at that position. | |
| With optional end, stop comparing sequence at that position. | |
| prefix can also be a tuple of strings to try. e.g. | |
| >>> from Bio.Seq import Seq | |
| >>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG") | |
| >>> my_rna.startswith("GUC") | |
| True | |
| >>> my_rna.startswith("AUG") | |
| False | |
| >>> my_rna.startswith("AUG", 3) | |
| True | |
| >>> my_rna.startswith(("UCC", "UCA", "UCG"), 1) | |
| True | |
| """ | |
| if isinstance(prefix, tuple): | |
| prefix = tuple( | |
| bytes(p) if isinstance(p, _SeqAbstractBaseClass) else p.encode("ASCII") | |
| for p in prefix | |
| ) | |
| elif isinstance(prefix, _SeqAbstractBaseClass): | |
| prefix = bytes(prefix) | |
| elif isinstance(prefix, str): | |
| prefix = prefix.encode("ASCII") | |
| return self._data.startswith(prefix, start, end) | |
| def endswith(self, suffix, start=None, end=None): | |
| """Return True if the sequence ends with the given suffix, False otherwise. | |
| Return True if the sequence ends with the specified suffix | |
| (a string or another Seq object), False otherwise. | |
| With optional start, test sequence beginning at that position. | |
| With optional end, stop comparing sequence at that position. | |
| suffix can also be a tuple of strings to try. e.g. | |
| >>> from Bio.Seq import Seq | |
| >>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG") | |
| >>> my_rna.endswith("UUG") | |
| True | |
| >>> my_rna.endswith("AUG") | |
| False | |
| >>> my_rna.endswith("AUG", 0, 18) | |
| True | |
| >>> my_rna.endswith(("UCC", "UCA", "UUG")) | |
| True | |
| """ | |
| if isinstance(suffix, tuple): | |
| suffix = tuple( | |
| bytes(p) if isinstance(p, _SeqAbstractBaseClass) else p.encode("ASCII") | |
| for p in suffix | |
| ) | |
| elif isinstance(suffix, _SeqAbstractBaseClass): | |
| suffix = bytes(suffix) | |
| elif isinstance(suffix, str): | |
| suffix = suffix.encode("ASCII") | |
| return self._data.endswith(suffix, start, end) | |
| def split(self, sep=None, maxsplit=-1): | |
| """Return a list of subsequences when splitting the sequence by separator sep. | |
| Return a list of the subsequences in the sequence (as Seq objects), | |
| using sep as the delimiter string. If maxsplit is given, at | |
| most maxsplit splits are done. If maxsplit is omitted, all | |
| splits are made. | |
| For consistency with the ``split`` method of Python strings, any | |
| whitespace (tabs, spaces, newlines) is a separator if sep is None, the | |
| default value | |
| e.g. | |
| >>> from Bio.Seq import Seq | |
| >>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG") | |
| >>> my_aa = my_rna.translate() | |
| >>> my_aa | |
| Seq('VMAIVMGR*KGAR*L') | |
| >>> for pep in my_aa.split("*"): | |
| ... pep | |
| Seq('VMAIVMGR') | |
| Seq('KGAR') | |
| Seq('L') | |
| >>> for pep in my_aa.split("*", 1): | |
| ... pep | |
| Seq('VMAIVMGR') | |
| Seq('KGAR*L') | |
| See also the rsplit method, which splits the sequence starting from the | |
| end: | |
| >>> for pep in my_aa.rsplit("*", 1): | |
| ... pep | |
| Seq('VMAIVMGR*KGAR') | |
| Seq('L') | |
| """ | |
| if isinstance(sep, _SeqAbstractBaseClass): | |
| sep = bytes(sep) | |
| elif isinstance(sep, str): | |
| sep = sep.encode("ASCII") | |
| return [Seq(part) for part in self._data.split(sep, maxsplit)] | |
| def rsplit(self, sep=None, maxsplit=-1): | |
| """Return a list of subsequences by splitting the sequence from the right. | |
| Return a list of the subsequences in the sequence (as Seq objects), | |
| using sep as the delimiter string. If maxsplit is given, at | |
| most maxsplit splits are done. If maxsplit is omitted, all | |
| splits are made. | |
| For consistency with the ``rsplit`` method of Python strings, any | |
| whitespace (tabs, spaces, newlines) is a separator if sep is None, the | |
| default value | |
| e.g. | |
| >>> from Bio.Seq import Seq | |
| >>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG") | |
| >>> my_aa = my_rna.translate() | |
| >>> my_aa | |
| Seq('VMAIVMGR*KGAR*L') | |
| >>> for pep in my_aa.rsplit("*"): | |
| ... pep | |
| Seq('VMAIVMGR') | |
| Seq('KGAR') | |
| Seq('L') | |
| >>> for pep in my_aa.rsplit("*", 1): | |
| ... pep | |
| Seq('VMAIVMGR*KGAR') | |
| Seq('L') | |
| See also the split method, which splits the sequence starting from the | |
| beginning: | |
| >>> for pep in my_aa.split("*", 1): | |
| ... pep | |
| Seq('VMAIVMGR') | |
| Seq('KGAR*L') | |
| """ | |
| if isinstance(sep, _SeqAbstractBaseClass): | |
| sep = bytes(sep) | |
| elif isinstance(sep, str): | |
| sep = sep.encode("ASCII") | |
| return [Seq(part) for part in self._data.rsplit(sep, maxsplit)] | |
| def strip(self, chars=None, inplace=False): | |
| """Return a sequence object with leading and trailing ends stripped. | |
| With default arguments, leading and trailing whitespace is removed: | |
| >>> seq = Seq(" ACGT ") | |
| >>> seq.strip() | |
| Seq('ACGT') | |
| >>> seq | |
| Seq(' ACGT ') | |
| If ``chars`` is given and not ``None``, remove characters in ``chars`` | |
| instead. The order of the characters to be removed is not important: | |
| >>> Seq("ACGTACGT").strip("TGCA") | |
| Seq('') | |
| A copy of the sequence is returned if ``inplace`` is ``False`` (the | |
| default value). If ``inplace`` is ``True``, the sequence is stripped | |
| in-place and returned. | |
| >>> seq = MutableSeq(" ACGT ") | |
| >>> seq.strip(inplace=False) | |
| MutableSeq('ACGT') | |
| >>> seq | |
| MutableSeq(' ACGT ') | |
| >>> seq.strip(inplace=True) | |
| MutableSeq('ACGT') | |
| >>> seq | |
| MutableSeq('ACGT') | |
| As ``Seq`` objects are immutable, a ``TypeError`` is raised if ``strip`` | |
| is called on a ``Seq`` object with ``inplace=True``. | |
| See also the lstrip and rstrip methods. | |
| """ | |
| if isinstance(chars, _SeqAbstractBaseClass): | |
| chars = bytes(chars) | |
| elif isinstance(chars, str): | |
| chars = chars.encode("ASCII") | |
| try: | |
| data = self._data.strip(chars) | |
| except TypeError: | |
| raise TypeError( | |
| "argument must be None or a string, Seq, MutableSeq, or bytes-like object" | |
| ) from None | |
| if inplace: | |
| if not isinstance(self._data, bytearray): | |
| raise TypeError("Sequence is immutable") | |
| self._data[:] = data | |
| return self | |
| else: | |
| return self.__class__(data) | |
| def lstrip(self, chars=None, inplace=False): | |
| """Return a sequence object with leading and trailing ends stripped. | |
| With default arguments, leading whitespace is removed: | |
| >>> seq = Seq(" ACGT ") | |
| >>> seq.lstrip() | |
| Seq('ACGT ') | |
| >>> seq | |
| Seq(' ACGT ') | |
| If ``chars`` is given and not ``None``, remove characters in ``chars`` | |
| from the leading end instead. The order of the characters to be removed | |
| is not important: | |
| >>> Seq("ACGACGTTACG").lstrip("GCA") | |
| Seq('TTACG') | |
| A copy of the sequence is returned if ``inplace`` is ``False`` (the | |
| default value). If ``inplace`` is ``True``, the sequence is stripped | |
| in-place and returned. | |
| >>> seq = MutableSeq(" ACGT ") | |
| >>> seq.lstrip(inplace=False) | |
| MutableSeq('ACGT ') | |
| >>> seq | |
| MutableSeq(' ACGT ') | |
| >>> seq.lstrip(inplace=True) | |
| MutableSeq('ACGT ') | |
| >>> seq | |
| MutableSeq('ACGT ') | |
| As ``Seq`` objects are immutable, a ``TypeError`` is raised if | |
| ``lstrip`` is called on a ``Seq`` object with ``inplace=True``. | |
| See also the strip and rstrip methods. | |
| """ | |
| if isinstance(chars, _SeqAbstractBaseClass): | |
| chars = bytes(chars) | |
| elif isinstance(chars, str): | |
| chars = chars.encode("ASCII") | |
| try: | |
| data = self._data.lstrip(chars) | |
| except TypeError: | |
| raise TypeError( | |
| "argument must be None or a string, Seq, MutableSeq, or bytes-like object" | |
| ) from None | |
| if inplace: | |
| if not isinstance(self._data, bytearray): | |
| raise TypeError("Sequence is immutable") | |
| self._data[:] = data | |
| return self | |
| else: | |
| return self.__class__(data) | |
| def rstrip(self, chars=None, inplace=False): | |
| """Return a sequence object with trailing ends stripped. | |
| With default arguments, trailing whitespace is removed: | |
| >>> seq = Seq(" ACGT ") | |
| >>> seq.rstrip() | |
| Seq(' ACGT') | |
| >>> seq | |
| Seq(' ACGT ') | |
| If ``chars`` is given and not ``None``, remove characters in ``chars`` | |
| from the trailing end instead. The order of the characters to be | |
| removed is not important: | |
| >>> Seq("ACGACGTTACG").rstrip("GCA") | |
| Seq('ACGACGTT') | |
| A copy of the sequence is returned if ``inplace`` is ``False`` (the | |
| default value). If ``inplace`` is ``True``, the sequence is stripped | |
| in-place and returned. | |
| >>> seq = MutableSeq(" ACGT ") | |
| >>> seq.rstrip(inplace=False) | |
| MutableSeq(' ACGT') | |
| >>> seq | |
| MutableSeq(' ACGT ') | |
| >>> seq.rstrip(inplace=True) | |
| MutableSeq(' ACGT') | |
| >>> seq | |
| MutableSeq(' ACGT') | |
| As ``Seq`` objects are immutable, a ``TypeError`` is raised if | |
| ``rstrip`` is called on a ``Seq`` object with ``inplace=True``. | |
| See also the strip and lstrip methods. | |
| """ | |
| if isinstance(chars, _SeqAbstractBaseClass): | |
| chars = bytes(chars) | |
| elif isinstance(chars, str): | |
| chars = chars.encode("ASCII") | |
| try: | |
| data = self._data.rstrip(chars) | |
| except TypeError: | |
| raise TypeError( | |
| "argument must be None or a string, Seq, MutableSeq, or bytes-like object" | |
| ) from None | |
| if inplace: | |
| if not isinstance(self._data, bytearray): | |
| raise TypeError("Sequence is immutable") | |
| self._data[:] = data | |
| return self | |
| else: | |
| return self.__class__(data) | |
| def upper(self, inplace=False): | |
| """Return the sequence in upper case. | |
| An upper-case copy of the sequence is returned if inplace is False, | |
| the default value: | |
| >>> from Bio.Seq import Seq, MutableSeq | |
| >>> my_seq = Seq("VHLTPeeK*") | |
| >>> my_seq | |
| Seq('VHLTPeeK*') | |
| >>> my_seq.lower() | |
| Seq('vhltpeek*') | |
| >>> my_seq.upper() | |
| Seq('VHLTPEEK*') | |
| >>> my_seq | |
| Seq('VHLTPeeK*') | |
| The sequence is modified in-place and returned if inplace is True: | |
| >>> my_seq = MutableSeq("VHLTPeeK*") | |
| >>> my_seq | |
| MutableSeq('VHLTPeeK*') | |
| >>> my_seq.lower() | |
| MutableSeq('vhltpeek*') | |
| >>> my_seq.upper() | |
| MutableSeq('VHLTPEEK*') | |
| >>> my_seq | |
| MutableSeq('VHLTPeeK*') | |
| >>> my_seq.lower(inplace=True) | |
| MutableSeq('vhltpeek*') | |
| >>> my_seq | |
| MutableSeq('vhltpeek*') | |
| >>> my_seq.upper(inplace=True) | |
| MutableSeq('VHLTPEEK*') | |
| >>> my_seq | |
| MutableSeq('VHLTPEEK*') | |
| As ``Seq`` objects are immutable, a ``TypeError`` is raised if | |
| ``upper`` is called on a ``Seq`` object with ``inplace=True``. | |
| See also the ``lower`` method. | |
| """ | |
| data = self._data.upper() | |
| if inplace: | |
| if not isinstance(self._data, bytearray): | |
| raise TypeError("Sequence is immutable") | |
| self._data[:] = data | |
| return self | |
| else: | |
| return self.__class__(data) | |
| def lower(self, inplace=False): | |
| """Return the sequence in lower case. | |
| An lower-case copy of the sequence is returned if inplace is False, | |
| the default value: | |
| >>> from Bio.Seq import Seq, MutableSeq | |
| >>> my_seq = Seq("VHLTPeeK*") | |
| >>> my_seq | |
| Seq('VHLTPeeK*') | |
| >>> my_seq.lower() | |
| Seq('vhltpeek*') | |
| >>> my_seq.upper() | |
| Seq('VHLTPEEK*') | |
| >>> my_seq | |
| Seq('VHLTPeeK*') | |
| The sequence is modified in-place and returned if inplace is True: | |
| >>> my_seq = MutableSeq("VHLTPeeK*") | |
| >>> my_seq | |
| MutableSeq('VHLTPeeK*') | |
| >>> my_seq.lower() | |
| MutableSeq('vhltpeek*') | |
| >>> my_seq.upper() | |
| MutableSeq('VHLTPEEK*') | |
| >>> my_seq | |
| MutableSeq('VHLTPeeK*') | |
| >>> my_seq.lower(inplace=True) | |
| MutableSeq('vhltpeek*') | |
| >>> my_seq | |
| MutableSeq('vhltpeek*') | |
| >>> my_seq.upper(inplace=True) | |
| MutableSeq('VHLTPEEK*') | |
| >>> my_seq | |
| MutableSeq('VHLTPEEK*') | |
| As ``Seq`` objects are immutable, a ``TypeError`` is raised if | |
| ``lower`` is called on a ``Seq`` object with ``inplace=True``. | |
| See also the ``upper`` method. | |
| """ | |
| data = self._data.lower() | |
| if inplace: | |
| if not isinstance(self._data, bytearray): | |
| raise TypeError("Sequence is immutable") | |
| self._data[:] = data | |
| return self | |
| else: | |
| return self.__class__(data) | |
| def isupper(self): | |
| """Return True if all ASCII characters in data are uppercase. | |
| If there are no cased characters, the method returns False. | |
| """ | |
| return self._data.isupper() | |
| def islower(self): | |
| """Return True if all ASCII characters in data are lowercase. | |
| If there are no cased characters, the method returns False. | |
| """ | |
| return self._data.islower() | |
| def translate( | |
| self, table="Standard", stop_symbol="*", to_stop=False, cds=False, gap="-" | |
| ): | |
| """Turn a nucleotide sequence into a protein sequence by creating a new sequence object. | |
| This method will translate DNA or RNA sequences. It should not | |
| be used on protein sequences as any result will be biologically | |
| meaningless. | |
| Arguments: | |
| - table - Which codon table to use? This can be either a name | |
| (string), an NCBI identifier (integer), or a CodonTable | |
| object (useful for non-standard genetic codes). This | |
| defaults to the "Standard" table. | |
| - stop_symbol - Single character string, what to use for | |
| terminators. This defaults to the asterisk, "*". | |
| - to_stop - Boolean, defaults to False meaning do a full | |
| translation continuing on past any stop codons (translated as the | |
| specified stop_symbol). If True, translation is terminated at | |
| the first in frame stop codon (and the stop_symbol is not | |
| appended to the returned protein sequence). | |
| - cds - Boolean, indicates this is a complete CDS. If True, | |
| this checks the sequence starts with a valid alternative start | |
| codon (which will be translated as methionine, M), that the | |
| sequence length is a multiple of three, and that there is a | |
| single in frame stop codon at the end (this will be excluded | |
| from the protein sequence, regardless of the to_stop option). | |
| If these tests fail, an exception is raised. | |
| - gap - Single character string to denote symbol used for gaps. | |
| Defaults to the minus sign. | |
| A ``Seq`` object is returned if ``translate`` is called on a ``Seq`` | |
| object; a ``MutableSeq`` object is returned if ``translate`` is called | |
| pn a ``MutableSeq`` object. | |
| e.g. Using the standard table: | |
| >>> coding_dna = Seq("GTGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG") | |
| >>> coding_dna.translate() | |
| Seq('VAIVMGR*KGAR*') | |
| >>> coding_dna.translate(stop_symbol="@") | |
| Seq('VAIVMGR@KGAR@') | |
| >>> coding_dna.translate(to_stop=True) | |
| Seq('VAIVMGR') | |
| Now using NCBI table 2, where TGA is not a stop codon: | |
| >>> coding_dna.translate(table=2) | |
| Seq('VAIVMGRWKGAR*') | |
| >>> coding_dna.translate(table=2, to_stop=True) | |
| Seq('VAIVMGRWKGAR') | |
| In fact, GTG is an alternative start codon under NCBI table 2, meaning | |
| this sequence could be a complete CDS: | |
| >>> coding_dna.translate(table=2, cds=True) | |
| Seq('MAIVMGRWKGAR') | |
| It isn't a valid CDS under NCBI table 1, due to both the start codon | |
| and also the in frame stop codons: | |
| >>> coding_dna.translate(table=1, cds=True) | |
| Traceback (most recent call last): | |
| ... | |
| Bio.Data.CodonTable.TranslationError: First codon 'GTG' is not a start codon | |
| If the sequence has no in-frame stop codon, then the to_stop argument | |
| has no effect: | |
| >>> coding_dna2 = Seq("TTGGCCATTGTAATGGGCCGC") | |
| >>> coding_dna2.translate() | |
| Seq('LAIVMGR') | |
| >>> coding_dna2.translate(to_stop=True) | |
| Seq('LAIVMGR') | |
| NOTE - Ambiguous codons like "TAN" or "NNN" could be an amino acid | |
| or a stop codon. These are translated as "X". Any invalid codon | |
| (e.g. "TA?" or "T-A") will throw a TranslationError. | |
| NOTE - This does NOT behave like the python string's translate | |
| method. For that use str(my_seq).translate(...) instead | |
| """ | |
| try: | |
| data = str(self) | |
| except UndefinedSequenceError: | |
| # translating an undefined sequence yields an undefined | |
| # sequence with the length divided by 3 | |
| n = len(self) | |
| if n % 3 != 0: | |
| warnings.warn( | |
| "Partial codon, len(sequence) not a multiple of three. " | |
| "This may become an error in future.", | |
| BiopythonWarning, | |
| ) | |
| return Seq(None, n // 3) | |
| return self.__class__( | |
| _translate_str(str(self), table, stop_symbol, to_stop, cds, gap=gap) | |
| ) | |
| def complement(self, inplace=None): | |
| """Return the complement as a DNA sequence. | |
| >>> Seq("CGA").complement() | |
| Seq('GCT') | |
| Any U in the sequence is treated as a T: | |
| >>> Seq("CGAUT").complement(inplace=False) | |
| Seq('GCTAA') | |
| In contrast, ``complement_rna`` returns an RNA sequence: | |
| >>> Seq("CGAUT").complement_rna() | |
| Seq('GCUAA') | |
| The sequence is modified in-place and returned if inplace is True: | |
| >>> my_seq = MutableSeq("CGA") | |
| >>> my_seq | |
| MutableSeq('CGA') | |
| >>> my_seq.complement(inplace=False) | |
| MutableSeq('GCT') | |
| >>> my_seq | |
| MutableSeq('CGA') | |
| >>> my_seq.complement(inplace=True) | |
| MutableSeq('GCT') | |
| >>> my_seq | |
| MutableSeq('GCT') | |
| As ``Seq`` objects are immutable, a ``TypeError`` is raised if | |
| ``complement_rna`` is called on a ``Seq`` object with ``inplace=True``. | |
| """ | |
| ttable = _dna_complement_table | |
| try: | |
| if inplace is None: | |
| # deprecated | |
| if isinstance(self._data, bytearray): # MutableSeq | |
| warnings.warn( | |
| "mutable_seq.complement() will change in the near " | |
| "future and will no longer change the sequence in-" | |
| "place by default. Please use\n" | |
| "\n" | |
| "mutable_seq.complement(inplace=True)\n" | |
| "\n" | |
| "if you want to continue to use this method to change " | |
| "a mutable sequence in-place.", | |
| BiopythonDeprecationWarning, | |
| ) | |
| inplace = True | |
| if isinstance(self._data, _PartiallyDefinedSequenceData): | |
| for seq in self._data._data.values(): | |
| if b"U" in seq or b"u" in seq: | |
| warnings.warn( | |
| "seq.complement() will change in the near " | |
| "future to always return DNA nucleotides only. " | |
| "Please use\n" | |
| "\n" | |
| "seq.complement_rna()\n" | |
| "\n" | |
| "if you want to receive an RNA sequence instead.", | |
| BiopythonDeprecationWarning, | |
| ) | |
| for seq in self._data._data.values(): | |
| if b"t" in seq or b"T" in seq: | |
| raise ValueError("Mixed RNA/DNA found") | |
| ttable = _rna_complement_table | |
| break | |
| elif b"U" in self._data or b"u" in self._data: | |
| warnings.warn( | |
| "seq.complement() will change in the near future to " | |
| "always return DNA nucleotides only. " | |
| "Please use\n" | |
| "\n" | |
| "seq.complement_rna()\n" | |
| "\n" | |
| "if you want to receive an RNA sequence instead.", | |
| BiopythonDeprecationWarning, | |
| ) | |
| if b"t" in self._data or b"T" in self._data: | |
| raise ValueError("Mixed RNA/DNA found") | |
| ttable = _rna_complement_table | |
| data = self._data.translate(ttable) | |
| except UndefinedSequenceError: | |
| # complement of an undefined sequence is an undefined sequence | |
| # of the same length | |
| return self | |
| if inplace: | |
| if not isinstance(self._data, bytearray): | |
| raise TypeError("Sequence is immutable") | |
| self._data[:] = data | |
| return self | |
| return self.__class__(data) | |
| def complement_rna(self, inplace=False): | |
| """Return the complement as an RNA sequence. | |
| >>> Seq("CGA").complement_rna() | |
| Seq('GCU') | |
| Any T in the sequence is treated as a U: | |
| >>> Seq("CGAUT").complement_rna() | |
| Seq('GCUAA') | |
| In contrast, ``complement`` returns a DNA sequence by default: | |
| >>> Seq("CGA").complement() | |
| Seq('GCT') | |
| The sequence is modified in-place and returned if inplace is True: | |
| >>> my_seq = MutableSeq("CGA") | |
| >>> my_seq | |
| MutableSeq('CGA') | |
| >>> my_seq.complement_rna() | |
| MutableSeq('GCU') | |
| >>> my_seq | |
| MutableSeq('CGA') | |
| >>> my_seq.complement_rna(inplace=True) | |
| MutableSeq('GCU') | |
| >>> my_seq | |
| MutableSeq('GCU') | |
| As ``Seq`` objects are immutable, a ``TypeError`` is raised if | |
| ``complement_rna`` is called on a ``Seq`` object with ``inplace=True``. | |
| """ | |
| try: | |
| data = self._data.translate(_rna_complement_table) | |
| except UndefinedSequenceError: | |
| # complement of an undefined sequence is an undefined sequence | |
| # of the same length | |
| return self | |
| if inplace: | |
| if not isinstance(self._data, bytearray): | |
| raise TypeError("Sequence is immutable") | |
| self._data[:] = data | |
| return self | |
| return self.__class__(data) | |
| def reverse_complement(self, inplace=None): | |
| """Return the reverse complement as a DNA sequence. | |
| >>> Seq("CGA").reverse_complement(inplace=False) | |
| Seq('TCG') | |
| Any U in the sequence is treated as a T: | |
| >>> Seq("CGAUT").reverse_complement(inplace=False) | |
| Seq('AATCG') | |
| In contrast, ``reverse_complement_rna`` returns an RNA sequence: | |
| >>> Seq("CGA").reverse_complement_rna() | |
| Seq('UCG') | |
| The sequence is modified in-place and returned if inplace is True: | |
| >>> my_seq = MutableSeq("CGA") | |
| >>> my_seq | |
| MutableSeq('CGA') | |
| >>> my_seq.reverse_complement(inplace=False) | |
| MutableSeq('TCG') | |
| >>> my_seq | |
| MutableSeq('CGA') | |
| >>> my_seq.reverse_complement(inplace=True) | |
| MutableSeq('TCG') | |
| >>> my_seq | |
| MutableSeq('TCG') | |
| As ``Seq`` objects are immutable, a ``TypeError`` is raised if | |
| ``reverse_complement`` is called on a ``Seq`` object with | |
| ``inplace=True``. | |
| """ | |
| try: | |
| if inplace is None: | |
| # deprecated | |
| if isinstance(self._data, bytearray): # MutableSeq | |
| warnings.warn( | |
| "mutable_seq.reverse_complement() will change in the " | |
| "near future and will no longer change the sequence in-" | |
| "place by default. Please use\n" | |
| "\n" | |
| "mutable_seq.reverse_complement(inplace=True)\n" | |
| "\n" | |
| "if you want to continue to use this method to change " | |
| "a mutable sequence in-place.", | |
| BiopythonDeprecationWarning, | |
| ) | |
| inplace = True | |
| else: | |
| inplace = False | |
| if isinstance(self._data, _PartiallyDefinedSequenceData): | |
| for seq in self._data._data.values(): | |
| if b"U" in seq or b"u" in seq: | |
| warnings.warn( | |
| "seq.reverse_complement() will change in the near " | |
| "future to always return DNA nucleotides only. " | |
| "Please use\n" | |
| "\n" | |
| "seq.reverse_complement_rna()\n" | |
| "\n" | |
| "if you want to receive an RNA sequence instead.", | |
| BiopythonDeprecationWarning, | |
| ) | |
| for seq in self._data._data.values(): | |
| if b"t" in seq or b"T" in seq: | |
| raise ValueError("Mixed RNA/DNA found") | |
| return self.reverse_complement_rna(inplace=inplace) | |
| elif b"U" in self._data or b"u" in self._data: | |
| warnings.warn( | |
| "seq.reverse_complement() will change in the near " | |
| "future to always return DNA nucleotides only. " | |
| "Please use\n" | |
| "\n" | |
| "seq.reverse_complement_rna()\n" | |
| "\n" | |
| "if you want to receive an RNA sequence instead.", | |
| BiopythonDeprecationWarning, | |
| ) | |
| if b"t" in self._data or b"T" in self._data: | |
| raise ValueError("Mixed RNA/DNA found") | |
| return self.reverse_complement_rna(inplace=inplace) | |
| data = self._data.translate(_dna_complement_table) | |
| except UndefinedSequenceError: | |
| # reverse complement of an undefined sequence is an undefined sequence | |
| # of the same length | |
| return self | |
| if inplace: | |
| if not isinstance(self._data, bytearray): | |
| raise TypeError("Sequence is immutable") | |
| self._data[::-1] = data | |
| return self | |
| return self.__class__(data[::-1]) | |
| def reverse_complement_rna(self, inplace=False): | |
| """Return the reverse complement as an RNA sequence. | |
| >>> Seq("CGA").reverse_complement_rna() | |
| Seq('UCG') | |
| Any T in the sequence is treated as a U: | |
| >>> Seq("CGAUT").reverse_complement_rna() | |
| Seq('AAUCG') | |
| In contrast, ``reverse_complement`` returns a DNA sequence: | |
| >>> Seq("CGA").reverse_complement(inplace=False) | |
| Seq('TCG') | |
| The sequence is modified in-place and returned if inplace is True: | |
| >>> my_seq = MutableSeq("CGA") | |
| >>> my_seq | |
| MutableSeq('CGA') | |
| >>> my_seq.reverse_complement_rna() | |
| MutableSeq('UCG') | |
| >>> my_seq | |
| MutableSeq('CGA') | |
| >>> my_seq.reverse_complement_rna(inplace=True) | |
| MutableSeq('UCG') | |
| >>> my_seq | |
| MutableSeq('UCG') | |
| As ``Seq`` objects are immutable, a ``TypeError`` is raised if | |
| ``reverse_complement_rna`` is called on a ``Seq`` object with | |
| ``inplace=True``. | |
| """ | |
| try: | |
| data = self._data.translate(_rna_complement_table) | |
| except UndefinedSequenceError: | |
| # reverse complement of an undefined sequence is an undefined sequence | |
| # of the same length | |
| return self | |
| if inplace: | |
| if not isinstance(self._data, bytearray): | |
| raise TypeError("Sequence is immutable") | |
| self._data[::-1] = data | |
| return self | |
| return self.__class__(data[::-1]) | |
| def transcribe(self, inplace=False): | |
| """Transcribe a DNA sequence into RNA and return the RNA sequence as a new Seq object. | |
| >>> from Bio.Seq import Seq | |
| >>> coding_dna = Seq("ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG") | |
| >>> coding_dna | |
| Seq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG') | |
| >>> coding_dna.transcribe() | |
| Seq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG') | |
| The sequence is modified in-place and returned if inplace is True: | |
| >>> sequence = MutableSeq("ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG") | |
| >>> sequence | |
| MutableSeq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG') | |
| >>> sequence.transcribe() | |
| MutableSeq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG') | |
| >>> sequence | |
| MutableSeq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG') | |
| >>> sequence.transcribe(inplace=True) | |
| MutableSeq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG') | |
| >>> sequence | |
| MutableSeq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG') | |
| As ``Seq`` objects are immutable, a ``TypeError`` is raised if | |
| ``transcribe`` is called on a ``Seq`` object with ``inplace=True``. | |
| Trying to transcribe an RNA sequence has no effect. | |
| If you have a nucleotide sequence which might be DNA or RNA | |
| (or even a mixture), calling the transcribe method will ensure | |
| any T becomes U. | |
| Trying to transcribe a protein sequence will replace any | |
| T for Threonine with U for Selenocysteine, which has no | |
| biologically plausible rational. | |
| >>> from Bio.Seq import Seq | |
| >>> my_protein = Seq("MAIVMGRT") | |
| >>> my_protein.transcribe() | |
| Seq('MAIVMGRU') | |
| """ | |
| data = self._data.replace(b"T", b"U").replace(b"t", b"u") | |
| if inplace: | |
| if not isinstance(self._data, bytearray): | |
| raise TypeError("Sequence is immutable") | |
| self._data[:] = data | |
| return self | |
| return self.__class__(data) | |
| def back_transcribe(self, inplace=False): | |
| """Return the DNA sequence from an RNA sequence by creating a new Seq object. | |
| >>> from Bio.Seq import Seq | |
| >>> messenger_rna = Seq("AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG") | |
| >>> messenger_rna | |
| Seq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG') | |
| >>> messenger_rna.back_transcribe() | |
| Seq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG') | |
| The sequence is modified in-place and returned if inplace is True: | |
| >>> sequence = MutableSeq("AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG") | |
| >>> sequence | |
| MutableSeq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG') | |
| >>> sequence.back_transcribe() | |
| MutableSeq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG') | |
| >>> sequence | |
| MutableSeq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG') | |
| >>> sequence.back_transcribe(inplace=True) | |
| MutableSeq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG') | |
| >>> sequence | |
| MutableSeq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG') | |
| As ``Seq`` objects are immutable, a ``TypeError`` is raised if | |
| ``transcribe`` is called on a ``Seq`` object with ``inplace=True``. | |
| Trying to back-transcribe DNA has no effect, If you have a nucleotide | |
| sequence which might be DNA or RNA (or even a mixture), calling the | |
| back-transcribe method will ensure any U becomes T. | |
| Trying to back-transcribe a protein sequence will replace any U for | |
| Selenocysteine with T for Threonine, which is biologically meaningless. | |
| >>> from Bio.Seq import Seq | |
| >>> my_protein = Seq("MAIVMGRU") | |
| >>> my_protein.back_transcribe() | |
| Seq('MAIVMGRT') | |
| """ | |
| data = self._data.replace(b"U", b"T").replace(b"u", b"t") | |
| if inplace: | |
| if not isinstance(self._data, bytearray): | |
| raise TypeError("Sequence is immutable") | |
| self._data[:] = data | |
| return self | |
| return self.__class__(data) | |
| def join(self, other): | |
| """Return a merge of the sequences in other, spaced by the sequence from self. | |
| Accepts a Seq object, MutableSeq object, or string (and iterates over | |
| the letters), or an iterable containing Seq, MutableSeq, or string | |
| objects. These arguments will be concatenated with the calling sequence | |
| as the spacer: | |
| >>> concatenated = Seq('NNNNN').join([Seq("AAA"), Seq("TTT"), Seq("PPP")]) | |
| >>> concatenated | |
| Seq('AAANNNNNTTTNNNNNPPP') | |
| Joining the letters of a single sequence: | |
| >>> Seq('NNNNN').join(Seq("ACGT")) | |
| Seq('ANNNNNCNNNNNGNNNNNT') | |
| >>> Seq('NNNNN').join("ACGT") | |
| Seq('ANNNNNCNNNNNGNNNNNT') | |
| """ | |
| if isinstance(other, _SeqAbstractBaseClass): | |
| return self.__class__(str(self).join(str(other))) | |
| elif isinstance(other, str): | |
| return self.__class__(str(self).join(other)) | |
| from Bio.SeqRecord import SeqRecord # Lazy to avoid circular imports | |
| if isinstance(other, SeqRecord): | |
| raise TypeError("Iterable cannot be a SeqRecord") | |
| for c in other: | |
| if isinstance(c, SeqRecord): | |
| raise TypeError("Iterable cannot contain SeqRecords") | |
| elif not isinstance(c, (str, _SeqAbstractBaseClass)): | |
| raise TypeError( | |
| "Input must be an iterable of Seq objects, MutableSeq objects, or strings" | |
| ) | |
| return self.__class__(str(self).join([str(_) for _ in other])) | |
| def replace(self, old, new, inplace=False): | |
| """Return a copy with all occurrences of subsequence old replaced by new. | |
| >>> s = Seq("ACGTAACCGGTT") | |
| >>> t = s.replace("AC", "XYZ") | |
| >>> s | |
| Seq('ACGTAACCGGTT') | |
| >>> t | |
| Seq('XYZGTAXYZCGGTT') | |
| For mutable sequences, passing inplace=True will modify the sequence in place: | |
| >>> m = MutableSeq("ACGTAACCGGTT") | |
| >>> t = m.replace("AC", "XYZ") | |
| >>> m | |
| MutableSeq('ACGTAACCGGTT') | |
| >>> t | |
| MutableSeq('XYZGTAXYZCGGTT') | |
| >>> m = MutableSeq("ACGTAACCGGTT") | |
| >>> t = m.replace("AC", "XYZ", inplace=True) | |
| >>> m | |
| MutableSeq('XYZGTAXYZCGGTT') | |
| >>> t | |
| MutableSeq('XYZGTAXYZCGGTT') | |
| As ``Seq`` objects are immutable, a ``TypeError`` is raised if | |
| ``replace`` is called on a ``Seq`` object with ``inplace=True``. | |
| """ | |
| if isinstance(old, _SeqAbstractBaseClass): | |
| old = bytes(old) | |
| elif isinstance(old, str): | |
| old = old.encode("ASCII") | |
| if isinstance(new, _SeqAbstractBaseClass): | |
| new = bytes(new) | |
| elif isinstance(new, str): | |
| new = new.encode("ASCII") | |
| data = self._data.replace(old, new) | |
| if inplace: | |
| if not isinstance(self._data, bytearray): | |
| raise TypeError("Sequence is immutable") | |
| self._data[:] = data | |
| return self | |
| return self.__class__(data) | |
| def defined(self): | |
| """Return True if the sequence is defined, False if undefined or partially defined. | |
| Zero-length sequences are always considered to be defined. | |
| """ | |
| if isinstance(self._data, (bytes, bytearray)): | |
| return True | |
| else: | |
| return self._data.defined | |
| def defined_ranges(self): | |
| """Return a tuple of the ranges where the sequence contents is defined. | |
| The return value has the format ((start1, end1), (start2, end2), ...). | |
| """ | |
| if isinstance(self._data, (bytes, bytearray)): | |
| length = len(self) | |
| if length > 0: | |
| return ((0, length),) | |
| else: | |
| return () | |
| else: | |
| return self._data.defined_ranges | |
| class Seq(_SeqAbstractBaseClass): | |
| """Read-only sequence object (essentially a string with biological methods). | |
| Like normal python strings, our basic sequence object is immutable. | |
| This prevents you from doing my_seq[5] = "A" for example, but does allow | |
| Seq objects to be used as dictionary keys. | |
| The Seq object provides a number of string like methods (such as count, | |
| find, split and strip). | |
| The Seq object also provides some biological methods, such as complement, | |
| reverse_complement, transcribe, back_transcribe and translate (which are | |
| not applicable to protein sequences). | |
| """ | |
| def __init__(self, data, length=None): | |
| """Create a Seq object. | |
| Arguments: | |
| - data - Sequence, required (string) | |
| - length - Sequence length, used only if data is None or a dictionary (integer) | |
| You will typically use Bio.SeqIO to read in sequences from files as | |
| SeqRecord objects, whose sequence will be exposed as a Seq object via | |
| the seq property. | |
| However, you can also create a Seq object directly: | |
| >>> from Bio.Seq import Seq | |
| >>> my_seq = Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF") | |
| >>> my_seq | |
| Seq('MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF') | |
| >>> print(my_seq) | |
| MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF | |
| To create a Seq object with for a sequence of known length but | |
| unknown sequence contents, use None for the data argument and pass | |
| the sequence length for the length argument. Trying to access the | |
| sequence contents of a Seq object created in this way will raise | |
| an UndefinedSequenceError: | |
| >>> my_undefined_sequence = Seq(None, 20) | |
| >>> my_undefined_sequence | |
| Seq(None, length=20) | |
| >>> len(my_undefined_sequence) | |
| 20 | |
| >>> print(my_undefined_sequence) | |
| Traceback (most recent call last): | |
| ... | |
| Bio.Seq.UndefinedSequenceError: Sequence content is undefined | |
| If the sequence contents is known for parts of the sequence only, use | |
| a dictionary for the data argument to pass the known sequence segments: | |
| >>> my_partially_defined_sequence = Seq({3: "ACGT"}, 10) | |
| >>> my_partially_defined_sequence | |
| Seq({3: 'ACGT'}, length=10) | |
| >>> len(my_partially_defined_sequence) | |
| 10 | |
| >>> print(my_partially_defined_sequence) | |
| Traceback (most recent call last): | |
| ... | |
| Bio.Seq.UndefinedSequenceError: Sequence content is only partially defined | |
| >>> my_partially_defined_sequence[3:7] | |
| Seq('ACGT') | |
| >>> print(my_partially_defined_sequence[3:7]) | |
| ACGT | |
| """ | |
| if data is None: | |
| if length is None: | |
| raise ValueError("length must not be None if data is None") | |
| elif length == 0: | |
| self._data = b"" | |
| elif length < 0: | |
| raise ValueError("length must not be negative.") | |
| else: | |
| self._data = _UndefinedSequenceData(length) | |
| elif isinstance(data, (bytes, SequenceDataAbstractBaseClass)): | |
| self._data = data | |
| elif isinstance(data, (bytearray, _SeqAbstractBaseClass)): | |
| self._data = bytes(data) | |
| elif isinstance(data, str): | |
| self._data = bytes(data, encoding="ASCII") | |
| elif isinstance(data, dict): | |
| if length is None: | |
| raise ValueError("length must not be None if data is a dictionary") | |
| elif length == 0: | |
| self._data = b"" | |
| elif length < 0: | |
| raise ValueError("length must not be negative.") | |
| else: | |
| end = -1 | |
| starts = sorted(data.keys()) | |
| _data = {} | |
| for start in starts: | |
| seq = data[start] | |
| if isinstance(seq, str): | |
| seq = bytes(seq, encoding="ASCII") | |
| else: | |
| try: | |
| seq = bytes(seq) | |
| except Exception: | |
| raise ValueError("Expected bytes-like objects or strings") | |
| if start < end: | |
| raise ValueError("Sequence data are overlapping.") | |
| elif start == end: | |
| _data[current] += seq # noqa: F821 | |
| else: | |
| _data[start] = seq | |
| current = start | |
| end = start + len(seq) | |
| if end > length: | |
| raise ValueError( | |
| "Provided sequence data extend beyond sequence length." | |
| ) | |
| elif end == length and current == 0: | |
| # sequence is fully defined | |
| self._data = _data[current] | |
| else: | |
| self._data = _PartiallyDefinedSequenceData(length, _data) | |
| else: | |
| raise TypeError( | |
| "data should be a string, bytes, bytearray, Seq, or MutableSeq object" | |
| ) | |
| def __hash__(self): | |
| """Hash of the sequence as a string for comparison. | |
| See Seq object comparison documentation (method ``__eq__`` in | |
| particular) as this has changed in Biopython 1.65. Older versions | |
| would hash on object identity. | |
| """ | |
| return hash(self._data) | |
| def ungap(self, gap="-"): | |
| """Return a copy of the sequence without the gap character(s) (DEPRECATED). | |
| The gap character now defaults to the minus sign, and can only | |
| be specified via the method argument. This is no longer possible | |
| via the sequence's alphabet (as was possible up to Biopython 1.77): | |
| >>> from Bio.Seq import Seq | |
| >>> my_dna = Seq("-ATA--TGAAAT-TTGAAAA") | |
| >>> my_dna | |
| Seq('-ATA--TGAAAT-TTGAAAA') | |
| >>> my_dna.ungap("-") | |
| Seq('ATATGAAATTTGAAAA') | |
| This method is DEPRECATED; please use my_dna.replace(gap, "") instead. | |
| """ | |
| warnings.warn( | |
| """\ | |
| myseq.ungap(gap) is deprecated; please use myseq.replace(gap, "") instead.""", | |
| BiopythonDeprecationWarning, | |
| ) | |
| if not gap: | |
| raise ValueError("Gap character required.") | |
| elif len(gap) != 1 or not isinstance(gap, str): | |
| raise ValueError(f"Unexpected gap character, {gap!r}") | |
| return self.replace(gap, b"") | |
| class MutableSeq(_SeqAbstractBaseClass): | |
| """An editable sequence object. | |
| Unlike normal python strings and our basic sequence object (the Seq class) | |
| which are immutable, the MutableSeq lets you edit the sequence in place. | |
| However, this means you cannot use a MutableSeq object as a dictionary key. | |
| >>> from Bio.Seq import MutableSeq | |
| >>> my_seq = MutableSeq("ACTCGTCGTCG") | |
| >>> my_seq | |
| MutableSeq('ACTCGTCGTCG') | |
| >>> my_seq[5] | |
| 'T' | |
| >>> my_seq[5] = "A" | |
| >>> my_seq | |
| MutableSeq('ACTCGACGTCG') | |
| >>> my_seq[5] | |
| 'A' | |
| >>> my_seq[5:8] = "NNN" | |
| >>> my_seq | |
| MutableSeq('ACTCGNNNTCG') | |
| >>> len(my_seq) | |
| 11 | |
| Note that the MutableSeq object does not support as many string-like | |
| or biological methods as the Seq object. | |
| """ | |
| def __init__(self, data): | |
| """Create a MutableSeq object.""" | |
| if isinstance(data, bytearray): | |
| self._data = data | |
| elif isinstance(data, bytes): | |
| self._data = bytearray(data) | |
| elif isinstance(data, str): | |
| self._data = bytearray(data, "ASCII") | |
| elif isinstance(data, MutableSeq): | |
| self._data = data._data[:] # Take a copy | |
| elif isinstance(data, Seq): | |
| # Make no assumptions about the Seq subclass internal storage | |
| self._data = bytearray(bytes(data)) | |
| else: | |
| raise TypeError( | |
| "data should be a string, bytearray object, Seq object, or a " | |
| "MutableSeq object" | |
| ) | |
| def __setitem__(self, index, value): | |
| """Set a subsequence of single letter via value parameter. | |
| >>> my_seq = MutableSeq('ACTCGACGTCG') | |
| >>> my_seq[0] = 'T' | |
| >>> my_seq | |
| MutableSeq('TCTCGACGTCG') | |
| """ | |
| if isinstance(index, numbers.Integral): | |
| # Replacing a single letter with a new string | |
| self._data[index] = ord(value) | |
| else: | |
| # Replacing a sub-sequence | |
| if isinstance(value, MutableSeq): | |
| self._data[index] = value._data | |
| elif isinstance(value, Seq): | |
| self._data[index] = bytes(value) | |
| elif isinstance(value, str): | |
| self._data[index] = value.encode("ASCII") | |
| else: | |
| raise TypeError(f"received unexpected type '{type(value).__name__}'") | |
| def __delitem__(self, index): | |
| """Delete a subsequence of single letter. | |
| >>> my_seq = MutableSeq('ACTCGACGTCG') | |
| >>> del my_seq[0] | |
| >>> my_seq | |
| MutableSeq('CTCGACGTCG') | |
| """ | |
| # Could be deleting a single letter, or a slice | |
| del self._data[index] | |
| def append(self, c): | |
| """Add a subsequence to the mutable sequence object. | |
| >>> my_seq = MutableSeq('ACTCGACGTCG') | |
| >>> my_seq.append('A') | |
| >>> my_seq | |
| MutableSeq('ACTCGACGTCGA') | |
| No return value. | |
| """ | |
| self._data.append(ord(c.encode("ASCII"))) | |
| def insert(self, i, c): | |
| """Add a subsequence to the mutable sequence object at a given index. | |
| >>> my_seq = MutableSeq('ACTCGACGTCG') | |
| >>> my_seq.insert(0,'A') | |
| >>> my_seq | |
| MutableSeq('AACTCGACGTCG') | |
| >>> my_seq.insert(8,'G') | |
| >>> my_seq | |
| MutableSeq('AACTCGACGGTCG') | |
| No return value. | |
| """ | |
| self._data.insert(i, ord(c.encode("ASCII"))) | |
| def pop(self, i=(-1)): | |
| """Remove a subsequence of a single letter at given index. | |
| >>> my_seq = MutableSeq('ACTCGACGTCG') | |
| >>> my_seq.pop() | |
| 'G' | |
| >>> my_seq | |
| MutableSeq('ACTCGACGTC') | |
| >>> my_seq.pop() | |
| 'C' | |
| >>> my_seq | |
| MutableSeq('ACTCGACGT') | |
| Returns the last character of the sequence. | |
| """ | |
| c = self._data[i] | |
| del self._data[i] | |
| return chr(c) | |
| def remove(self, item): | |
| """Remove a subsequence of a single letter from mutable sequence. | |
| >>> my_seq = MutableSeq('ACTCGACGTCG') | |
| >>> my_seq.remove('C') | |
| >>> my_seq | |
| MutableSeq('ATCGACGTCG') | |
| >>> my_seq.remove('A') | |
| >>> my_seq | |
| MutableSeq('TCGACGTCG') | |
| No return value. | |
| """ | |
| codepoint = ord(item) | |
| try: | |
| self._data.remove(codepoint) | |
| except ValueError: | |
| raise ValueError("value not found in MutableSeq") from None | |
| def reverse(self): | |
| """Modify the mutable sequence to reverse itself. | |
| No return value. | |
| """ | |
| self._data.reverse() | |
| def extend(self, other): | |
| """Add a sequence to the original mutable sequence object. | |
| >>> my_seq = MutableSeq('ACTCGACGTCG') | |
| >>> my_seq.extend('A') | |
| >>> my_seq | |
| MutableSeq('ACTCGACGTCGA') | |
| >>> my_seq.extend('TTT') | |
| >>> my_seq | |
| MutableSeq('ACTCGACGTCGATTT') | |
| No return value. | |
| """ | |
| if isinstance(other, MutableSeq): | |
| self._data.extend(other._data) | |
| elif isinstance(other, Seq): | |
| self._data.extend(bytes(other)) | |
| elif isinstance(other, str): | |
| self._data.extend(other.encode("ASCII")) | |
| else: | |
| raise TypeError("expected a string, Seq or MutableSeq") | |
| class UndefinedSequenceError(ValueError): | |
| """Sequence contents is undefined.""" | |
| class _UndefinedSequenceData(SequenceDataAbstractBaseClass): | |
| """Stores the length of a sequence with an undefined sequence contents (PRIVATE). | |
| Objects of this class can be used to create a Seq object to represent | |
| sequences with a known length, but an unknown sequence contents. | |
| Calling __len__ returns the sequence length, calling __getitem__ raises an | |
| UndefinedSequenceError except for requests of zero size, for which it | |
| returns an empty bytes object. | |
| """ | |
| __slots__ = ("_length",) | |
| def __init__(self, length): | |
| """Initialize the object with the sequence length. | |
| The calling function is responsible for ensuring that the length is | |
| greater than zero. | |
| """ | |
| self._length = length | |
| super().__init__() | |
| def __getitem__(self, key): | |
| if isinstance(key, slice): | |
| start, end, step = key.indices(self._length) | |
| size = len(range(start, end, step)) | |
| if size == 0: | |
| return b"" | |
| return _UndefinedSequenceData(size) | |
| else: | |
| raise UndefinedSequenceError("Sequence content is undefined") | |
| def __len__(self): | |
| return self._length | |
| def __bytes__(self): | |
| raise UndefinedSequenceError("Sequence content is undefined") | |
| def __add__(self, other): | |
| length = len(self) + len(other) | |
| try: | |
| other = bytes(other) | |
| except UndefinedSequenceError: | |
| if isinstance(other, _UndefinedSequenceData): | |
| return _UndefinedSequenceData(length) | |
| else: | |
| return NotImplemented | |
| # _PartiallyDefinedSequenceData.__radd__ will handle this | |
| else: | |
| data = {len(self): other} | |
| return _PartiallyDefinedSequenceData(length, data) | |
| def __radd__(self, other): | |
| data = {0: bytes(other)} | |
| length = len(other) + len(self) | |
| return _PartiallyDefinedSequenceData(length, data) | |
| def upper(self): | |
| """Return an upper case copy of the sequence.""" | |
| # An upper case copy of an undefined sequence is an undefined | |
| # sequence of the same length | |
| return _UndefinedSequenceData(self._length) | |
| def lower(self): | |
| """Return a lower case copy of the sequence.""" | |
| # A lower case copy of an undefined sequence is an undefined | |
| # sequence of the same length | |
| return _UndefinedSequenceData(self._length) | |
| def isupper(self): | |
| """Return True if all ASCII characters in data are uppercase. | |
| If there are no cased characters, the method returns False. | |
| """ | |
| # Character case is irrelevant for an undefined sequence | |
| raise UndefinedSequenceError("Sequence content is undefined") | |
| def islower(self): | |
| """Return True if all ASCII characters in data are lowercase. | |
| If there are no cased characters, the method returns False. | |
| """ | |
| # Character case is irrelevant for an undefined sequence | |
| raise UndefinedSequenceError("Sequence content is undefined") | |
| def replace(self, old, new): | |
| """Return a copy with all occurrences of substring old replaced by new.""" | |
| # Replacing substring old by new in an undefined sequence will result | |
| # in an undefined sequence of the same length, if old and new have the | |
| # number of characters. | |
| if len(old) != len(new): | |
| raise UndefinedSequenceError("Sequence content is undefined") | |
| return _UndefinedSequenceData(self._length) | |
| def defined(self): | |
| """Return False, as the sequence is not defined and has a non-zero length.""" | |
| return False | |
| def defined_ranges(self): | |
| """Return a tuple of the ranges where the sequence contents is defined. | |
| As the sequence contents of an _UndefinedSequenceData object is fully | |
| undefined, the return value is always an empty tuple. | |
| """ | |
| return () | |
| class _PartiallyDefinedSequenceData(SequenceDataAbstractBaseClass): | |
| """Stores the length of a sequence with an undefined sequence contents (PRIVATE). | |
| Objects of this class can be used to create a Seq object to represent | |
| sequences with a known length, but with a sequence contents that is only | |
| partially known. | |
| Calling __len__ returns the sequence length, calling __getitem__ returns | |
| the sequence contents if known, otherwise an UndefinedSequenceError is | |
| raised. | |
| """ | |
| __slots__ = ("_length", "_data") | |
| def __init__(self, length, data): | |
| """Initialize with the sequence length and defined sequence segments. | |
| The calling function is responsible for ensuring that the length is | |
| greater than zero. | |
| """ | |
| self._length = length | |
| self._data = data | |
| super().__init__() | |
| def __getitem__(self, key): | |
| if isinstance(key, slice): | |
| start, end, step = key.indices(self._length) | |
| size = len(range(start, end, step)) | |
| if size == 0: | |
| return b"" | |
| data = {} | |
| for s, d in self._data.items(): | |
| indices = range(-s, -s + self._length)[key] | |
| e = indices.stop | |
| if step > 0: | |
| if e <= 0: | |
| continue | |
| if indices.start < 0: | |
| s = indices.start % step | |
| else: | |
| s = indices.start | |
| else: # step < 0 | |
| if e < 0: | |
| e = None | |
| end = len(d) - 1 | |
| if indices.start > end: | |
| s = end + (indices.start - end) % step | |
| else: | |
| s = indices.start | |
| if s < 0: | |
| continue | |
| start = (s - indices.start) // step | |
| d = d[s:e:step] | |
| if d: | |
| data[start] = d | |
| if len(data) == 0: # Fully undefined sequence | |
| return _UndefinedSequenceData(size) | |
| # merge adjacent sequence segments | |
| end = -1 | |
| previous = None # not needed here, but it keeps flake happy | |
| items = data.items() | |
| data = {} | |
| for start, seq in items: | |
| if end == start: | |
| data[previous] += seq | |
| else: | |
| data[start] = seq | |
| previous = start | |
| end = start + len(seq) | |
| if len(data) == 1: | |
| seq = data.get(0) | |
| if seq is not None and len(seq) == size: | |
| return seq # Fully defined sequence; return bytes | |
| if step < 0: | |
| # use this after we drop Python 3.7: | |
| # data = {start: data[start] for start in reversed(data)} | |
| # use this as long as we support Python 3.7: | |
| data = {start: data[start] for start in reversed(list(data.keys()))} | |
| return _PartiallyDefinedSequenceData(size, data) | |
| elif self._length <= key: | |
| raise IndexError("sequence index out of range") | |
| else: | |
| for start, seq in self._data.items(): | |
| if start <= key and key < start + len(seq): | |
| return seq[key - start] | |
| raise UndefinedSequenceError("Sequence at position %d is undefined" % key) | |
| def __len__(self): | |
| return self._length | |
| def __bytes__(self): | |
| raise UndefinedSequenceError("Sequence content is only partially defined") | |
| def __add__(self, other): | |
| length = len(self) + len(other) | |
| data = dict(self._data) | |
| items = list(self._data.items()) | |
| start, seq = items[-1] | |
| end = start + len(seq) | |
| try: | |
| other = bytes(other) | |
| except UndefinedSequenceError: | |
| if isinstance(other, _UndefinedSequenceData): | |
| pass | |
| elif isinstance(other, _PartiallyDefinedSequenceData): | |
| other_items = list(other._data.items()) | |
| if end == len(self): | |
| other_start, other_seq = other_items.pop(0) | |
| if other_start == 0: | |
| data[start] += other_seq | |
| else: | |
| data[len(self) + other_start] = other_seq | |
| for other_start, other_seq in other_items: | |
| data[len(self) + other_start] = other_seq | |
| else: | |
| if end == len(self): | |
| data[start] += other | |
| else: | |
| data[len(self)] = other | |
| return _PartiallyDefinedSequenceData(length, data) | |
| def __radd__(self, other): | |
| length = len(other) + len(self) | |
| try: | |
| other = bytes(other) | |
| except UndefinedSequenceError: | |
| data = {len(other) + start: seq for start, seq in self._data.items()} | |
| else: | |
| data = {0: other} | |
| items = list(self._data.items()) | |
| start, seq = items.pop(0) | |
| if start == 0: | |
| data[0] += seq | |
| else: | |
| data[len(other) + start] = seq | |
| for start, seq in items: | |
| data[len(other) + start] = seq | |
| return _PartiallyDefinedSequenceData(length, data) | |
| def __mul__(self, other): | |
| length = self._length | |
| items = self._data.items() | |
| data = {} | |
| end = -1 | |
| previous = None # not needed here, but it keeps flake happy | |
| for i in range(other): | |
| for start, seq in items: | |
| start += i * length | |
| if end == start: | |
| data[previous] += seq | |
| else: | |
| data[start] = seq | |
| previous = start | |
| end = start + len(seq) | |
| return _PartiallyDefinedSequenceData(length * other, data) | |
| def upper(self): | |
| """Return an upper case copy of the sequence.""" | |
| data = {start: seq.upper() for start, seq in self._data.items()} | |
| return _PartiallyDefinedSequenceData(self._length, data) | |
| def lower(self): | |
| """Return a lower case copy of the sequence.""" | |
| data = {start: seq.lower() for start, seq in self._data.items()} | |
| return _PartiallyDefinedSequenceData(self._length, data) | |
| def isupper(self): | |
| """Return True if all ASCII characters in data are uppercase. | |
| If there are no cased characters, the method returns False. | |
| """ | |
| # Character case is irrelevant for an undefined sequence | |
| raise UndefinedSequenceError("Sequence content is only partially defined") | |
| def islower(self): | |
| """Return True if all ASCII characters in data are lowercase. | |
| If there are no cased characters, the method returns False. | |
| """ | |
| # Character case is irrelevant for an undefined sequence | |
| raise UndefinedSequenceError("Sequence content is only partially defined") | |
| def translate(self, table, delete=b""): | |
| """Return a copy with each character mapped by the given translation table. | |
| table | |
| Translation table, which must be a bytes object of length 256. | |
| All characters occurring in the optional argument delete are removed. | |
| The remaining characters are mapped through the given translation table. | |
| """ | |
| items = self._data.items() | |
| data = {start: seq.translate(table, delete) for start, seq in items} | |
| return _PartiallyDefinedSequenceData(self._length, data) | |
| def replace(self, old, new): | |
| """Return a copy with all occurrences of substring old replaced by new.""" | |
| # Replacing substring old by new in the undefined sequence segments | |
| # will result in an undefined sequence segment of the same length, if | |
| # old and new have the number of characters. If not, an error is raised, | |
| # as the correct start positions cannot be calculated reliably. | |
| if len(old) != len(new): | |
| raise UndefinedSequenceError( | |
| "Sequence content is only partially defined; substring \n" | |
| "replacement cannot be performed reliably" | |
| ) | |
| items = self._data.items() | |
| data = {start: seq.replace(old, new) for start, seq in items} | |
| return _PartiallyDefinedSequenceData(self._length, data) | |
| def defined(self): | |
| """Return False, as the sequence is not fully defined and has a non-zero length.""" | |
| return False | |
| def defined_ranges(self): | |
| """Return a tuple of the ranges where the sequence contents is defined. | |
| The return value has the format ((start1, end1), (start2, end2), ...). | |
| """ | |
| return tuple((start, start + len(seq)) for start, seq in self._data.items()) | |
| # The transcribe, backward_transcribe, and translate functions are | |
| # user-friendly versions of the corresponding Seq/MutableSeq methods. | |
| # The functions work both on Seq objects, and on strings. | |
| def transcribe(dna): | |
| """Transcribe a DNA sequence into RNA. | |
| If given a string, returns a new string object. | |
| Given a Seq or MutableSeq, returns a new Seq object. | |
| e.g. | |
| >>> transcribe("ACTGN") | |
| 'ACUGN' | |
| """ | |
| if isinstance(dna, Seq): | |
| return dna.transcribe() | |
| elif isinstance(dna, MutableSeq): | |
| return Seq(dna).transcribe() | |
| else: | |
| return dna.replace("T", "U").replace("t", "u") | |
| def back_transcribe(rna): | |
| """Return the RNA sequence back-transcribed into DNA. | |
| If given a string, returns a new string object. | |
| Given a Seq or MutableSeq, returns a new Seq object. | |
| e.g. | |
| >>> back_transcribe("ACUGN") | |
| 'ACTGN' | |
| """ | |
| if isinstance(rna, Seq): | |
| return rna.back_transcribe() | |
| elif isinstance(rna, MutableSeq): | |
| return Seq(rna).back_transcribe() | |
| else: | |
| return rna.replace("U", "T").replace("u", "t") | |
| def _translate_str( | |
| sequence, table, stop_symbol="*", to_stop=False, cds=False, pos_stop="X", gap=None | |
| ): | |
| """Translate nucleotide string into a protein string (PRIVATE). | |
| Arguments: | |
| - sequence - a string | |
| - table - Which codon table to use? This can be either a name (string), | |
| an NCBI identifier (integer), or a CodonTable object (useful for | |
| non-standard genetic codes). This defaults to the "Standard" table. | |
| - stop_symbol - a single character string, what to use for terminators. | |
| - to_stop - boolean, should translation terminate at the first | |
| in frame stop codon? If there is no in-frame stop codon | |
| then translation continues to the end. | |
| - pos_stop - a single character string for a possible stop codon | |
| (e.g. TAN or NNN) | |
| - cds - Boolean, indicates this is a complete CDS. If True, this | |
| checks the sequence starts with a valid alternative start | |
| codon (which will be translated as methionine, M), that the | |
| sequence length is a multiple of three, and that there is a | |
| single in frame stop codon at the end (this will be excluded | |
| from the protein sequence, regardless of the to_stop option). | |
| If these tests fail, an exception is raised. | |
| - gap - Single character string to denote symbol used for gaps. | |
| Defaults to None. | |
| Returns a string. | |
| e.g. | |
| >>> from Bio.Data import CodonTable | |
| >>> table = CodonTable.ambiguous_dna_by_id[1] | |
| >>> _translate_str("AAA", table) | |
| 'K' | |
| >>> _translate_str("TAR", table) | |
| '*' | |
| >>> _translate_str("TAN", table) | |
| 'X' | |
| >>> _translate_str("TAN", table, pos_stop="@") | |
| '@' | |
| >>> _translate_str("TA?", table) | |
| Traceback (most recent call last): | |
| ... | |
| Bio.Data.CodonTable.TranslationError: Codon 'TA?' is invalid | |
| In a change to older versions of Biopython, partial codons are now | |
| always regarded as an error (previously only checked if cds=True) | |
| and will trigger a warning (likely to become an exception in a | |
| future release). | |
| If **cds=True**, the start and stop codons are checked, and the start | |
| codon will be translated at methionine. The sequence must be an | |
| while number of codons. | |
| >>> _translate_str("ATGCCCTAG", table, cds=True) | |
| 'MP' | |
| >>> _translate_str("AAACCCTAG", table, cds=True) | |
| Traceback (most recent call last): | |
| ... | |
| Bio.Data.CodonTable.TranslationError: First codon 'AAA' is not a start codon | |
| >>> _translate_str("ATGCCCTAGCCCTAG", table, cds=True) | |
| Traceback (most recent call last): | |
| ... | |
| Bio.Data.CodonTable.TranslationError: Extra in frame stop codon 'TAG' found. | |
| """ | |
| try: | |
| table_id = int(table) | |
| except ValueError: | |
| # Assume it's a table name | |
| # The same table can be used for RNA or DNA | |
| try: | |
| codon_table = CodonTable.ambiguous_generic_by_name[table] | |
| except KeyError: | |
| if isinstance(table, str): | |
| raise ValueError( | |
| "The Bio.Seq translate methods and function DO NOT " | |
| "take a character string mapping table like the python " | |
| "string object's translate method. " | |
| "Use str(my_seq).translate(...) instead." | |
| ) from None | |
| else: | |
| raise TypeError("table argument must be integer or string") from None | |
| except (AttributeError, TypeError): | |
| # Assume it's a CodonTable object | |
| if isinstance(table, CodonTable.CodonTable): | |
| codon_table = table | |
| else: | |
| raise ValueError("Bad table argument") from None | |
| else: | |
| # Assume it's a table ID | |
| # The same table can be used for RNA or DNA | |
| codon_table = CodonTable.ambiguous_generic_by_id[table_id] | |
| sequence = sequence.upper() | |
| amino_acids = [] | |
| forward_table = codon_table.forward_table | |
| stop_codons = codon_table.stop_codons | |
| if codon_table.nucleotide_alphabet is not None: | |
| valid_letters = set(codon_table.nucleotide_alphabet.upper()) | |
| else: | |
| # Assume the worst case, ambiguous DNA or RNA: | |
| valid_letters = set( | |
| IUPACData.ambiguous_dna_letters.upper() | |
| + IUPACData.ambiguous_rna_letters.upper() | |
| ) | |
| n = len(sequence) | |
| # Check for tables with 'ambiguous' (dual-coding) stop codons: | |
| dual_coding = [c for c in stop_codons if c in forward_table] | |
| if dual_coding: | |
| c = dual_coding[0] | |
| if to_stop: | |
| raise ValueError( | |
| "You cannot use 'to_stop=True' with this table as it contains" | |
| f" {len(dual_coding)} codon(s) which can be both STOP and an" | |
| f" amino acid (e.g. '{c}' -> '{forward_table[c]}' or STOP)." | |
| ) | |
| warnings.warn( | |
| f"This table contains {len(dual_coding)} codon(s) which code(s) for" | |
| f" both STOP and an amino acid (e.g. '{c}' -> '{forward_table[c]}'" | |
| " or STOP). Such codons will be translated as amino acid.", | |
| BiopythonWarning, | |
| ) | |
| if cds: | |
| if str(sequence[:3]).upper() not in codon_table.start_codons: | |
| raise CodonTable.TranslationError( | |
| f"First codon '{sequence[:3]}' is not a start codon" | |
| ) | |
| if n % 3 != 0: | |
| raise CodonTable.TranslationError( | |
| f"Sequence length {n} is not a multiple of three" | |
| ) | |
| if str(sequence[-3:]).upper() not in stop_codons: | |
| raise CodonTable.TranslationError( | |
| f"Final codon '{sequence[-3:]}' is not a stop codon" | |
| ) | |
| # Don't translate the stop symbol, and manually translate the M | |
| sequence = sequence[3:-3] | |
| n -= 6 | |
| amino_acids = ["M"] | |
| elif n % 3 != 0: | |
| warnings.warn( | |
| "Partial codon, len(sequence) not a multiple of three. " | |
| "Explicitly trim the sequence or add trailing N before " | |
| "translation. This may become an error in future.", | |
| BiopythonWarning, | |
| ) | |
| if gap is not None: | |
| if not isinstance(gap, str): | |
| raise TypeError("Gap character should be a single character string.") | |
| elif len(gap) > 1: | |
| raise ValueError("Gap character should be a single character string.") | |
| for i in range(0, n - n % 3, 3): | |
| codon = sequence[i : i + 3] | |
| try: | |
| amino_acids.append(forward_table[codon]) | |
| except (KeyError, CodonTable.TranslationError): | |
| if codon in codon_table.stop_codons: | |
| if cds: | |
| raise CodonTable.TranslationError( | |
| f"Extra in frame stop codon '{codon}' found." | |
| ) from None | |
| if to_stop: | |
| break | |
| amino_acids.append(stop_symbol) | |
| elif valid_letters.issuperset(set(codon)): | |
| # Possible stop codon (e.g. NNN or TAN) | |
| amino_acids.append(pos_stop) | |
| elif gap is not None and codon == gap * 3: | |
| # Gapped translation | |
| amino_acids.append(gap) | |
| else: | |
| raise CodonTable.TranslationError( | |
| f"Codon '{codon}' is invalid" | |
| ) from None | |
| return "".join(amino_acids) | |
| def translate( | |
| sequence, table="Standard", stop_symbol="*", to_stop=False, cds=False, gap=None | |
| ): | |
| """Translate a nucleotide sequence into amino acids. | |
| If given a string, returns a new string object. Given a Seq or | |
| MutableSeq, returns a Seq object. | |
| Arguments: | |
| - table - Which codon table to use? This can be either a name | |
| (string), an NCBI identifier (integer), or a CodonTable object | |
| (useful for non-standard genetic codes). Defaults to the "Standard" | |
| table. | |
| - stop_symbol - Single character string, what to use for any | |
| terminators, defaults to the asterisk, "*". | |
| - to_stop - Boolean, defaults to False meaning do a full | |
| translation continuing on past any stop codons | |
| (translated as the specified stop_symbol). If | |
| True, translation is terminated at the first in | |
| frame stop codon (and the stop_symbol is not | |
| appended to the returned protein sequence). | |
| - cds - Boolean, indicates this is a complete CDS. If True, this | |
| checks the sequence starts with a valid alternative start | |
| codon (which will be translated as methionine, M), that the | |
| sequence length is a multiple of three, and that there is a | |
| single in frame stop codon at the end (this will be excluded | |
| from the protein sequence, regardless of the to_stop option). | |
| If these tests fail, an exception is raised. | |
| - gap - Single character string to denote symbol used for gaps. | |
| Defaults to None. | |
| A simple string example using the default (standard) genetic code: | |
| >>> coding_dna = "GTGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG" | |
| >>> translate(coding_dna) | |
| 'VAIVMGR*KGAR*' | |
| >>> translate(coding_dna, stop_symbol="@") | |
| 'VAIVMGR@KGAR@' | |
| >>> translate(coding_dna, to_stop=True) | |
| 'VAIVMGR' | |
| Now using NCBI table 2, where TGA is not a stop codon: | |
| >>> translate(coding_dna, table=2) | |
| 'VAIVMGRWKGAR*' | |
| >>> translate(coding_dna, table=2, to_stop=True) | |
| 'VAIVMGRWKGAR' | |
| In fact this example uses an alternative start codon valid under NCBI | |
| table 2, GTG, which means this example is a complete valid CDS which | |
| when translated should really start with methionine (not valine): | |
| >>> translate(coding_dna, table=2, cds=True) | |
| 'MAIVMGRWKGAR' | |
| Note that if the sequence has no in-frame stop codon, then the to_stop | |
| argument has no effect: | |
| >>> coding_dna2 = "GTGGCCATTGTAATGGGCCGC" | |
| >>> translate(coding_dna2) | |
| 'VAIVMGR' | |
| >>> translate(coding_dna2, to_stop=True) | |
| 'VAIVMGR' | |
| NOTE - Ambiguous codons like "TAN" or "NNN" could be an amino acid | |
| or a stop codon. These are translated as "X". Any invalid codon | |
| (e.g. "TA?" or "T-A") will throw a TranslationError. | |
| It will however translate either DNA or RNA. | |
| NOTE - Since version 1.71 Biopython contains codon tables with 'ambiguous | |
| stop codons'. These are stop codons with unambiguous sequence but which | |
| have a context dependent coding as STOP or as amino acid. With these tables | |
| 'to_stop' must be False (otherwise a ValueError is raised). The dual | |
| coding codons will always be translated as amino acid, except for | |
| 'cds=True', where the last codon will be translated as STOP. | |
| >>> coding_dna3 = "ATGGCACGGAAGTGA" | |
| >>> translate(coding_dna3) | |
| 'MARK*' | |
| >>> translate(coding_dna3, table=27) # Table 27: TGA -> STOP or W | |
| 'MARKW' | |
| It will however raise a BiopythonWarning (not shown). | |
| >>> translate(coding_dna3, table=27, cds=True) | |
| 'MARK' | |
| >>> translate(coding_dna3, table=27, to_stop=True) | |
| Traceback (most recent call last): | |
| ... | |
| ValueError: You cannot use 'to_stop=True' with this table ... | |
| """ | |
| if isinstance(sequence, Seq): | |
| return sequence.translate(table, stop_symbol, to_stop, cds) | |
| elif isinstance(sequence, MutableSeq): | |
| # Return a Seq object | |
| return Seq(sequence).translate(table, stop_symbol, to_stop, cds) | |
| else: | |
| # Assume it's a string, return a string | |
| return _translate_str(sequence, table, stop_symbol, to_stop, cds, gap=gap) | |
| def reverse_complement(sequence, inplace=None): | |
| """Return the reverse complement as a DNA sequence. | |
| If given a string, returns a new string object. | |
| Given a Seq object, returns a new Seq object. | |
| Given a MutableSeq, returns a new MutableSeq object. | |
| Given a SeqRecord object, returns a new SeqRecord object. | |
| >>> my_seq = "CGA" | |
| >>> reverse_complement(my_seq, inplace=False) | |
| 'TCG' | |
| >>> my_seq = Seq("CGA") | |
| >>> reverse_complement(my_seq, inplace=False) | |
| Seq('TCG') | |
| >>> my_seq = MutableSeq("CGA") | |
| >>> reverse_complement(my_seq, inplace=False) | |
| MutableSeq('TCG') | |
| >>> my_seq | |
| MutableSeq('CGA') | |
| Any U in the sequence is treated as a T: | |
| >>> reverse_complement(Seq("CGAUT"), inplace=False) | |
| Seq('AATCG') | |
| In contrast, ``reverse_complement_rna`` returns an RNA sequence: | |
| >>> reverse_complement_rna(Seq("CGAUT")) | |
| Seq('AAUCG') | |
| Supports and lower- and upper-case characters, and unambiguous and | |
| ambiguous nucleotides. All other characters are not converted: | |
| >>> reverse_complement("ACGTUacgtuXYZxyz", inplace=False) | |
| 'zrxZRXaacgtAACGT' | |
| The sequence is modified in-place and returned if inplace is True: | |
| >>> my_seq = MutableSeq("CGA") | |
| >>> reverse_complement(my_seq, inplace=True) | |
| MutableSeq('TCG') | |
| >>> my_seq | |
| MutableSeq('TCG') | |
| As strings and ``Seq`` objects are immutable, a ``TypeError`` is | |
| raised if ``reverse_complement`` is called on a ``Seq`` object with | |
| ``inplace=True``. | |
| """ | |
| from Bio.SeqRecord import SeqRecord # Lazy to avoid circular imports | |
| if inplace is None: | |
| # deprecated | |
| if isinstance(sequence, Seq): | |
| if b"U" in sequence._data or b"u" in sequence._data: | |
| warnings.warn( | |
| "reverse_complement(sequence) will change in the " | |
| "near future to always return DNA nucleotides only. " | |
| "Please use\n" | |
| "\n" | |
| "reverse_complement_rna(sequence)\n" | |
| "\n" | |
| "if you want to receive an RNA sequence instead.", | |
| BiopythonDeprecationWarning, | |
| ) | |
| if b"T" in sequence._data or b"t" in sequence._data: | |
| raise ValueError("Mixed RNA/DNA found") | |
| return sequence.reverse_complement_rna() | |
| elif isinstance(sequence, MutableSeq): | |
| # Return a Seq | |
| # Don't use the MutableSeq reverse_complement method as it is | |
| # 'in place'. | |
| warnings.warn( | |
| "reverse_complement(mutable_seq) will change in the near " | |
| "future to return a MutableSeq object instead of a Seq object.", | |
| BiopythonDeprecationWarning, | |
| ) | |
| return Seq(sequence).reverse_complement() | |
| else: # str | |
| if "U" in sequence or "u" in sequence: | |
| warnings.warn( | |
| "reverse_complement(sequence) will change in the " | |
| "near future to always return DNA nucleotides only. " | |
| "Please use\n" | |
| "\n" | |
| "reverse_complement_rna(sequence)\n" | |
| "\n" | |
| "if you want to receive an RNA sequence instead.", | |
| BiopythonDeprecationWarning, | |
| ) | |
| if "T" in sequence or "t" in sequence: | |
| raise ValueError("Mixed RNA/DNA found") | |
| sequence = sequence.encode("ASCII") | |
| sequence = sequence.translate(_rna_complement_table) | |
| return sequence.decode("ASCII")[::-1] | |
| if isinstance(sequence, (Seq, MutableSeq)): | |
| return sequence.reverse_complement(inplace) | |
| if isinstance(sequence, SeqRecord): | |
| if inplace: | |
| raise TypeError("SeqRecords are immutable") | |
| return sequence.reverse_complement() | |
| # Assume it's a string. | |
| if inplace: | |
| raise TypeError("strings are immutable") | |
| sequence = sequence.encode("ASCII") | |
| sequence = sequence.translate(_dna_complement_table) | |
| sequence = sequence.decode("ASCII") | |
| return sequence[::-1] | |
| def reverse_complement_rna(sequence, inplace=False): | |
| """Return the reverse complement as an RNA sequence. | |
| If given a string, returns a new string object. | |
| Given a Seq object, returns a new Seq object. | |
| Given a MutableSeq, returns a new MutableSeq object. | |
| Given a SeqRecord object, returns a new SeqRecord object. | |
| >>> my_seq = "CGA" | |
| >>> reverse_complement_rna(my_seq) | |
| 'UCG' | |
| >>> my_seq = Seq("CGA") | |
| >>> reverse_complement_rna(my_seq) | |
| Seq('UCG') | |
| >>> my_seq = MutableSeq("CGA") | |
| >>> reverse_complement_rna(my_seq) | |
| MutableSeq('UCG') | |
| >>> my_seq | |
| MutableSeq('CGA') | |
| Any T in the sequence is treated as a U: | |
| >>> reverse_complement_rna(Seq("CGAUT")) | |
| Seq('AAUCG') | |
| In contrast, ``reverse_complement`` returns a DNA sequence: | |
| >>> reverse_complement(Seq("CGAUT"), inplace=False) | |
| Seq('AATCG') | |
| Supports and lower- and upper-case characters, and unambiguous and | |
| ambiguous nucleotides. All other characters are not converted: | |
| >>> reverse_complement_rna("ACGTUacgtuXYZxyz") | |
| 'zrxZRXaacguAACGU' | |
| The sequence is modified in-place and returned if inplace is True: | |
| >>> my_seq = MutableSeq("CGA") | |
| >>> reverse_complement_rna(my_seq, inplace=True) | |
| MutableSeq('UCG') | |
| >>> my_seq | |
| MutableSeq('UCG') | |
| As strings and ``Seq`` objects are immutable, a ``TypeError`` is | |
| raised if ``reverse_complement`` is called on a ``Seq`` object with | |
| ``inplace=True``. | |
| """ | |
| from Bio.SeqRecord import SeqRecord # Lazy to avoid circular imports | |
| if isinstance(sequence, (Seq, MutableSeq)): | |
| return sequence.reverse_complement_rna(inplace) | |
| if isinstance(sequence, SeqRecord): | |
| if inplace: | |
| raise TypeError("SeqRecords are immutable") | |
| return sequence.reverse_complement_rna() | |
| # Assume it's a string. | |
| if inplace: | |
| raise TypeError("strings are immutable") | |
| sequence = sequence.encode("ASCII") | |
| sequence = sequence.translate(_rna_complement_table) | |
| sequence = sequence.decode("ASCII") | |
| return sequence[::-1] | |
| def complement(sequence, inplace=None): | |
| """Return the complement as a DNA sequence. | |
| If given a string, returns a new string object. | |
| Given a Seq object, returns a new Seq object. | |
| Given a MutableSeq, returns a new MutableSeq object. | |
| Given a SeqRecord object, returns a new SeqRecord object. | |
| >>> my_seq = "CGA" | |
| >>> complement(my_seq, inplace=False) | |
| 'GCT' | |
| >>> my_seq = Seq("CGA") | |
| >>> complement(my_seq, inplace=False) | |
| Seq('GCT') | |
| >>> my_seq = MutableSeq("CGA") | |
| >>> complement(my_seq, inplace=False) | |
| MutableSeq('GCT') | |
| >>> my_seq | |
| MutableSeq('CGA') | |
| Any U in the sequence is treated as a T: | |
| >>> complement(Seq("CGAUT"), inplace=False) | |
| Seq('GCTAA') | |
| In contrast, ``complement_rna`` returns an RNA sequence: | |
| >>> complement_rna(Seq("CGAUT")) | |
| Seq('GCUAA') | |
| Supports and lower- and upper-case characters, and unambiguous and | |
| ambiguous nucleotides. All other characters are not converted: | |
| >>> complement("ACGTUacgtuXYZxyz", inplace=False) | |
| 'TGCAAtgcaaXRZxrz' | |
| The sequence is modified in-place and returned if inplace is True: | |
| >>> my_seq = MutableSeq("CGA") | |
| >>> complement(my_seq, inplace=True) | |
| MutableSeq('GCT') | |
| >>> my_seq | |
| MutableSeq('GCT') | |
| As strings and ``Seq`` objects are immutable, a ``TypeError`` is | |
| raised if ``reverse_complement`` is called on a ``Seq`` object with | |
| ``inplace=True``. | |
| """ | |
| from Bio.SeqRecord import SeqRecord # Lazy to avoid circular imports | |
| if inplace is None: | |
| # deprecated | |
| if isinstance(sequence, Seq): | |
| # Return a Seq | |
| if b"U" in sequence._data or b"u" in sequence._data: | |
| warnings.warn( | |
| "complement(sequence) will change in the near " | |
| "future to always return DNA nucleotides only. " | |
| "Please use\n" | |
| "\n" | |
| "complement_rna(sequence)\n" | |
| "\n" | |
| "if you want to receive an RNA sequence instead.", | |
| BiopythonDeprecationWarning, | |
| ) | |
| if b"T" in sequence._data or b"t" in sequence._data: | |
| raise ValueError("Mixed RNA/DNA found") | |
| return sequence.complement_rna() | |
| elif isinstance(sequence, MutableSeq): | |
| # Return a Seq | |
| # Don't use the MutableSeq reverse_complement method as it is | |
| # 'in place'. | |
| warnings.warn( | |
| "complement(mutable_seq) will change in the near future" | |
| "to return a MutableSeq object instead of a Seq object.", | |
| BiopythonDeprecationWarning, | |
| ) | |
| return Seq(sequence).complement() | |
| else: | |
| if "U" in sequence or "u" in sequence: | |
| warnings.warn( | |
| "complement(sequence) will change in the near " | |
| "future to always return DNA nucleotides only. " | |
| "Please use\n" | |
| "\n" | |
| "complement_rna(sequence)\n" | |
| "\n" | |
| "if you want to receive an RNA sequence instead.", | |
| BiopythonDeprecationWarning, | |
| ) | |
| if "T" in sequence or "t" in sequence: | |
| raise ValueError("Mixed RNA/DNA found") | |
| ttable = _rna_complement_table | |
| sequence = sequence.encode("ASCII") | |
| sequence = sequence.translate(ttable) | |
| return sequence.decode("ASCII") | |
| if isinstance(sequence, (Seq, MutableSeq)): | |
| return sequence.complement(inplace) | |
| if isinstance(sequence, SeqRecord): | |
| if inplace: | |
| raise TypeError("SeqRecords are immutable") | |
| return sequence.complement() | |
| # Assume it's a string. | |
| if inplace: | |
| raise TypeError("strings are immutable") | |
| sequence = sequence.encode("ASCII") | |
| sequence = sequence.translate(_dna_complement_table) | |
| return sequence.decode("ASCII") | |
| def complement_rna(sequence, inplace=False): | |
| """Return the complement as an RNA sequence. | |
| If given a string, returns a new string object. | |
| Given a Seq object, returns a new Seq object. | |
| Given a MutableSeq, returns a new MutableSeq object. | |
| Given a SeqRecord object, returns a new SeqRecord object. | |
| >>> my_seq = "CGA" | |
| >>> complement_rna(my_seq) | |
| 'GCU' | |
| >>> my_seq = Seq("CGA") | |
| >>> complement_rna(my_seq) | |
| Seq('GCU') | |
| >>> my_seq = MutableSeq("CGA") | |
| >>> complement_rna(my_seq) | |
| MutableSeq('GCU') | |
| >>> my_seq | |
| MutableSeq('CGA') | |
| Any T in the sequence is treated as a U: | |
| >>> complement_rna(Seq("CGAUT")) | |
| Seq('GCUAA') | |
| In contrast, ``complement`` returns a DNA sequence: | |
| >>> complement(Seq("CGAUT"),inplace=False) | |
| Seq('GCTAA') | |
| Supports and lower- and upper-case characters, and unambiguous and | |
| ambiguous nucleotides. All other characters are not converted: | |
| >>> complement_rna("ACGTUacgtuXYZxyz") | |
| 'UGCAAugcaaXRZxrz' | |
| The sequence is modified in-place and returned if inplace is True: | |
| >>> my_seq = MutableSeq("CGA") | |
| >>> complement(my_seq, inplace=True) | |
| MutableSeq('GCT') | |
| >>> my_seq | |
| MutableSeq('GCT') | |
| As strings and ``Seq`` objects are immutable, a ``TypeError`` is | |
| raised if ``reverse_complement`` is called on a ``Seq`` object with | |
| ``inplace=True``. | |
| """ | |
| from Bio.SeqRecord import SeqRecord # Lazy to avoid circular imports | |
| if isinstance(sequence, (Seq, MutableSeq)): | |
| return sequence.complement_rna(inplace) | |
| if isinstance(sequence, SeqRecord): | |
| if inplace: | |
| raise TypeError("SeqRecords are immutable") | |
| return sequence.complement_rna() | |
| # Assume it's a string. | |
| if inplace: | |
| raise TypeError("strings are immutable") | |
| sequence = sequence.encode("ASCII") | |
| sequence = sequence.translate(_rna_complement_table) | |
| return sequence.decode("ASCII") | |
| def _test(): | |
| """Run the Bio.Seq module's doctests (PRIVATE).""" | |
| print("Running doctests...") | |
| import doctest | |
| doctest.testmod(optionflags=doctest.IGNORE_EXCEPTION_DETAIL) | |
| print("Done") | |
| if __name__ == "__main__": | |
| _test() | |