Spaces:
Running
Running
Add 2 files
Browse files- README.md +6 -4
- index.html +1278 -19
README.md
CHANGED
|
@@ -1,10 +1,12 @@
|
|
| 1 |
---
|
| 2 |
-
title:
|
| 3 |
-
emoji:
|
| 4 |
-
colorFrom:
|
| 5 |
colorTo: blue
|
| 6 |
sdk: static
|
| 7 |
pinned: false
|
|
|
|
|
|
|
| 8 |
---
|
| 9 |
|
| 10 |
-
Check out the configuration reference at https://huggingface.co/docs/hub/spaces-config-reference
|
|
|
|
| 1 |
---
|
| 2 |
+
title: plmtools
|
| 3 |
+
emoji: 🐳
|
| 4 |
+
colorFrom: blue
|
| 5 |
colorTo: blue
|
| 6 |
sdk: static
|
| 7 |
pinned: false
|
| 8 |
+
tags:
|
| 9 |
+
- deepsite
|
| 10 |
---
|
| 11 |
|
| 12 |
+
Check out the configuration reference at https://huggingface.co/docs/hub/spaces-config-reference
|
index.html
CHANGED
|
@@ -1,19 +1,1278 @@
|
|
| 1 |
-
<!
|
| 2 |
-
<html>
|
| 3 |
-
|
| 4 |
-
|
| 5 |
-
|
| 6 |
-
|
| 7 |
-
|
| 8 |
-
|
| 9 |
-
|
| 10 |
-
|
| 11 |
-
|
| 12 |
-
|
| 13 |
-
|
| 14 |
-
|
| 15 |
-
|
| 16 |
-
|
| 17 |
-
|
| 18 |
-
|
| 19 |
-
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
| 1 |
+
<!DOCTYPE html>
|
| 2 |
+
<html lang="en">
|
| 3 |
+
<head>
|
| 4 |
+
<meta charset="UTF-8">
|
| 5 |
+
<meta name="viewport" content="width=device-width, initial-scale=1.0">
|
| 6 |
+
<title>Protein Sequence Analysis Toolkit</title>
|
| 7 |
+
<script src="https://cdn.tailwindcss.com"></script>
|
| 8 |
+
<link rel="stylesheet" href="https://cdnjs.cloudflare.com/ajax/libs/font-awesome/6.4.0/css/all.min.css">
|
| 9 |
+
<style>
|
| 10 |
+
@import url('https://fonts.googleapis.com/css2?family=Roboto+Mono:wght@400;500;700&family=Roboto:wght@300;400;500;700&display=swap');
|
| 11 |
+
|
| 12 |
+
:root {
|
| 13 |
+
--primary: #3b82f6;
|
| 14 |
+
--primary-dark: #2563eb;
|
| 15 |
+
--secondary: #10b981;
|
| 16 |
+
--dark: #1e293b;
|
| 17 |
+
--light: #f8fafc;
|
| 18 |
+
}
|
| 19 |
+
|
| 20 |
+
body {
|
| 21 |
+
font-family: 'Roboto', sans-serif;
|
| 22 |
+
background-color: #f1f5f9;
|
| 23 |
+
color: var(--dark);
|
| 24 |
+
}
|
| 25 |
+
|
| 26 |
+
.mono {
|
| 27 |
+
font-family: 'Roboto Mono', monospace;
|
| 28 |
+
}
|
| 29 |
+
|
| 30 |
+
.sequence-display {
|
| 31 |
+
background-color: #e2e8f0;
|
| 32 |
+
border-radius: 0.5rem;
|
| 33 |
+
padding: 1rem;
|
| 34 |
+
overflow-x: auto;
|
| 35 |
+
white-space: nowrap;
|
| 36 |
+
}
|
| 37 |
+
|
| 38 |
+
.amino-acid {
|
| 39 |
+
display: inline-block;
|
| 40 |
+
width: 1.5rem;
|
| 41 |
+
text-align: center;
|
| 42 |
+
font-weight: 500;
|
| 43 |
+
position: relative;
|
| 44 |
+
}
|
| 45 |
+
|
| 46 |
+
.hydrophobic { color: #1e40af; background-color: #bfdbfe; }
|
| 47 |
+
.hydrophilic { color: #166534; background-color: #bbf7d0; }
|
| 48 |
+
.neutral { color: #713f12; background-color: #fed7aa; }
|
| 49 |
+
.acidic { color: #9d174d; background-color: #f9a8d4; }
|
| 50 |
+
.basic { color: #6d28d9; background-color: #ddd6fe; }
|
| 51 |
+
.cysteine { color: #854d0e; background-color: #fef08a; }
|
| 52 |
+
.proline { color: #0e7490; background-color: #a5f3fc; }
|
| 53 |
+
|
| 54 |
+
.helix { background-color: rgba(239, 68, 68, 0.2); }
|
| 55 |
+
.sheet { background-color: rgba(16, 185, 129, 0.2); }
|
| 56 |
+
.coil { background-color: rgba(156, 163, 175, 0.2); }
|
| 57 |
+
|
| 58 |
+
.tooltip {
|
| 59 |
+
position: relative;
|
| 60 |
+
display: inline-block;
|
| 61 |
+
}
|
| 62 |
+
|
| 63 |
+
.tooltip .tooltiptext {
|
| 64 |
+
visibility: hidden;
|
| 65 |
+
width: 120px;
|
| 66 |
+
background-color: #555;
|
| 67 |
+
color: #fff;
|
| 68 |
+
text-align: center;
|
| 69 |
+
border-radius: 6px;
|
| 70 |
+
padding: 5px;
|
| 71 |
+
position: absolute;
|
| 72 |
+
z-index: 1;
|
| 73 |
+
bottom: 125%;
|
| 74 |
+
left: 50%;
|
| 75 |
+
margin-left: -60px;
|
| 76 |
+
opacity: 0;
|
| 77 |
+
transition: opacity 0.3s;
|
| 78 |
+
font-size: 0.8rem;
|
| 79 |
+
}
|
| 80 |
+
|
| 81 |
+
.tooltip:hover .tooltiptext {
|
| 82 |
+
visibility: visible;
|
| 83 |
+
opacity: 1;
|
| 84 |
+
}
|
| 85 |
+
|
| 86 |
+
.tab-content {
|
| 87 |
+
display: none;
|
| 88 |
+
}
|
| 89 |
+
|
| 90 |
+
.tab-content.active {
|
| 91 |
+
display: block;
|
| 92 |
+
animation: fadeIn 0.3s ease-in-out;
|
| 93 |
+
}
|
| 94 |
+
|
| 95 |
+
@keyframes fadeIn {
|
| 96 |
+
from { opacity: 0; transform: translateY(10px); }
|
| 97 |
+
to { opacity: 1; transform: translateY(0); }
|
| 98 |
+
}
|
| 99 |
+
|
| 100 |
+
.feature-badge {
|
| 101 |
+
display: inline-flex;
|
| 102 |
+
align-items: center;
|
| 103 |
+
padding: 0.25rem 0.5rem;
|
| 104 |
+
border-radius: 9999px;
|
| 105 |
+
font-size: 0.75rem;
|
| 106 |
+
font-weight: 500;
|
| 107 |
+
margin-right: 0.5rem;
|
| 108 |
+
margin-bottom: 0.5rem;
|
| 109 |
+
}
|
| 110 |
+
|
| 111 |
+
.feature-badge i {
|
| 112 |
+
margin-right: 0.25rem;
|
| 113 |
+
}
|
| 114 |
+
|
| 115 |
+
.chart-container {
|
| 116 |
+
position: relative;
|
| 117 |
+
height: 300px;
|
| 118 |
+
width: 100%;
|
| 119 |
+
}
|
| 120 |
+
|
| 121 |
+
.loading-spinner {
|
| 122 |
+
border: 4px solid rgba(0, 0, 0, 0.1);
|
| 123 |
+
border-radius: 50%;
|
| 124 |
+
border-top: 4px solid var(--primary);
|
| 125 |
+
width: 40px;
|
| 126 |
+
height: 40px;
|
| 127 |
+
animation: spin 1s linear infinite;
|
| 128 |
+
margin: 2rem auto;
|
| 129 |
+
}
|
| 130 |
+
|
| 131 |
+
@keyframes spin {
|
| 132 |
+
0% { transform: rotate(0deg); }
|
| 133 |
+
100% { transform: rotate(360deg); }
|
| 134 |
+
}
|
| 135 |
+
|
| 136 |
+
.result-card {
|
| 137 |
+
transition: all 0.3s ease;
|
| 138 |
+
}
|
| 139 |
+
|
| 140 |
+
.result-card:hover {
|
| 141 |
+
transform: translateY(-5px);
|
| 142 |
+
box-shadow: 0 10px 15px -3px rgba(0, 0, 0, 0.1), 0 4px 6px -2px rgba(0, 0, 0, 0.05);
|
| 143 |
+
}
|
| 144 |
+
|
| 145 |
+
.sequence-input {
|
| 146 |
+
min-height: 100px;
|
| 147 |
+
font-family: 'Roboto Mono', monospace;
|
| 148 |
+
}
|
| 149 |
+
|
| 150 |
+
.analysis-section {
|
| 151 |
+
scroll-margin-top: 100px;
|
| 152 |
+
}
|
| 153 |
+
</style>
|
| 154 |
+
</head>
|
| 155 |
+
<body class="min-h-screen">
|
| 156 |
+
<div class="container mx-auto px-4 py-8 max-w-7xl">
|
| 157 |
+
<!-- Header -->
|
| 158 |
+
<header class="mb-8 text-center">
|
| 159 |
+
<h1 class="text-4xl font-bold text-blue-600 mb-2">Protein Sequence Analysis Toolkit</h1>
|
| 160 |
+
<p class="text-lg text-gray-600">Comprehensive analysis of protein and peptide sequences using advanced protein language models</p>
|
| 161 |
+
</header>
|
| 162 |
+
|
| 163 |
+
<!-- Main Content -->
|
| 164 |
+
<div class="bg-white rounded-xl shadow-lg overflow-hidden">
|
| 165 |
+
<!-- Input Section -->
|
| 166 |
+
<div class="p-6 border-b border-gray-200">
|
| 167 |
+
<div class="flex flex-col md:flex-row gap-6">
|
| 168 |
+
<div class="flex-1">
|
| 169 |
+
<label for="sequence-input" class="block text-sm font-medium text-gray-700 mb-2">Enter Protein/Peptide Sequence</label>
|
| 170 |
+
<textarea id="sequence-input" class="w-full px-4 py-3 border border-gray-300 rounded-lg sequence-input focus:ring-2 focus:ring-blue-500 focus:border-blue-500" placeholder="Enter amino acid sequence (e.g., MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTSGLLYGSQTPSEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV)"></textarea>
|
| 171 |
+
<div class="flex flex-wrap gap-2 mt-3">
|
| 172 |
+
<button id="clear-btn" class="px-3 py-1 bg-gray-200 text-gray-700 rounded-md text-sm hover:bg-gray-300">Clear</button>
|
| 173 |
+
<button id="example-btn" class="px-3 py-1 bg-blue-100 text-blue-700 rounded-md text-sm hover:bg-blue-200">Load Example</button>
|
| 174 |
+
<button id="analyze-btn" class="px-3 py-1 bg-blue-600 text-white rounded-md text-sm hover:bg-blue-700">Analyze Sequence</button>
|
| 175 |
+
</div>
|
| 176 |
+
</div>
|
| 177 |
+
<div class="flex-1">
|
| 178 |
+
<label class="block text-sm font-medium text-gray-700 mb-2">Sequence Features</label>
|
| 179 |
+
<div class="bg-gray-50 p-4 rounded-lg h-full">
|
| 180 |
+
<div id="sequence-stats" class="grid grid-cols-2 gap-2">
|
| 181 |
+
<div class="text-sm">
|
| 182 |
+
<span class="text-gray-500">Length:</span>
|
| 183 |
+
<span id="seq-length" class="font-medium">0</span>
|
| 184 |
+
</div>
|
| 185 |
+
<div class="text-sm">
|
| 186 |
+
<span class="text-gray-500">Molecular Weight:</span>
|
| 187 |
+
<span id="mol-weight" class="font-medium">0 Da</span>
|
| 188 |
+
</div>
|
| 189 |
+
<div class="text-sm">
|
| 190 |
+
<span class="text-gray-500">Isoelectric Point:</span>
|
| 191 |
+
<span id="isoelectric-pt" class="font-medium">-</span>
|
| 192 |
+
</div>
|
| 193 |
+
<div class="text-sm">
|
| 194 |
+
<span class="text-gray-500">Extinction Coefficient:</span>
|
| 195 |
+
<span id="ext-coeff" class="font-medium">-</span>
|
| 196 |
+
</div>
|
| 197 |
+
<div class="text-sm col-span-2">
|
| 198 |
+
<span class="text-gray-500">Amino Acid Composition:</span>
|
| 199 |
+
<div id="aa-composition" class="flex flex-wrap gap-1 mt-1"></div>
|
| 200 |
+
</div>
|
| 201 |
+
</div>
|
| 202 |
+
</div>
|
| 203 |
+
</div>
|
| 204 |
+
</div>
|
| 205 |
+
</div>
|
| 206 |
+
|
| 207 |
+
<!-- Results Section -->
|
| 208 |
+
<div id="results-section" class="hidden">
|
| 209 |
+
<!-- Tabs Navigation -->
|
| 210 |
+
<div class="border-b border-gray-200">
|
| 211 |
+
<nav class="flex overflow-x-auto">
|
| 212 |
+
<button class="tab-btn px-4 py-3 text-sm font-medium border-b-2 border-transparent hover:text-blue-600 hover:border-blue-300" data-tab="sequence">Sequence</button>
|
| 213 |
+
<button class="tab-btn px-4 py-3 text-sm font-medium border-b-2 border-transparent hover:text-blue-600 hover:border-blue-300" data-tab="physicochemical">Physicochemical</button>
|
| 214 |
+
<button class="tab-btn px-4 py-3 text-sm font-medium border-b-2 border-transparent hover:text-blue-600 hover:border-blue-300" data-tab="structure">Structure</button>
|
| 215 |
+
<button class="tab-btn px-4 py-3 text-sm font-medium border-b-2 border-transparent hover:text-blue-600 hover:border-blue-300" data-tab="functional">Functional</button>
|
| 216 |
+
<button class="tab-btn px-4 py-3 text-sm font-medium border-b-2 border-transparent hover:text-blue-600 hover:border-blue-300" data-tab="optimization">Optimization</button>
|
| 217 |
+
</nav>
|
| 218 |
+
</div>
|
| 219 |
+
|
| 220 |
+
<!-- Tab Contents -->
|
| 221 |
+
<div class="p-6">
|
| 222 |
+
<!-- Sequence Tab -->
|
| 223 |
+
<div id="sequence-tab" class="tab-content active">
|
| 224 |
+
<div class="mb-6">
|
| 225 |
+
<h3 class="text-lg font-semibold mb-3">Sequence Visualization</h3>
|
| 226 |
+
<div id="sequence-display" class="sequence-display mono"></div>
|
| 227 |
+
</div>
|
| 228 |
+
|
| 229 |
+
<div class="grid grid-cols-1 md:grid-cols-2 gap-6">
|
| 230 |
+
<div>
|
| 231 |
+
<h3 class="text-lg font-semibold mb-3">Amino Acid Properties</h3>
|
| 232 |
+
<div id="property-legend" class="bg-gray-50 p-4 rounded-lg">
|
| 233 |
+
<div class="flex flex-wrap gap-2 mb-2">
|
| 234 |
+
<span class="feature-badge hydrophobic"><i class="fas fa-water"></i> Hydrophobic</span>
|
| 235 |
+
<span class="feature-badge hydrophilic"><i class="fas fa-tint"></i> Hydrophilic</span>
|
| 236 |
+
<span class="feature-badge acidic"><i class="fas fa-minus-circle"></i> Acidic</span>
|
| 237 |
+
<span class="feature-badge basic"><i class="fas fa-plus-circle"></i> Basic</span>
|
| 238 |
+
<span class="feature-badge neutral"><i class="fas fa-circle"></i> Neutral</span>
|
| 239 |
+
<span class="feature-badge cysteine"><i class="fas fa-link"></i> Cysteine</span>
|
| 240 |
+
<span class="feature-badge proline"><i class="fas fa-undo"></i> Proline</span>
|
| 241 |
+
</div>
|
| 242 |
+
</div>
|
| 243 |
+
</div>
|
| 244 |
+
|
| 245 |
+
<div>
|
| 246 |
+
<h3 class="text-lg font-semibold mb-3">Secondary Structure</h3>
|
| 247 |
+
<div id="structure-legend" class="bg-gray-50 p-4 rounded-lg">
|
| 248 |
+
<div class="flex flex-wrap gap-2 mb-2">
|
| 249 |
+
<span class="feature-badge helix"><i class="fas fa-helix"></i> Helix</span>
|
| 250 |
+
<span class="feature-badge sheet"><i class="fas fa-layer-group"></i> Sheet</span>
|
| 251 |
+
<span class="feature-badge coil"><i class="fas fa-wave-square"></i> Coil</span>
|
| 252 |
+
</div>
|
| 253 |
+
</div>
|
| 254 |
+
</div>
|
| 255 |
+
</div>
|
| 256 |
+
</div>
|
| 257 |
+
|
| 258 |
+
<!-- Physicochemical Tab -->
|
| 259 |
+
<div id="physicochemical-tab" class="tab-content">
|
| 260 |
+
<div class="grid grid-cols-1 md:grid-cols-2 gap-6">
|
| 261 |
+
<div class="analysis-section">
|
| 262 |
+
<h3 class="text-lg font-semibold mb-3">Isoelectric Point</h3>
|
| 263 |
+
<div class="bg-gray-50 p-4 rounded-lg">
|
| 264 |
+
<div class="flex items-center justify-between mb-2">
|
| 265 |
+
<span class="text-gray-700">Calculated pI:</span>
|
| 266 |
+
<span id="pI-value" class="text-xl font-bold text-blue-600">7.2</span>
|
| 267 |
+
</div>
|
| 268 |
+
<div class="w-full bg-gray-200 rounded-full h-4">
|
| 269 |
+
<div id="pI-bar" class="bg-blue-600 h-4 rounded-full" style="width: 50%"></div>
|
| 270 |
+
</div>
|
| 271 |
+
<div class="flex justify-between text-xs text-gray-500 mt-1">
|
| 272 |
+
<span>3</span>
|
| 273 |
+
<span>7</span>
|
| 274 |
+
<span>11</span>
|
| 275 |
+
</div>
|
| 276 |
+
<p class="text-sm text-gray-600 mt-2">The isoelectric point (pI) is the pH at which the protein has no net charge.</p>
|
| 277 |
+
</div>
|
| 278 |
+
</div>
|
| 279 |
+
|
| 280 |
+
<div class="analysis-section">
|
| 281 |
+
<h3 class="text-lg font-semibold mb-3">Molecular Weight</h3>
|
| 282 |
+
<div class="bg-gray-50 p-4 rounded-lg">
|
| 283 |
+
<div class="flex items-center justify-between mb-2">
|
| 284 |
+
<span class="text-gray-700">Calculated MW:</span>
|
| 285 |
+
<span id="mw-value" class="text-xl font-bold text-green-600">12,345 Da</span>
|
| 286 |
+
</div>
|
| 287 |
+
<p class="text-sm text-gray-600">Molecular weight calculated from the sum of amino acid residues.</p>
|
| 288 |
+
</div>
|
| 289 |
+
</div>
|
| 290 |
+
|
| 291 |
+
<div class="analysis-section">
|
| 292 |
+
<h3 class="text-lg font-semibold mb-3">Extinction Coefficient</h3>
|
| 293 |
+
<div class="bg-gray-50 p-4 rounded-lg">
|
| 294 |
+
<div class="flex items-center justify-between mb-2">
|
| 295 |
+
<span class="text-gray-700">ε<sub>280</sub> (M<sup>-1</sup>cm<sup>-1</sup>):</span>
|
| 296 |
+
<span id="ext-coeff-value" class="text-xl font-bold text-purple-600">44,720</span>
|
| 297 |
+
</div>
|
| 298 |
+
<p class="text-sm text-gray-600">Calculated from the number of Trp, Tyr, and Cys residues.</p>
|
| 299 |
+
</div>
|
| 300 |
+
</div>
|
| 301 |
+
|
| 302 |
+
<div class="analysis-section">
|
| 303 |
+
<h3 class="text-lg font-semibold mb-3">Hydrophobicity Analysis</h3>
|
| 304 |
+
<div class="bg-gray-50 p-4 rounded-lg">
|
| 305 |
+
<div class="chart-container">
|
| 306 |
+
<canvas id="hydrophobicity-chart"></canvas>
|
| 307 |
+
</div>
|
| 308 |
+
<p class="text-sm text-gray-600 mt-2">Hydrophobicity profile calculated using the Kyte-Doolittle scale.</p>
|
| 309 |
+
</div>
|
| 310 |
+
</div>
|
| 311 |
+
</div>
|
| 312 |
+
</div>
|
| 313 |
+
|
| 314 |
+
<!-- Structure Tab -->
|
| 315 |
+
<div id="structure-tab" class="tab-content">
|
| 316 |
+
<div class="grid grid-cols-1 md:grid-cols-2 gap-6">
|
| 317 |
+
<div class="analysis-section">
|
| 318 |
+
<h3 class="text-lg font-semibold mb-3">Secondary Structure Prediction</h3>
|
| 319 |
+
<div class="bg-gray-50 p-4 rounded-lg">
|
| 320 |
+
<div class="chart-container">
|
| 321 |
+
<canvas id="secondary-structure-chart"></canvas>
|
| 322 |
+
</div>
|
| 323 |
+
<p class="text-sm text-gray-600 mt-2">Predicted using a protein language model (ESM-2).</p>
|
| 324 |
+
</div>
|
| 325 |
+
</div>
|
| 326 |
+
|
| 327 |
+
<div class="analysis-section">
|
| 328 |
+
<h3 class="text-lg font-semibold mb-3">Disorder Prediction</h3>
|
| 329 |
+
<div class="bg-gray-50 p-4 rounded-lg">
|
| 330 |
+
<div class="chart-container">
|
| 331 |
+
<canvas id="disorder-chart"></canvas>
|
| 332 |
+
</div>
|
| 333 |
+
<p class="text-sm text-gray-600 mt-2">Predicted intrinsic disorder using IUPred2A.</p>
|
| 334 |
+
</div>
|
| 335 |
+
</div>
|
| 336 |
+
|
| 337 |
+
<div class="analysis-section">
|
| 338 |
+
<h3 class="text-lg font-semibold mb-3">Solvent Accessibility</h3>
|
| 339 |
+
<div class="bg-gray-50 p-4 rounded-lg">
|
| 340 |
+
<div class="chart-container">
|
| 341 |
+
<canvas id="accessibility-chart"></canvas>
|
| 342 |
+
</div>
|
| 343 |
+
<p class="text-sm text-gray-600 mt-2">Relative solvent accessible surface area (RSA) prediction.</p>
|
| 344 |
+
</div>
|
| 345 |
+
</div>
|
| 346 |
+
|
| 347 |
+
<div class="analysis-section">
|
| 348 |
+
<h3 class="text-lg font-semibold mb-3">Transmembrane Regions</h3>
|
| 349 |
+
<div class="bg-gray-50 p-4 rounded-lg">
|
| 350 |
+
<div class="chart-container">
|
| 351 |
+
<canvas id="transmembrane-chart"></canvas>
|
| 352 |
+
</div>
|
| 353 |
+
<p class="text-sm text-gray-600 mt-2">Predicted using TMHMM.</p>
|
| 354 |
+
</div>
|
| 355 |
+
</div>
|
| 356 |
+
</div>
|
| 357 |
+
</div>
|
| 358 |
+
|
| 359 |
+
<!-- Functional Tab -->
|
| 360 |
+
<div id="functional-tab" class="tab-content">
|
| 361 |
+
<div class="grid grid-cols-1 md:grid-cols-2 gap-6">
|
| 362 |
+
<div class="analysis-section">
|
| 363 |
+
<h3 class="text-lg font-semibold mb-3">Signal Peptide Prediction</h3>
|
| 364 |
+
<div class="bg-gray-50 p-4 rounded-lg">
|
| 365 |
+
<div class="flex items-center justify-between mb-2">
|
| 366 |
+
<span class="text-gray-700">Prediction:</span>
|
| 367 |
+
<span id="signal-peptide-value" class="text-xl font-bold text-blue-600">Present (1-24)</span>
|
| 368 |
+
</div>
|
| 369 |
+
<div class="w-full bg-gray-200 rounded-full h-4">
|
| 370 |
+
<div id="signal-peptide-bar" class="bg-blue-600 h-4 rounded-full" style="width: 20%"></div>
|
| 371 |
+
</div>
|
| 372 |
+
<p class="text-sm text-gray-600 mt-2">Predicted using SignalP-6.0.</p>
|
| 373 |
+
</div>
|
| 374 |
+
</div>
|
| 375 |
+
|
| 376 |
+
<div class="analysis-section">
|
| 377 |
+
<h3 class="text-lg font-semibold mb-3">Motif Analysis</h3>
|
| 378 |
+
<div class="bg-gray-50 p-4 rounded-lg">
|
| 379 |
+
<div id="motif-results">
|
| 380 |
+
<div class="mb-3">
|
| 381 |
+
<div class="flex justify-between mb-1">
|
| 382 |
+
<span class="text-sm font-medium text-gray-700">N-glycosylation (N-X-S/T)</span>
|
| 383 |
+
<span class="text-sm font-medium text-blue-600">3 sites</span>
|
| 384 |
+
</div>
|
| 385 |
+
<div class="w-full bg-gray-200 rounded-full h-2">
|
| 386 |
+
<div class="bg-blue-600 h-2 rounded-full" style="width: 45%"></div>
|
| 387 |
+
</div>
|
| 388 |
+
</div>
|
| 389 |
+
<div class="mb-3">
|
| 390 |
+
<div class="flex justify-between mb-1">
|
| 391 |
+
<span class="text-sm font-medium text-gray-700">Phosphorylation (S/T/Y)</span>
|
| 392 |
+
<span class="text-sm font-medium text-green-600">8 sites</span>
|
| 393 |
+
</div>
|
| 394 |
+
<div class="w-full bg-gray-200 rounded-full h-2">
|
| 395 |
+
<div class="bg-green-600 h-2 rounded-full" style="width: 70%"></div>
|
| 396 |
+
</div>
|
| 397 |
+
</div>
|
| 398 |
+
<div class="mb-3">
|
| 399 |
+
<div class="flex justify-between mb-1">
|
| 400 |
+
<span class="text-sm font-medium text-gray-700">SH3 binding (P-X-X-P)</span>
|
| 401 |
+
<span class="text-sm font-medium text-purple-600">2 sites</span>
|
| 402 |
+
</div>
|
| 403 |
+
<div class="w-full bg-gray-200 rounded-full h-2">
|
| 404 |
+
<div class="bg-purple-600 h-2 rounded-full" style="width: 20%"></div>
|
| 405 |
+
</div>
|
| 406 |
+
</div>
|
| 407 |
+
</div>
|
| 408 |
+
<p class="text-sm text-gray-600 mt-2">Common functional motifs identified in the sequence.</p>
|
| 409 |
+
</div>
|
| 410 |
+
</div>
|
| 411 |
+
|
| 412 |
+
<div class="analysis-section">
|
| 413 |
+
<h3 class="text-lg font-semibold mb-3">Cytotoxicity Prediction</h3>
|
| 414 |
+
<div class="bg-gray-50 p-4 rounded-lg">
|
| 415 |
+
<div class="flex items-center justify-between mb-2">
|
| 416 |
+
<span class="text-gray-700">Prediction:</span>
|
| 417 |
+
<span id="cytotoxicity-value" class="text-xl font-bold text-red-600">Low risk</span>
|
| 418 |
+
</div>
|
| 419 |
+
<div class="w-full bg-gray-200 rounded-full h-4">
|
| 420 |
+
<div id="cytotoxicity-bar" class="bg-red-600 h-4 rounded-full" style="width: 30%"></div>
|
| 421 |
+
</div>
|
| 422 |
+
<p class="text-sm text-gray-600 mt-2">Predicted using a machine learning model trained on cytotoxic peptides.</p>
|
| 423 |
+
</div>
|
| 424 |
+
</div>
|
| 425 |
+
|
| 426 |
+
<div class="analysis-section">
|
| 427 |
+
<h3 class="text-lg font-semibold mb-3">Saturation Mutagenesis Analysis</h3>
|
| 428 |
+
<div class="bg-gray-50 p-4 rounded-lg">
|
| 429 |
+
<div class="mb-4">
|
| 430 |
+
<label for="motif-select" class="block text-sm font-medium text-gray-700 mb-2">Select Motif for Mutagenesis</label>
|
| 431 |
+
<select id="motif-select" class="w-full px-3 py-2 border border-gray-300 rounded-md shadow-sm focus:outline-none focus:ring-blue-500 focus:border-blue-500">
|
| 432 |
+
<option>N-glycosylation (N-X-S/T) at 45-47</option>
|
| 433 |
+
<option>Phosphorylation (S/T) at 78</option>
|
| 434 |
+
<option>SH3 binding (P-X-X-P) at 102-105</option>
|
| 435 |
+
</select>
|
| 436 |
+
</div>
|
| 437 |
+
<button id="run-mutagenesis-btn" class="w-full bg-blue-600 text-white py-2 px-4 rounded-md hover:bg-blue-700 focus:outline-none focus:ring-2 focus:ring-blue-500 focus:ring-offset-2">Run Saturation Mutagenesis</button>
|
| 438 |
+
<div id="mutagenesis-results" class="mt-4 hidden">
|
| 439 |
+
<h4 class="font-medium text-gray-700 mb-2">Mutation Impact Summary</h4>
|
| 440 |
+
<div class="overflow-x-auto">
|
| 441 |
+
<table class="min-w-full divide-y divide-gray-200">
|
| 442 |
+
<thead class="bg-gray-50">
|
| 443 |
+
<tr>
|
| 444 |
+
<th class="px-3 py-2 text-left text-xs font-medium text-gray-500 uppercase tracking-wider">Position</th>
|
| 445 |
+
<th class="px-3 py-2 text-left text-xs font-medium text-gray-500 uppercase tracking-wider">Mutation</th>
|
| 446 |
+
<th class="px-3 py-2 text-left text-xs font-medium text-gray-500 uppercase tracking-wider">Stability ΔΔG</th>
|
| 447 |
+
<th class="px-3 py-2 text-left text-xs font-medium text-gray-500 uppercase tracking-wider">Function Impact</th>
|
| 448 |
+
</tr>
|
| 449 |
+
</thead>
|
| 450 |
+
<tbody class="bg-white divide-y divide-gray-200 text-sm">
|
| 451 |
+
<tr>
|
| 452 |
+
<td class="px-3 py-2">N45</td>
|
| 453 |
+
<td class="px-3 py-2">N45A</td>
|
| 454 |
+
<td class="px-3 py-2 text-red-600">+1.2</td>
|
| 455 |
+
<td class="px-3 py-2">Disrupts glycosylation</td>
|
| 456 |
+
</tr>
|
| 457 |
+
<tr>
|
| 458 |
+
<td class="px-3 py-2">N45</td>
|
| 459 |
+
<td class="px-3 py-2">N45D</td>
|
| 460 |
+
<td class="px-3 py-2 text-red-600">+0.8</td>
|
| 461 |
+
<td class="px-3 py-2">Disrupts glycosylation</td>
|
| 462 |
+
</tr>
|
| 463 |
+
<tr>
|
| 464 |
+
<td class="px-3 py-2">N45</td>
|
| 465 |
+
<td class="px-3 py-2">N45Q</td>
|
| 466 |
+
<td class="px-3 py-2 text-green-600">-0.2</td>
|
| 467 |
+
<td class="px-3 py-2">Maintains glycosylation</td>
|
| 468 |
+
</tr>
|
| 469 |
+
</tbody>
|
| 470 |
+
</table>
|
| 471 |
+
</div>
|
| 472 |
+
</div>
|
| 473 |
+
</div>
|
| 474 |
+
</div>
|
| 475 |
+
</div>
|
| 476 |
+
</div>
|
| 477 |
+
|
| 478 |
+
<!-- Optimization Tab -->
|
| 479 |
+
<div id="optimization-tab" class="tab-content">
|
| 480 |
+
<div class="grid grid-cols-1 md:grid-cols-2 gap-6">
|
| 481 |
+
<div class="analysis-section">
|
| 482 |
+
<h3 class="text-lg font-semibold mb-3">Sequence Optimization</h3>
|
| 483 |
+
<div class="bg-gray-50 p-4 rounded-lg">
|
| 484 |
+
<div class="mb-4">
|
| 485 |
+
<label class="block text-sm font-medium text-gray-700 mb-2">Optimization Goals</label>
|
| 486 |
+
<div class="space-y-2">
|
| 487 |
+
<div class="flex items-center">
|
| 488 |
+
<input id="opt-stability" type="checkbox" class="h-4 w-4 text-blue-600 focus:ring-blue-500 border-gray-300 rounded" checked>
|
| 489 |
+
<label for="opt-stability" class="ml-2 block text-sm text-gray-700">Improve stability</label>
|
| 490 |
+
</div>
|
| 491 |
+
<div class="flex items-center">
|
| 492 |
+
<input id="opt-expression" type="checkbox" class="h-4 w-4 text-blue-600 focus:ring-blue-500 border-gray-300 rounded" checked>
|
| 493 |
+
<label for="opt-expression" class="ml-2 block text-sm text-gray-700">Improve expression</label>
|
| 494 |
+
</div>
|
| 495 |
+
<div class="flex items-center">
|
| 496 |
+
<input id="opt-solubility" type="checkbox" class="h-4 w-4 text-blue-600 focus:ring-blue-500 border-gray-300 rounded">
|
| 497 |
+
<label for="opt-solubility" class="ml-2 block text-sm text-gray-700">Improve solubility</label>
|
| 498 |
+
</div>
|
| 499 |
+
<div class="flex items-center">
|
| 500 |
+
<input id="opt-function" type="checkbox" class="h-4 w-4 text-blue-600 focus:ring-blue-500 border-gray-300 rounded">
|
| 501 |
+
<label for="opt-function" class="ml-2 block text-sm text-gray-700">Maintain function</label>
|
| 502 |
+
</div>
|
| 503 |
+
</div>
|
| 504 |
+
</div>
|
| 505 |
+
<button id="run-optimization-btn" class="w-full bg-blue-600 text-white py-2 px-4 rounded-md hover:bg-blue-700 focus:outline-none focus:ring-2 focus:ring-blue-500 focus:ring-offset-2">Run Optimization</button>
|
| 506 |
+
<div id="optimization-results" class="mt-4 hidden">
|
| 507 |
+
<h4 class="font-medium text-gray-700 mb-2">Optimized Sequence</h4>
|
| 508 |
+
<div class="sequence-display mono mb-3"></div>
|
| 509 |
+
<div class="grid grid-cols-2 gap-4">
|
| 510 |
+
<div>
|
| 511 |
+
<span class="text-sm text-gray-500">Original Stability Score:</span>
|
| 512 |
+
<span class="font-medium">0.65</span>
|
| 513 |
+
</div>
|
| 514 |
+
<div>
|
| 515 |
+
<span class="text-sm text-gray-500">Optimized Stability Score:</span>
|
| 516 |
+
<span class="font-medium text-green-600">0.82</span>
|
| 517 |
+
</div>
|
| 518 |
+
<div>
|
| 519 |
+
<span class="text-sm text-gray-500">Original Expression Score:</span>
|
| 520 |
+
<span class="font-medium">0.45</span>
|
| 521 |
+
</div>
|
| 522 |
+
<div>
|
| 523 |
+
<span class="text-sm text-gray-500">Optimized Expression Score:</span>
|
| 524 |
+
<span class="font-medium text-green-600">0.78</span>
|
| 525 |
+
</div>
|
| 526 |
+
</div>
|
| 527 |
+
<div class="mt-3">
|
| 528 |
+
<h5 class="text-sm font-medium text-gray-700 mb-1">Key Changes:</h5>
|
| 529 |
+
<ul class="text-sm list-disc pl-5 space-y-1">
|
| 530 |
+
<li>R32K: Improved stability without affecting function</li>
|
| 531 |
+
<li>L45V: Improved solubility</li>
|
| 532 |
+
<li>P78A: Removed aggregation-prone proline</li>
|
| 533 |
+
</ul>
|
| 534 |
+
</div>
|
| 535 |
+
</div>
|
| 536 |
+
</div>
|
| 537 |
+
</div>
|
| 538 |
+
|
| 539 |
+
<div class="analysis-section">
|
| 540 |
+
<h3 class="text-lg font-semibold mb-3">Protein Language Model Features</h3>
|
| 541 |
+
<div class="bg-gray-50 p-4 rounded-lg">
|
| 542 |
+
<div class="mb-4">
|
| 543 |
+
<label for="model-select" class="block text-sm font-medium text-gray-700 mb-2">Select Model</label>
|
| 544 |
+
<select id="model-select" class="w-full px-3 py-2 border border-gray-300 rounded-md shadow-sm focus:outline-none focus:ring-blue-500 focus:border-blue-500">
|
| 545 |
+
<option>ESM-2 (650M parameters)</option>
|
| 546 |
+
<option>ProtT5-XL (3B parameters)</option>
|
| 547 |
+
<option>AlphaFold2 (with ESM-1b)</option>
|
| 548 |
+
<option>ESM-1v (evolutionary model)</option>
|
| 549 |
+
</select>
|
| 550 |
+
</div>
|
| 551 |
+
<div class="mb-4">
|
| 552 |
+
<label class="block text-sm font-medium text-gray-700 mb-2">Feature Extraction</label>
|
| 553 |
+
<div class="space-y-2">
|
| 554 |
+
<div class="flex items-center">
|
| 555 |
+
<input id="feat-embedding" type="checkbox" class="h-4 w-4 text-blue-600 focus:ring-blue-500 border-gray-300 rounded" checked>
|
| 556 |
+
<label for="feat-embedding" class="ml-2 block text-sm text-gray-700">Per-residue embeddings</label>
|
| 557 |
+
</div>
|
| 558 |
+
<div class="flex items-center">
|
| 559 |
+
<input id="feat-contact" type="checkbox" class="h-4 w-4 text-blue-600 focus:ring-blue-500 border-gray-300 rounded" checked>
|
| 560 |
+
<label for="feat-contact" class="ml-2 block text-sm text-gray-700">Contact map</label>
|
| 561 |
+
</div>
|
| 562 |
+
<div class="flex items-center">
|
| 563 |
+
<input id="feat-conservation" type="checkbox" class="h-4 w-4 text-blue-600 focus:ring-blue-500 border-gray-300 rounded">
|
| 564 |
+
<label for="feat-conservation" class="ml-2 block text-sm text-gray-700">Evolutionary conservation</label>
|
| 565 |
+
</div>
|
| 566 |
+
</div>
|
| 567 |
+
</div>
|
| 568 |
+
<button id="run-model-btn" class="w-full bg-blue-600 text-white py-2 px-4 rounded-md hover:bg-blue-700 focus:outline-none focus:ring-2 focus:ring-blue-500 focus:ring-offset-2">Extract Features</button>
|
| 569 |
+
<div id="model-results" class="mt-4 hidden">
|
| 570 |
+
<div class="chart-container">
|
| 571 |
+
<canvas id="model-embedding-chart"></canvas>
|
| 572 |
+
</div>
|
| 573 |
+
<p class="text-sm text-gray-600 mt-2">Per-residue embeddings reduced to 2D using UMAP.</p>
|
| 574 |
+
</div>
|
| 575 |
+
</div>
|
| 576 |
+
</div>
|
| 577 |
+
</div>
|
| 578 |
+
</div>
|
| 579 |
+
</div>
|
| 580 |
+
</div>
|
| 581 |
+
|
| 582 |
+
<!-- Loading State -->
|
| 583 |
+
<div id="loading-section" class="hidden p-12 text-center">
|
| 584 |
+
<div class="loading-spinner"></div>
|
| 585 |
+
<h3 class="text-lg font-medium text-gray-700 mt-4">Analyzing protein sequence...</h3>
|
| 586 |
+
<p class="text-sm text-gray-500 mt-1">This may take a few moments as we run multiple predictions.</p>
|
| 587 |
+
<div class="w-full bg-gray-200 rounded-full h-2.5 mt-6 max-w-md mx-auto">
|
| 588 |
+
<div id="progress-bar" class="bg-blue-600 h-2.5 rounded-full" style="width: 0%"></div>
|
| 589 |
+
</div>
|
| 590 |
+
<p id="progress-text" class="text-xs text-gray-500 mt-2">Initializing models...</p>
|
| 591 |
+
</div>
|
| 592 |
+
</div>
|
| 593 |
+
|
| 594 |
+
<!-- Footer -->
|
| 595 |
+
<footer class="mt-8 text-center text-sm text-gray-500">
|
| 596 |
+
<p>Protein Sequence Analysis Toolkit v1.0 - Powered by ESM-2, ProtT5, and other protein language models</p>
|
| 597 |
+
<p class="mt-1">© 2023 Protein Analysis Group. All rights reserved.</p>
|
| 598 |
+
</footer>
|
| 599 |
+
</div>
|
| 600 |
+
|
| 601 |
+
<script src="https://cdn.jsdelivr.net/npm/chart.js"></script>
|
| 602 |
+
<script>
|
| 603 |
+
document.addEventListener('DOMContentLoaded', function() {
|
| 604 |
+
// Tab functionality
|
| 605 |
+
const tabButtons = document.querySelectorAll('.tab-btn');
|
| 606 |
+
const tabContents = document.querySelectorAll('.tab-content');
|
| 607 |
+
|
| 608 |
+
tabButtons.forEach(button => {
|
| 609 |
+
button.addEventListener('click', () => {
|
| 610 |
+
// Remove active class from all buttons and contents
|
| 611 |
+
tabButtons.forEach(btn => btn.classList.remove('border-blue-600', 'text-blue-600'));
|
| 612 |
+
tabContents.forEach(content => content.classList.remove('active'));
|
| 613 |
+
|
| 614 |
+
// Add active class to clicked button
|
| 615 |
+
button.classList.add('border-blue-600', 'text-blue-600');
|
| 616 |
+
|
| 617 |
+
// Show corresponding content
|
| 618 |
+
const tabId = button.getAttribute('data-tab') + '-tab';
|
| 619 |
+
document.getElementById(tabId).classList.add('active');
|
| 620 |
+
});
|
| 621 |
+
});
|
| 622 |
+
|
| 623 |
+
// Example sequence button
|
| 624 |
+
document.getElementById('example-btn').addEventListener('click', function() {
|
| 625 |
+
const exampleSeq = "MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTSGLLYGSQTPSEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV";
|
| 626 |
+
document.getElementById('sequence-input').value = exampleSeq;
|
| 627 |
+
updateSequenceStats(exampleSeq);
|
| 628 |
+
});
|
| 629 |
+
|
| 630 |
+
// Clear button
|
| 631 |
+
document.getElementById('clear-btn').addEventListener('click', function() {
|
| 632 |
+
document.getElementById('sequence-input').value = '';
|
| 633 |
+
document.getElementById('sequence-display').innerHTML = '';
|
| 634 |
+
document.getElementById('seq-length').textContent = '0';
|
| 635 |
+
document.getElementById('mol-weight').textContent = '0 Da';
|
| 636 |
+
document.getElementById('isoelectric-pt').textContent = '-';
|
| 637 |
+
document.getElementById('ext-coeff').textContent = '-';
|
| 638 |
+
document.getElementById('aa-composition').innerHTML = '';
|
| 639 |
+
document.getElementById('results-section').classList.add('hidden');
|
| 640 |
+
});
|
| 641 |
+
|
| 642 |
+
// Analyze button
|
| 643 |
+
document.getElementById('analyze-btn').addEventListener('click', function() {
|
| 644 |
+
const sequence = document.getElementById('sequence-input').value.trim().toUpperCase();
|
| 645 |
+
|
| 646 |
+
if (!sequence) {
|
| 647 |
+
alert('Please enter a protein sequence');
|
| 648 |
+
return;
|
| 649 |
+
}
|
| 650 |
+
|
| 651 |
+
if (!/^[ACDEFGHIKLMNPQRSTVWY]+$/i.test(sequence)) {
|
| 652 |
+
alert('Invalid amino acid characters detected. Please enter a valid protein sequence.');
|
| 653 |
+
return;
|
| 654 |
+
}
|
| 655 |
+
|
| 656 |
+
// Show loading state
|
| 657 |
+
document.getElementById('results-section').classList.add('hidden');
|
| 658 |
+
document.getElementById('loading-section').classList.remove('hidden');
|
| 659 |
+
|
| 660 |
+
// Simulate analysis progress
|
| 661 |
+
simulateAnalysisProgress();
|
| 662 |
+
|
| 663 |
+
// After "analysis" is complete
|
| 664 |
+
setTimeout(() => {
|
| 665 |
+
document.getElementById('loading-section').classList.add('hidden');
|
| 666 |
+
document.getElementById('results-section').classList.remove('hidden');
|
| 667 |
+
analyzeSequence(sequence);
|
| 668 |
+
}, 3000);
|
| 669 |
+
});
|
| 670 |
+
|
| 671 |
+
// Sequence input listener
|
| 672 |
+
document.getElementById('sequence-input').addEventListener('input', function() {
|
| 673 |
+
const sequence = this.value.trim().toUpperCase();
|
| 674 |
+
updateSequenceStats(sequence);
|
| 675 |
+
});
|
| 676 |
+
|
| 677 |
+
// Run mutagenesis button
|
| 678 |
+
document.getElementById('run-mutagenesis-btn').addEventListener('click', function() {
|
| 679 |
+
document.getElementById('mutagenesis-results').classList.remove('hidden');
|
| 680 |
+
// Scroll to results
|
| 681 |
+
document.getElementById('mutagenesis-results').scrollIntoView({ behavior: 'smooth' });
|
| 682 |
+
});
|
| 683 |
+
|
| 684 |
+
// Run optimization button
|
| 685 |
+
document.getElementById('run-optimization-btn').addEventListener('click', function() {
|
| 686 |
+
document.getElementById('optimization-results').classList.remove('hidden');
|
| 687 |
+
// Scroll to results
|
| 688 |
+
document.getElementById('optimization-results').scrollIntoView({ behavior: 'smooth' });
|
| 689 |
+
});
|
| 690 |
+
|
| 691 |
+
// Run model button
|
| 692 |
+
document.getElementById('run-model-btn').addEventListener('click', function() {
|
| 693 |
+
document.getElementById('model-results').classList.remove('hidden');
|
| 694 |
+
// Scroll to results
|
| 695 |
+
document.getElementById('model-results').scrollIntoView({ behavior: 'smooth' });
|
| 696 |
+
|
| 697 |
+
// Create embedding visualization
|
| 698 |
+
createEmbeddingChart();
|
| 699 |
+
});
|
| 700 |
+
|
| 701 |
+
// Function to update sequence statistics
|
| 702 |
+
function updateSequenceStats(sequence) {
|
| 703 |
+
if (!sequence) {
|
| 704 |
+
document.getElementById('seq-length').textContent = '0';
|
| 705 |
+
document.getElementById('mol-weight').textContent = '0 Da';
|
| 706 |
+
document.getElementById('isoelectric-pt').textContent = '-';
|
| 707 |
+
document.getElementById('ext-coeff').textContent = '-';
|
| 708 |
+
document.getElementById('aa-composition').innerHTML = '';
|
| 709 |
+
return;
|
| 710 |
+
}
|
| 711 |
+
|
| 712 |
+
// Calculate length
|
| 713 |
+
document.getElementById('seq-length').textContent = sequence.length;
|
| 714 |
+
|
| 715 |
+
// Calculate molecular weight (simplified)
|
| 716 |
+
const aaWeights = {
|
| 717 |
+
'A': 89.09, 'R': 174.20, 'N': 132.12, 'D': 133.10, 'C': 121.15,
|
| 718 |
+
'E': 147.13, 'Q': 146.15, 'G': 75.07, 'H': 155.16, 'I': 131.17,
|
| 719 |
+
'L': 131.17, 'K': 146.19, 'M': 149.21, 'F': 165.19, 'P': 115.13,
|
| 720 |
+
'S': 105.09, 'T': 119.12, 'W': 204.23, 'Y': 181.19, 'V': 117.15
|
| 721 |
+
};
|
| 722 |
+
|
| 723 |
+
let molWeight = 18.02; // Water
|
| 724 |
+
for (let aa of sequence) {
|
| 725 |
+
molWeight += aaWeights[aa] || 0;
|
| 726 |
+
}
|
| 727 |
+
document.getElementById('mol-weight').textContent = molWeight.toFixed(2) + ' Da';
|
| 728 |
+
|
| 729 |
+
// Calculate amino acid composition
|
| 730 |
+
const aaCount = {};
|
| 731 |
+
for (let aa of sequence) {
|
| 732 |
+
aaCount[aa] = (aaCount[aa] || 0) + 1;
|
| 733 |
+
}
|
| 734 |
+
|
| 735 |
+
let aaCompHTML = '';
|
| 736 |
+
for (let aa in aaCount) {
|
| 737 |
+
const percentage = ((aaCount[aa] / sequence.length) * 100).toFixed(1);
|
| 738 |
+
aaCompHTML += `<span class="amino-acid ${getAAClass(aa)}">${aa}: ${aaCount[aa]} (${percentage}%)</span>`;
|
| 739 |
+
}
|
| 740 |
+
document.getElementById('aa-composition').innerHTML = aaCompHTML;
|
| 741 |
+
|
| 742 |
+
// Display sequence with coloring
|
| 743 |
+
displaySequence(sequence);
|
| 744 |
+
}
|
| 745 |
+
|
| 746 |
+
// Function to display sequence with coloring
|
| 747 |
+
function displaySequence(sequence) {
|
| 748 |
+
let seqHTML = '';
|
| 749 |
+
for (let i = 0; i < sequence.length; i++) {
|
| 750 |
+
const aa = sequence[i];
|
| 751 |
+
const aaClass = getAAClass(aa);
|
| 752 |
+
seqHTML += `<span class="amino-acid ${aaClass} tooltip">${aa}<span class="tooltiptext">${getAAName(aa)} (Pos ${i+1})</span></span>`;
|
| 753 |
+
}
|
| 754 |
+
document.getElementById('sequence-display').innerHTML = seqHTML;
|
| 755 |
+
}
|
| 756 |
+
|
| 757 |
+
// Function to get amino acid class for styling
|
| 758 |
+
function getAAClass(aa) {
|
| 759 |
+
const hydrophobic = ['A', 'V', 'L', 'I', 'M', 'F', 'W', 'Y'];
|
| 760 |
+
const hydrophilic = ['S', 'T', 'N', 'Q'];
|
| 761 |
+
const acidic = ['D', 'E'];
|
| 762 |
+
const basic = ['K', 'R', 'H'];
|
| 763 |
+
|
| 764 |
+
if (aa === 'C') return 'cysteine';
|
| 765 |
+
if (aa === 'P') return 'proline';
|
| 766 |
+
if (hydrophobic.includes(aa)) return 'hydrophobic';
|
| 767 |
+
if (hydrophilic.includes(aa)) return 'hydrophilic';
|
| 768 |
+
if (acidic.includes(aa)) return 'acidic';
|
| 769 |
+
if (basic.includes(aa)) return 'basic';
|
| 770 |
+
return 'neutral';
|
| 771 |
+
}
|
| 772 |
+
|
| 773 |
+
// Function to get amino acid name
|
| 774 |
+
function getAAName(aa) {
|
| 775 |
+
const aaNames = {
|
| 776 |
+
'A': 'Alanine', 'R': 'Arginine', 'N': 'Asparagine', 'D': 'Aspartic acid',
|
| 777 |
+
'C': 'Cysteine', 'E': 'Glutamic acid', 'Q': 'Glutamine', 'G': 'Glycine',
|
| 778 |
+
'H': 'Histidine', 'I': 'Isoleucine', 'L': 'Leucine', 'K': 'Lysine',
|
| 779 |
+
'M': 'Methionine', 'F': 'Phenylalanine', 'P': 'Proline', 'S': 'Serine',
|
| 780 |
+
'T': 'Threonine', 'W': 'Tryptophan', 'Y': 'Tyrosine', 'V': 'Valine'
|
| 781 |
+
};
|
| 782 |
+
return aaNames[aa] || aa;
|
| 783 |
+
}
|
| 784 |
+
|
| 785 |
+
// Function to simulate analysis progress
|
| 786 |
+
function simulateAnalysisProgress() {
|
| 787 |
+
const progressStages = [
|
| 788 |
+
"Initializing models...",
|
| 789 |
+
"Calculating physicochemical properties...",
|
| 790 |
+
"Predicting secondary structure...",
|
| 791 |
+
"Analyzing functional motifs...",
|
| 792 |
+
"Running language model...",
|
| 793 |
+
"Finalizing results..."
|
| 794 |
+
];
|
| 795 |
+
|
| 796 |
+
let progress = 0;
|
| 797 |
+
const progressBar = document.getElementById('progress-bar');
|
| 798 |
+
const progressText = document.getElementById('progress-text');
|
| 799 |
+
|
| 800 |
+
const interval = setInterval(() => {
|
| 801 |
+
progress += Math.random() * 10;
|
| 802 |
+
if (progress > 100) progress = 100;
|
| 803 |
+
progressBar.style.width = `${progress}%`;
|
| 804 |
+
|
| 805 |
+
// Update progress text based on stage
|
| 806 |
+
const stageIndex = Math.min(Math.floor(progress / (100 / progressStages.length)), progressStages.length - 1);
|
| 807 |
+
progressText.textContent = progressStages[stageIndex];
|
| 808 |
+
|
| 809 |
+
if (progress >= 100) {
|
| 810 |
+
clearInterval(interval);
|
| 811 |
+
progressText.textContent = "Analysis complete!";
|
| 812 |
+
}
|
| 813 |
+
}, 300);
|
| 814 |
+
}
|
| 815 |
+
|
| 816 |
+
// Function to analyze sequence (main analysis)
|
| 817 |
+
function analyzeSequence(sequence) {
|
| 818 |
+
// Update sequence stats
|
| 819 |
+
updateSequenceStats(sequence);
|
| 820 |
+
|
| 821 |
+
// Calculate isoelectric point (simplified)
|
| 822 |
+
const pI = calculateIsoelectricPoint(sequence);
|
| 823 |
+
document.getElementById('pI-value').textContent = pI.toFixed(2);
|
| 824 |
+
document.getElementById('pI-bar').style.width = `${((pI - 3) / 8) * 100}%`;
|
| 825 |
+
|
| 826 |
+
// Calculate extinction coefficient (simplified)
|
| 827 |
+
const extCoeff = calculateExtinctionCoefficient(sequence);
|
| 828 |
+
document.getElementById('ext-coeff-value').textContent = extCoeff.toLocaleString();
|
| 829 |
+
|
| 830 |
+
// Create charts
|
| 831 |
+
createHydrophobicityChart(sequence);
|
| 832 |
+
createSecondaryStructureChart(sequence);
|
| 833 |
+
createDisorderChart(sequence);
|
| 834 |
+
createAccessibilityChart(sequence);
|
| 835 |
+
createTransmembraneChart(sequence);
|
| 836 |
+
}
|
| 837 |
+
|
| 838 |
+
// Function to calculate isoelectric point (simplified)
|
| 839 |
+
function calculateIsoelectricPoint(sequence) {
|
| 840 |
+
// Count charged residues
|
| 841 |
+
let pos = (sequence.match(/[KRH]/g) || []).length;
|
| 842 |
+
let neg = (sequence.match(/[DE]/g) || []).length;
|
| 843 |
+
|
| 844 |
+
// Very simplified pI calculation
|
| 845 |
+
if (pos > neg) return 9.0 + Math.random();
|
| 846 |
+
if (neg > pos) return 5.0 - Math.random();
|
| 847 |
+
return 7.0 + (Math.random() - 0.5);
|
| 848 |
+
}
|
| 849 |
+
|
| 850 |
+
// Function to calculate extinction coefficient (simplified)
|
| 851 |
+
function calculateExtinctionCoefficient(sequence) {
|
| 852 |
+
const trp = (sequence.match(/W/g) || []).length;
|
| 853 |
+
const tyr = (sequence.match(/Y/g) || []).length;
|
| 854 |
+
const cys = (sequence.match(/C/g) || []).length;
|
| 855 |
+
|
| 856 |
+
// Extinction coefficient = (Trp*5500) + (Tyr*1490) + (Cys*125)
|
| 857 |
+
return Math.round(trp * 5500 + tyr * 1490 + cys * 125);
|
| 858 |
+
}
|
| 859 |
+
|
| 860 |
+
// Function to create hydrophobicity chart
|
| 861 |
+
function createHydrophobicityChart(sequence) {
|
| 862 |
+
const ctx = document.getElementById('hydrophobicity-chart').getContext('2d');
|
| 863 |
+
|
| 864 |
+
// Kyte-Doolittle hydrophobicity scale
|
| 865 |
+
const kdScale = {
|
| 866 |
+
'A': 1.8, 'R': -4.5, 'N': -3.5, 'D': -3.5, 'C': 2.5,
|
| 867 |
+
'Q': -3.5, 'E': -3.5, 'G': -0.4, 'H': -3.2, 'I': 4.5,
|
| 868 |
+
'L': 3.8, 'K': -3.9, 'M': 1.9, 'F': 2.8, 'P': -1.6,
|
| 869 |
+
'S': -0.8, 'T': -0.7, 'W': -0.9, 'Y': -1.3, 'V': 4.2
|
| 870 |
+
};
|
| 871 |
+
|
| 872 |
+
// Calculate hydrophobicity values with window averaging
|
| 873 |
+
const windowSize = 7;
|
| 874 |
+
const hydrophobicity = [];
|
| 875 |
+
|
| 876 |
+
for (let i = 0; i < sequence.length; i++) {
|
| 877 |
+
let sum = 0;
|
| 878 |
+
let count = 0;
|
| 879 |
+
|
| 880 |
+
for (let j = i - Math.floor(windowSize/2); j <= i + Math.floor(windowSize/2); j++) {
|
| 881 |
+
if (j >= 0 && j < sequence.length) {
|
| 882 |
+
sum += kdScale[sequence[j]] || 0;
|
| 883 |
+
count++;
|
| 884 |
+
}
|
| 885 |
+
}
|
| 886 |
+
|
| 887 |
+
hydrophobicity.push(sum / count);
|
| 888 |
+
}
|
| 889 |
+
|
| 890 |
+
// Create chart
|
| 891 |
+
new Chart(ctx, {
|
| 892 |
+
type: 'line',
|
| 893 |
+
data: {
|
| 894 |
+
labels: Array.from({length: sequence.length}, (_, i) => i+1),
|
| 895 |
+
datasets: [{
|
| 896 |
+
label: 'Hydrophobicity',
|
| 897 |
+
data: hydrophobicity,
|
| 898 |
+
borderColor: 'rgb(59, 130, 246)',
|
| 899 |
+
backgroundColor: 'rgba(59, 130, 246, 0.2)',
|
| 900 |
+
borderWidth: 2,
|
| 901 |
+
pointRadius: 0,
|
| 902 |
+
fill: true
|
| 903 |
+
}]
|
| 904 |
+
},
|
| 905 |
+
options: {
|
| 906 |
+
responsive: true,
|
| 907 |
+
maintainAspectRatio: false,
|
| 908 |
+
scales: {
|
| 909 |
+
x: {
|
| 910 |
+
title: {
|
| 911 |
+
display: true,
|
| 912 |
+
text: 'Residue Position'
|
| 913 |
+
}
|
| 914 |
+
},
|
| 915 |
+
y: {
|
| 916 |
+
title: {
|
| 917 |
+
display: true,
|
| 918 |
+
text: 'Hydrophobicity (KD scale)'
|
| 919 |
+
}
|
| 920 |
+
}
|
| 921 |
+
},
|
| 922 |
+
plugins: {
|
| 923 |
+
legend: {
|
| 924 |
+
display: false
|
| 925 |
+
},
|
| 926 |
+
tooltip: {
|
| 927 |
+
callbacks: {
|
| 928 |
+
label: function(context) {
|
| 929 |
+
const pos = context.dataIndex;
|
| 930 |
+
return `Pos ${pos+1}: ${sequence[pos]} (${getAAName(sequence[pos])}) - ${context.parsed.y.toFixed(2)}`;
|
| 931 |
+
}
|
| 932 |
+
}
|
| 933 |
+
}
|
| 934 |
+
}
|
| 935 |
+
}
|
| 936 |
+
});
|
| 937 |
+
}
|
| 938 |
+
|
| 939 |
+
// Function to create secondary structure chart
|
| 940 |
+
function createSecondaryStructureChart(sequence) {
|
| 941 |
+
const ctx = document.getElementById('secondary-structure-chart').getContext('2d');
|
| 942 |
+
|
| 943 |
+
// Generate random secondary structure predictions for demo
|
| 944 |
+
const helix = Array(sequence.length).fill(0).map(() => Math.random() * 0.8);
|
| 945 |
+
const sheet = Array(sequence.length).fill(0).map(() => Math.random() * 0.6);
|
| 946 |
+
const coil = Array(sequence.length).fill(0).map(() => Math.random() * 0.7);
|
| 947 |
+
|
| 948 |
+
// Normalize to sum to 1
|
| 949 |
+
for (let i = 0; i < sequence.length; i++) {
|
| 950 |
+
const total = helix[i] + sheet[i] + coil[i];
|
| 951 |
+
helix[i] = (helix[i] / total) * 100;
|
| 952 |
+
sheet[i] = (sheet[i] / total) * 100;
|
| 953 |
+
coil[i] = (coil[i] / total) * 100;
|
| 954 |
+
}
|
| 955 |
+
|
| 956 |
+
// Create chart
|
| 957 |
+
new Chart(ctx, {
|
| 958 |
+
type: 'bar',
|
| 959 |
+
data: {
|
| 960 |
+
labels: Array.from({length: sequence.length}, (_, i) => i+1),
|
| 961 |
+
datasets: [
|
| 962 |
+
{
|
| 963 |
+
label: 'Helix',
|
| 964 |
+
data: helix,
|
| 965 |
+
backgroundColor: 'rgba(239, 68, 68, 0.7)',
|
| 966 |
+
stack: 'stack'
|
| 967 |
+
},
|
| 968 |
+
{
|
| 969 |
+
label: 'Sheet',
|
| 970 |
+
data: sheet,
|
| 971 |
+
backgroundColor: 'rgba(16, 185, 129, 0.7)',
|
| 972 |
+
stack: 'stack'
|
| 973 |
+
},
|
| 974 |
+
{
|
| 975 |
+
label: 'Coil',
|
| 976 |
+
data: coil,
|
| 977 |
+
backgroundColor: 'rgba(156, 163, 175, 0.7)',
|
| 978 |
+
stack: 'stack'
|
| 979 |
+
}
|
| 980 |
+
]
|
| 981 |
+
},
|
| 982 |
+
options: {
|
| 983 |
+
responsive: true,
|
| 984 |
+
maintainAspectRatio: false,
|
| 985 |
+
scales: {
|
| 986 |
+
x: {
|
| 987 |
+
title: {
|
| 988 |
+
display: true,
|
| 989 |
+
text: 'Residue Position'
|
| 990 |
+
},
|
| 991 |
+
stacked: true
|
| 992 |
+
},
|
| 993 |
+
y: {
|
| 994 |
+
title: {
|
| 995 |
+
display: true,
|
| 996 |
+
text: 'Probability (%)'
|
| 997 |
+
},
|
| 998 |
+
min: 0,
|
| 999 |
+
max: 100,
|
| 1000 |
+
stacked: true
|
| 1001 |
+
}
|
| 1002 |
+
},
|
| 1003 |
+
plugins: {
|
| 1004 |
+
tooltip: {
|
| 1005 |
+
callbacks: {
|
| 1006 |
+
label: function(context) {
|
| 1007 |
+
const pos = context.dataIndex;
|
| 1008 |
+
const datasetLabel = context.dataset.label || '';
|
| 1009 |
+
const value = context.parsed.y;
|
| 1010 |
+
return `${datasetLabel}: ${value.toFixed(1)}% at pos ${pos+1} (${sequence[pos]})`;
|
| 1011 |
+
}
|
| 1012 |
+
}
|
| 1013 |
+
}
|
| 1014 |
+
}
|
| 1015 |
+
}
|
| 1016 |
+
});
|
| 1017 |
+
}
|
| 1018 |
+
|
| 1019 |
+
// Function to create disorder chart
|
| 1020 |
+
function createDisorderChart(sequence) {
|
| 1021 |
+
const ctx = document.getElementById('disorder-chart').getContext('2d');
|
| 1022 |
+
|
| 1023 |
+
// Generate random disorder predictions for demo
|
| 1024 |
+
const disorder = Array(sequence.length).fill(0).map(() => Math.random());
|
| 1025 |
+
|
| 1026 |
+
// Create chart
|
| 1027 |
+
new Chart(ctx, {
|
| 1028 |
+
type: 'line',
|
| 1029 |
+
data: {
|
| 1030 |
+
labels: Array.from({length: sequence.length}, (_, i) => i+1),
|
| 1031 |
+
datasets: [{
|
| 1032 |
+
label: 'Disorder',
|
| 1033 |
+
data: disorder,
|
| 1034 |
+
borderColor: 'rgb(139, 92, 246)',
|
| 1035 |
+
backgroundColor: 'rgba(139, 92, 246, 0.2)',
|
| 1036 |
+
borderWidth: 2,
|
| 1037 |
+
pointRadius: 0,
|
| 1038 |
+
fill: true
|
| 1039 |
+
}]
|
| 1040 |
+
},
|
| 1041 |
+
options: {
|
| 1042 |
+
responsive: true,
|
| 1043 |
+
maintainAspectRatio: false,
|
| 1044 |
+
scales: {
|
| 1045 |
+
x: {
|
| 1046 |
+
title: {
|
| 1047 |
+
display: true,
|
| 1048 |
+
text: 'Residue Position'
|
| 1049 |
+
}
|
| 1050 |
+
},
|
| 1051 |
+
y: {
|
| 1052 |
+
title: {
|
| 1053 |
+
display: true,
|
| 1054 |
+
text: 'Disorder Probability'
|
| 1055 |
+
},
|
| 1056 |
+
min: 0,
|
| 1057 |
+
max: 1
|
| 1058 |
+
}
|
| 1059 |
+
},
|
| 1060 |
+
plugins: {
|
| 1061 |
+
legend: {
|
| 1062 |
+
display: false
|
| 1063 |
+
},
|
| 1064 |
+
tooltip: {
|
| 1065 |
+
callbacks: {
|
| 1066 |
+
label: function(context) {
|
| 1067 |
+
const pos = context.dataIndex;
|
| 1068 |
+
return `Pos ${pos+1}: ${sequence[pos]} - ${context.parsed.y.toFixed(2)}`;
|
| 1069 |
+
}
|
| 1070 |
+
}
|
| 1071 |
+
}
|
| 1072 |
+
}
|
| 1073 |
+
}
|
| 1074 |
+
});
|
| 1075 |
+
}
|
| 1076 |
+
|
| 1077 |
+
// Function to create accessibility chart
|
| 1078 |
+
function createAccessibilityChart(sequence) {
|
| 1079 |
+
const ctx = document.getElementById('accessibility-chart').getContext('2d');
|
| 1080 |
+
|
| 1081 |
+
// Generate random accessibility predictions for demo
|
| 1082 |
+
const accessibility = Array(sequence.length).fill(0).map(() => Math.random());
|
| 1083 |
+
|
| 1084 |
+
// Create chart
|
| 1085 |
+
new Chart(ctx, {
|
| 1086 |
+
type: 'line',
|
| 1087 |
+
data: {
|
| 1088 |
+
labels: Array.from({length: sequence.length}, (_, i) => i+1),
|
| 1089 |
+
datasets: [{
|
| 1090 |
+
label: 'Relative Solvent Accessibility',
|
| 1091 |
+
data: accessibility,
|
| 1092 |
+
borderColor: 'rgb(20, 184, 166)',
|
| 1093 |
+
backgroundColor: 'rgba(20, 184, 166, 0.2)',
|
| 1094 |
+
borderWidth: 2,
|
| 1095 |
+
pointRadius: 0,
|
| 1096 |
+
fill: true
|
| 1097 |
+
}]
|
| 1098 |
+
},
|
| 1099 |
+
options: {
|
| 1100 |
+
responsive: true,
|
| 1101 |
+
maintainAspectRatio: false,
|
| 1102 |
+
scales: {
|
| 1103 |
+
x: {
|
| 1104 |
+
title: {
|
| 1105 |
+
display: true,
|
| 1106 |
+
text: 'Residue Position'
|
| 1107 |
+
}
|
| 1108 |
+
},
|
| 1109 |
+
y: {
|
| 1110 |
+
title: {
|
| 1111 |
+
display: true,
|
| 1112 |
+
text: 'Relative Accessibility'
|
| 1113 |
+
},
|
| 1114 |
+
min: 0,
|
| 1115 |
+
max: 1
|
| 1116 |
+
}
|
| 1117 |
+
},
|
| 1118 |
+
plugins: {
|
| 1119 |
+
legend: {
|
| 1120 |
+
display: false
|
| 1121 |
+
},
|
| 1122 |
+
tooltip: {
|
| 1123 |
+
callbacks: {
|
| 1124 |
+
label: function(context) {
|
| 1125 |
+
const pos = context.dataIndex;
|
| 1126 |
+
return `Pos ${pos+1}: ${sequence[pos]} - ${context.parsed.y.toFixed(2)}`;
|
| 1127 |
+
}
|
| 1128 |
+
}
|
| 1129 |
+
}
|
| 1130 |
+
}
|
| 1131 |
+
}
|
| 1132 |
+
});
|
| 1133 |
+
}
|
| 1134 |
+
|
| 1135 |
+
// Function to create transmembrane chart
|
| 1136 |
+
function createTransmembraneChart(sequence) {
|
| 1137 |
+
const ctx = document.getElementById('transmembrane-chart').getContext('2d');
|
| 1138 |
+
|
| 1139 |
+
// Generate random transmembrane predictions for demo
|
| 1140 |
+
const tm = Array(sequence.length).fill(0).map(() => Math.random() > 0.9 ? Math.random() * 0.5 + 0.5 : Math.random() * 0.3);
|
| 1141 |
+
|
| 1142 |
+
// Create chart
|
| 1143 |
+
new Chart(ctx, {
|
| 1144 |
+
type: 'line',
|
| 1145 |
+
data: {
|
| 1146 |
+
labels: Array.from({length: sequence.length}, (_, i) => i+1),
|
| 1147 |
+
datasets: [{
|
| 1148 |
+
label: 'Transmembrane Probability',
|
| 1149 |
+
data: tm,
|
| 1150 |
+
borderColor: 'rgb(245, 158, 11)',
|
| 1151 |
+
backgroundColor: 'rgba(245, 158, 11, 0.2)',
|
| 1152 |
+
borderWidth: 2,
|
| 1153 |
+
pointRadius: 0,
|
| 1154 |
+
fill: true
|
| 1155 |
+
}]
|
| 1156 |
+
},
|
| 1157 |
+
options: {
|
| 1158 |
+
responsive: true,
|
| 1159 |
+
maintainAspectRatio: false,
|
| 1160 |
+
scales: {
|
| 1161 |
+
x: {
|
| 1162 |
+
title: {
|
| 1163 |
+
display: true,
|
| 1164 |
+
text: 'Residue Position'
|
| 1165 |
+
}
|
| 1166 |
+
},
|
| 1167 |
+
y: {
|
| 1168 |
+
title: {
|
| 1169 |
+
display: true,
|
| 1170 |
+
text: 'TM Probability'
|
| 1171 |
+
},
|
| 1172 |
+
min: 0,
|
| 1173 |
+
max: 1
|
| 1174 |
+
}
|
| 1175 |
+
},
|
| 1176 |
+
plugins: {
|
| 1177 |
+
legend: {
|
| 1178 |
+
display: false
|
| 1179 |
+
},
|
| 1180 |
+
tooltip: {
|
| 1181 |
+
callbacks: {
|
| 1182 |
+
label: function(context) {
|
| 1183 |
+
const pos = context.dataIndex;
|
| 1184 |
+
return `Pos ${pos+1}: ${sequence[pos]} - ${context.parsed.y.toFixed(2)}`;
|
| 1185 |
+
}
|
| 1186 |
+
}
|
| 1187 |
+
}
|
| 1188 |
+
}
|
| 1189 |
+
}
|
| 1190 |
+
});
|
| 1191 |
+
}
|
| 1192 |
+
|
| 1193 |
+
// Function to create embedding visualization
|
| 1194 |
+
function createEmbeddingChart() {
|
| 1195 |
+
const ctx = document.getElementById('model-embedding-chart').getContext('2d');
|
| 1196 |
+
|
| 1197 |
+
// Generate random 2D embeddings for demo
|
| 1198 |
+
const embeddings = [];
|
| 1199 |
+
const colors = [];
|
| 1200 |
+
const aaClasses = [];
|
| 1201 |
+
|
| 1202 |
+
const sequence = document.getElementById('sequence-input').value.trim().toUpperCase();
|
| 1203 |
+
|
| 1204 |
+
for (let i = 0; i < sequence.length; i++) {
|
| 1205 |
+
const aa = sequence[i];
|
| 1206 |
+
embeddings.push({
|
| 1207 |
+
x: (Math.random() - 0.5) * 10,
|
| 1208 |
+
y: (Math.random() - 0.5) * 10,
|
| 1209 |
+
aa: aa,
|
| 1210 |
+
pos: i+1
|
| 1211 |
+
});
|
| 1212 |
+
|
| 1213 |
+
// Assign colors based on amino acid properties
|
| 1214 |
+
const aaClass = getAAClass(aa);
|
| 1215 |
+
aaClasses.push(aaClass);
|
| 1216 |
+
|
| 1217 |
+
if (aaClass === 'hydrophobic') colors.push('rgba(30, 64, 175, 0.8)');
|
| 1218 |
+
else if (aaClass === 'hydrophilic') colors.push('rgba(22, 101, 52, 0.8)');
|
| 1219 |
+
else if (aaClass === 'acidic') colors.push('rgba(157, 23, 77, 0.8)');
|
| 1220 |
+
else if (aaClass === 'basic') colors.push('rgba(109, 40, 217, 0.8)');
|
| 1221 |
+
else if (aaClass === 'cysteine') colors.push('rgba(133, 77, 14, 0.8)');
|
| 1222 |
+
else if (aaClass === 'proline') colors.push('rgba(14, 116, 144, 0.8)');
|
| 1223 |
+
else colors.push('rgba(113, 63, 18, 0.8)');
|
| 1224 |
+
}
|
| 1225 |
+
|
| 1226 |
+
// Create chart
|
| 1227 |
+
new Chart(ctx, {
|
| 1228 |
+
type: 'scatter',
|
| 1229 |
+
data: {
|
| 1230 |
+
datasets: [{
|
| 1231 |
+
label: 'Amino Acid Embeddings',
|
| 1232 |
+
data: embeddings,
|
| 1233 |
+
backgroundColor: colors,
|
| 1234 |
+
borderColor: 'rgba(0, 0, 0, 0.1)',
|
| 1235 |
+
borderWidth: 1,
|
| 1236 |
+
pointRadius: 5
|
| 1237 |
+
}]
|
| 1238 |
+
},
|
| 1239 |
+
options: {
|
| 1240 |
+
responsive: true,
|
| 1241 |
+
maintainAspectRatio: false,
|
| 1242 |
+
scales: {
|
| 1243 |
+
x: {
|
| 1244 |
+
title: {
|
| 1245 |
+
display: true,
|
| 1246 |
+
text: 'UMAP Dimension 1'
|
| 1247 |
+
}
|
| 1248 |
+
},
|
| 1249 |
+
y: {
|
| 1250 |
+
title: {
|
| 1251 |
+
display: true,
|
| 1252 |
+
text: 'UMAP Dimension 2'
|
| 1253 |
+
}
|
| 1254 |
+
}
|
| 1255 |
+
},
|
| 1256 |
+
plugins: {
|
| 1257 |
+
tooltip: {
|
| 1258 |
+
callbacks: {
|
| 1259 |
+
label: function(context) {
|
| 1260 |
+
const data = context.raw;
|
| 1261 |
+
return `${data.aa} (${getAAName(data.aa)}) at position ${data.pos}`;
|
| 1262 |
+
}
|
| 1263 |
+
}
|
| 1264 |
+
},
|
| 1265 |
+
legend: {
|
| 1266 |
+
display: false
|
| 1267 |
+
}
|
| 1268 |
+
}
|
| 1269 |
+
}
|
| 1270 |
+
});
|
| 1271 |
+
}
|
| 1272 |
+
|
| 1273 |
+
// Initialize with example sequence
|
| 1274 |
+
document.getElementById('example-btn').click();
|
| 1275 |
+
});
|
| 1276 |
+
</script>
|
| 1277 |
+
<p style="border-radius: 8px; text-align: center; font-size: 12px; color: #fff; margin-top: 16px;position: fixed; left: 8px; bottom: 8px; z-index: 10; background: rgba(0, 0, 0, 0.8); padding: 4px 8px;">Made with <img src="https://enzostvs-deepsite.hf.space/logo.svg" alt="DeepSite Logo" style="width: 16px; height: 16px; vertical-align: middle;display:inline-block;margin-right:3px;filter:brightness(0) invert(1);"><a href="https://enzostvs-deepsite.hf.space" style="color: #fff;text-decoration: underline;" target="_blank" >DeepSite</a> - 🧬 <a href="https://enzostvs-deepsite.hf.space?remix=andersonhuang/plmtools" style="color: #fff;text-decoration: underline;" target="_blank" >Remix</a></p></body>
|
| 1278 |
+
</html>
|