Spaces:
Runtime error
Runtime error
Commit ·
e20eddc
1
Parent(s): 0e5beb4
removed redundent model dropdown label
Browse files- .gradio/certificate.pem +31 -0
- __pycache__/demo_framework.cpython-310.pyc +0 -0
- app.py +1 -1
- gradio_app.ipynb +740 -0
- mammal_demo/__pycache__/__init__.cpython-310.pyc +0 -0
- mammal_demo/__pycache__/demo_framework.cpython-310.pyc +0 -0
- mammal_demo/__pycache__/dti_task.cpython-310.pyc +0 -0
- mammal_demo/__pycache__/ibm_theme.cpython-310.pyc +0 -0
- mammal_demo/__pycache__/ppi_task.cpython-310.pyc +0 -0
- mammal_demo/__pycache__/ps_task.cpython-310.pyc +0 -0
- mammal_demo/__pycache__/tcr_task.cpython-310.pyc +0 -0
- mammal_demo/ibm_theme.py +76 -0
- modular.ipynb +0 -0
.gradio/certificate.pem
ADDED
|
@@ -0,0 +1,31 @@
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
| 1 |
+
-----BEGIN CERTIFICATE-----
|
| 2 |
+
MIIFazCCA1OgAwIBAgIRAIIQz7DSQONZRGPgu2OCiwAwDQYJKoZIhvcNAQELBQAw
|
| 3 |
+
TzELMAkGA1UEBhMCVVMxKTAnBgNVBAoTIEludGVybmV0IFNlY3VyaXR5IFJlc2Vh
|
| 4 |
+
cmNoIEdyb3VwMRUwEwYDVQQDEwxJU1JHIFJvb3QgWDEwHhcNMTUwNjA0MTEwNDM4
|
| 5 |
+
WhcNMzUwNjA0MTEwNDM4WjBPMQswCQYDVQQGEwJVUzEpMCcGA1UEChMgSW50ZXJu
|
| 6 |
+
ZXQgU2VjdXJpdHkgUmVzZWFyY2ggR3JvdXAxFTATBgNVBAMTDElTUkcgUm9vdCBY
|
| 7 |
+
MTCCAiIwDQYJKoZIhvcNAQEBBQADggIPADCCAgoCggIBAK3oJHP0FDfzm54rVygc
|
| 8 |
+
h77ct984kIxuPOZXoHj3dcKi/vVqbvYATyjb3miGbESTtrFj/RQSa78f0uoxmyF+
|
| 9 |
+
0TM8ukj13Xnfs7j/EvEhmkvBioZxaUpmZmyPfjxwv60pIgbz5MDmgK7iS4+3mX6U
|
| 10 |
+
A5/TR5d8mUgjU+g4rk8Kb4Mu0UlXjIB0ttov0DiNewNwIRt18jA8+o+u3dpjq+sW
|
| 11 |
+
T8KOEUt+zwvo/7V3LvSye0rgTBIlDHCNAymg4VMk7BPZ7hm/ELNKjD+Jo2FR3qyH
|
| 12 |
+
B5T0Y3HsLuJvW5iB4YlcNHlsdu87kGJ55tukmi8mxdAQ4Q7e2RCOFvu396j3x+UC
|
| 13 |
+
B5iPNgiV5+I3lg02dZ77DnKxHZu8A/lJBdiB3QW0KtZB6awBdpUKD9jf1b0SHzUv
|
| 14 |
+
KBds0pjBqAlkd25HN7rOrFleaJ1/ctaJxQZBKT5ZPt0m9STJEadao0xAH0ahmbWn
|
| 15 |
+
OlFuhjuefXKnEgV4We0+UXgVCwOPjdAvBbI+e0ocS3MFEvzG6uBQE3xDk3SzynTn
|
| 16 |
+
jh8BCNAw1FtxNrQHusEwMFxIt4I7mKZ9YIqioymCzLq9gwQbooMDQaHWBfEbwrbw
|
| 17 |
+
qHyGO0aoSCqI3Haadr8faqU9GY/rOPNk3sgrDQoo//fb4hVC1CLQJ13hef4Y53CI
|
| 18 |
+
rU7m2Ys6xt0nUW7/vGT1M0NPAgMBAAGjQjBAMA4GA1UdDwEB/wQEAwIBBjAPBgNV
|
| 19 |
+
HRMBAf8EBTADAQH/MB0GA1UdDgQWBBR5tFnme7bl5AFzgAiIyBpY9umbbjANBgkq
|
| 20 |
+
hkiG9w0BAQsFAAOCAgEAVR9YqbyyqFDQDLHYGmkgJykIrGF1XIpu+ILlaS/V9lZL
|
| 21 |
+
ubhzEFnTIZd+50xx+7LSYK05qAvqFyFWhfFQDlnrzuBZ6brJFe+GnY+EgPbk6ZGQ
|
| 22 |
+
3BebYhtF8GaV0nxvwuo77x/Py9auJ/GpsMiu/X1+mvoiBOv/2X/qkSsisRcOj/KK
|
| 23 |
+
NFtY2PwByVS5uCbMiogziUwthDyC3+6WVwW6LLv3xLfHTjuCvjHIInNzktHCgKQ5
|
| 24 |
+
ORAzI4JMPJ+GslWYHb4phowim57iaztXOoJwTdwJx4nLCgdNbOhdjsnvzqvHu7Ur
|
| 25 |
+
TkXWStAmzOVyyghqpZXjFaH3pO3JLF+l+/+sKAIuvtd7u+Nxe5AW0wdeRlN8NwdC
|
| 26 |
+
jNPElpzVmbUq4JUagEiuTDkHzsxHpFKVK7q4+63SM1N95R1NbdWhscdCb+ZAJzVc
|
| 27 |
+
oyi3B43njTOQ5yOf+1CceWxG1bQVs5ZufpsMljq4Ui0/1lvh+wjChP4kqKOJ2qxq
|
| 28 |
+
4RgqsahDYVvTH9w7jXbyLeiNdd8XM2w9U/t7y0Ff/9yi0GE44Za4rF2LN9d11TPA
|
| 29 |
+
mRGunUHBcnWEvgJBQl9nJEiU0Zsnvgc/ubhPgXRR4Xq37Z0j4r7g1SgEEzwxA57d
|
| 30 |
+
emyPxgcYxn/eR44/KJ4EBs+lVDR3veyJm+kXQ99b21/+jh5Xos1AnX5iItreGCc=
|
| 31 |
+
-----END CERTIFICATE-----
|
__pycache__/demo_framework.cpython-310.pyc
ADDED
|
Binary file (3.16 kB). View file
|
|
|
app.py
CHANGED
|
@@ -105,7 +105,7 @@ def create_application():
|
|
| 105 |
if task_dropdown.value in model.tasks
|
| 106 |
],
|
| 107 |
interactive=True,
|
| 108 |
-
label="
|
| 109 |
visible=False,
|
| 110 |
scale=10,
|
| 111 |
)
|
|
|
|
| 105 |
if task_dropdown.value in model.tasks
|
| 106 |
],
|
| 107 |
interactive=True,
|
| 108 |
+
label="",
|
| 109 |
visible=False,
|
| 110 |
scale=10,
|
| 111 |
)
|
gradio_app.ipynb
ADDED
|
@@ -0,0 +1,740 @@
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
| 1 |
+
{
|
| 2 |
+
"cells": [
|
| 3 |
+
{
|
| 4 |
+
"cell_type": "code",
|
| 5 |
+
"execution_count": null,
|
| 6 |
+
"metadata": {},
|
| 7 |
+
"outputs": [],
|
| 8 |
+
"source": [
|
| 9 |
+
"!uv pip list|grep mammal"
|
| 10 |
+
]
|
| 11 |
+
},
|
| 12 |
+
{
|
| 13 |
+
"cell_type": "code",
|
| 14 |
+
"execution_count": null,
|
| 15 |
+
"metadata": {},
|
| 16 |
+
"outputs": [],
|
| 17 |
+
"source": [
|
| 18 |
+
"import os\n",
|
| 19 |
+
"from fuse.data.tokenizers.modular_tokenizer.op import ModularTokenizerOp\n"
|
| 20 |
+
]
|
| 21 |
+
},
|
| 22 |
+
{
|
| 23 |
+
"cell_type": "code",
|
| 24 |
+
"execution_count": null,
|
| 25 |
+
"metadata": {},
|
| 26 |
+
"outputs": [],
|
| 27 |
+
"source": [
|
| 28 |
+
"\n",
|
| 29 |
+
"from mammal.examples.dti_bindingdb_kd.task import DtiBindingdbKdTask\n",
|
| 30 |
+
"from mammal.keys import CLS_PRED, SCORES\n",
|
| 31 |
+
"from mammal.model import Mammal\n"
|
| 32 |
+
]
|
| 33 |
+
},
|
| 34 |
+
{
|
| 35 |
+
"cell_type": "markdown",
|
| 36 |
+
"metadata": {},
|
| 37 |
+
"source": [
|
| 38 |
+
"\n",
|
| 39 |
+
"# input\n",
|
| 40 |
+
"target_seq = \"NLMKRCTRGFRKLGKCTTLEEEKCKTLYPRGQCTCSDSKMNTHSCDCKSC\"\n",
|
| 41 |
+
"drug_seq = \"CC(=O)NCCC1=CNc2c1cc(OC)cc2\"\n"
|
| 42 |
+
]
|
| 43 |
+
},
|
| 44 |
+
{
|
| 45 |
+
"cell_type": "markdown",
|
| 46 |
+
"metadata": {},
|
| 47 |
+
"source": [
|
| 48 |
+
"\n",
|
| 49 |
+
"# Load Model\n",
|
| 50 |
+
"model = Mammal.from_pretrained(\"ibm/biomed.omics.bl.sm.ma-ted-458m.dti_bindingdb_pkd\")\n",
|
| 51 |
+
"model.eval()\n"
|
| 52 |
+
]
|
| 53 |
+
},
|
| 54 |
+
{
|
| 55 |
+
"cell_type": "markdown",
|
| 56 |
+
"metadata": {},
|
| 57 |
+
"source": [
|
| 58 |
+
"\n",
|
| 59 |
+
"# Load Tokenizer\n",
|
| 60 |
+
"tokenizer_op = ModularTokenizerOp.from_pretrained(\"ibm/biomed.omics.bl.sm.ma-ted-458m.dti_bindingdb_pkd\")\n"
|
| 61 |
+
]
|
| 62 |
+
},
|
| 63 |
+
{
|
| 64 |
+
"cell_type": "markdown",
|
| 65 |
+
"metadata": {},
|
| 66 |
+
"source": [
|
| 67 |
+
"\n",
|
| 68 |
+
"# convert to MAMMAL style\n",
|
| 69 |
+
"sample_dict = {\"target_seq\": target_seq, \"drug_seq\": drug_seq}\n",
|
| 70 |
+
"sample_dict = DtiBindingdbKdTask.data_preprocessing(\n",
|
| 71 |
+
" sample_dict=sample_dict,\n",
|
| 72 |
+
" tokenizer_op=tokenizer_op,\n",
|
| 73 |
+
" target_sequence_key=\"target_seq\",\n",
|
| 74 |
+
" drug_sequence_key=\"drug_seq\",\n",
|
| 75 |
+
" norm_y_mean=None,\n",
|
| 76 |
+
" norm_y_std=None,\n",
|
| 77 |
+
" device=model.device,\n",
|
| 78 |
+
")\n",
|
| 79 |
+
"\n",
|
| 80 |
+
"sample_dict"
|
| 81 |
+
]
|
| 82 |
+
},
|
| 83 |
+
{
|
| 84 |
+
"cell_type": "markdown",
|
| 85 |
+
"metadata": {},
|
| 86 |
+
"source": [
|
| 87 |
+
"f\"<@TOKENIZER-TYPE=AA><MASK>\"\\\n",
|
| 88 |
+
" f\"<@TOKENIZER-TYPE=AA@MAX-LEN={target_max_seq_length}><MOLECULAR_ENTITY><MOLECULAR_ENTITY_GENERAL_PROTEIN><SEQUENCE_NATURAL_START>{target_sequence}<SEQUENCE_NATURAL_END>\" \\\n",
|
| 89 |
+
" f\"<@TOKENIZER-TYPE=SMILES@MAX-LEN={drug_max_seq_length}><MOLECULAR_ENTITY><MOLECULAR_ENTITY_SMALL_MOLECULE><SEQUENCE_NATURAL_START>{drug_sequence}<SEQUENCE_NATURAL_END>\" \\\n",
|
| 90 |
+
" \"<EOS>\""
|
| 91 |
+
]
|
| 92 |
+
},
|
| 93 |
+
{
|
| 94 |
+
"cell_type": "code",
|
| 95 |
+
"execution_count": null,
|
| 96 |
+
"metadata": {},
|
| 97 |
+
"outputs": [],
|
| 98 |
+
"source": []
|
| 99 |
+
},
|
| 100 |
+
{
|
| 101 |
+
"cell_type": "code",
|
| 102 |
+
"execution_count": null,
|
| 103 |
+
"metadata": {},
|
| 104 |
+
"outputs": [],
|
| 105 |
+
"source": []
|
| 106 |
+
},
|
| 107 |
+
{
|
| 108 |
+
"cell_type": "markdown",
|
| 109 |
+
"metadata": {},
|
| 110 |
+
"source": [
|
| 111 |
+
"\n",
|
| 112 |
+
"# forward pass - encoder_only mode which supports scalar predictions\n",
|
| 113 |
+
"batch_dict = model.forward_encoder_only([sample_dict])\n"
|
| 114 |
+
]
|
| 115 |
+
},
|
| 116 |
+
{
|
| 117 |
+
"cell_type": "markdown",
|
| 118 |
+
"metadata": {},
|
| 119 |
+
"source": [
|
| 120 |
+
"\n",
|
| 121 |
+
"# Post-process the model's output\n",
|
| 122 |
+
"batch_dict = DtiBindingdbKdTask.process_model_output(\n",
|
| 123 |
+
" batch_dict,\n",
|
| 124 |
+
" scalars_preds_processed_key=\"model.out.dti_bindingdb_kd\",\n",
|
| 125 |
+
" norm_y_mean=5.79384684128215,\n",
|
| 126 |
+
" norm_y_std=1.33808027428196,\n",
|
| 127 |
+
")\n",
|
| 128 |
+
"ans = {\n",
|
| 129 |
+
" \"model.out.dti_bindingdb_kd\": float(batch_dict[\"model.out.dti_bindingdb_kd\"][0])\n",
|
| 130 |
+
"}\n",
|
| 131 |
+
"\n",
|
| 132 |
+
"# Print prediction\n",
|
| 133 |
+
"print(f\"{ans=}\")"
|
| 134 |
+
]
|
| 135 |
+
},
|
| 136 |
+
{
|
| 137 |
+
"cell_type": "markdown",
|
| 138 |
+
"metadata": {},
|
| 139 |
+
"source": [
|
| 140 |
+
"sample_dict"
|
| 141 |
+
]
|
| 142 |
+
},
|
| 143 |
+
{
|
| 144 |
+
"cell_type": "markdown",
|
| 145 |
+
"metadata": {},
|
| 146 |
+
"source": []
|
| 147 |
+
},
|
| 148 |
+
{
|
| 149 |
+
"cell_type": "markdown",
|
| 150 |
+
"metadata": {},
|
| 151 |
+
"source": [
|
| 152 |
+
"# GRADIO app"
|
| 153 |
+
]
|
| 154 |
+
},
|
| 155 |
+
{
|
| 156 |
+
"cell_type": "code",
|
| 157 |
+
"execution_count": 1,
|
| 158 |
+
"metadata": {},
|
| 159 |
+
"outputs": [],
|
| 160 |
+
"source": [
|
| 161 |
+
"import gradio as gr\n"
|
| 162 |
+
]
|
| 163 |
+
},
|
| 164 |
+
{
|
| 165 |
+
"cell_type": "code",
|
| 166 |
+
"execution_count": 2,
|
| 167 |
+
"metadata": {},
|
| 168 |
+
"outputs": [],
|
| 169 |
+
"source": [
|
| 170 |
+
"\n",
|
| 171 |
+
"import torch\n",
|
| 172 |
+
"from fuse.data.tokenizers.modular_tokenizer.op import ModularTokenizerOp\n",
|
| 173 |
+
"from mammal.examples.dti_bindingdb_kd.task import DtiBindingdbKdTask\n",
|
| 174 |
+
"from mammal.keys import *\n",
|
| 175 |
+
"from mammal.model import Mammal\n",
|
| 176 |
+
"\n"
|
| 177 |
+
]
|
| 178 |
+
},
|
| 179 |
+
{
|
| 180 |
+
"cell_type": "code",
|
| 181 |
+
"execution_count": null,
|
| 182 |
+
"metadata": {},
|
| 183 |
+
"outputs": [
|
| 184 |
+
{
|
| 185 |
+
"name": "stdout",
|
| 186 |
+
"output_type": "stream",
|
| 187 |
+
"text": [
|
| 188 |
+
"Path doesn't exist. Will try to download fron hf hub. pretrained_model_name_or_path='ibm/biomed.omics.bl.sm.ma-ted-458m.dti_bindingdb_pkd'\n"
|
| 189 |
+
]
|
| 190 |
+
},
|
| 191 |
+
{
|
| 192 |
+
"data": {
|
| 193 |
+
"application/vnd.jupyter.widget-view+json": {
|
| 194 |
+
"model_id": "8afb628360ae435395dd34ba644945b9",
|
| 195 |
+
"version_major": 2,
|
| 196 |
+
"version_minor": 0
|
| 197 |
+
},
|
| 198 |
+
"text/plain": [
|
| 199 |
+
"Fetching 9 files: 0%| | 0/9 [00:00<?, ?it/s]"
|
| 200 |
+
]
|
| 201 |
+
},
|
| 202 |
+
"metadata": {},
|
| 203 |
+
"output_type": "display_data"
|
| 204 |
+
},
|
| 205 |
+
{
|
| 206 |
+
"name": "stdout",
|
| 207 |
+
"output_type": "stream",
|
| 208 |
+
"text": [
|
| 209 |
+
"Attempting to load model from dir: pretrained_model_name_or_path='/Users/matann/.cache/huggingface/hub/models--ibm--biomed.omics.bl.sm.ma-ted-458m.dti_bindingdb_pkd/snapshots/81aa7e8935b01de596fd1820708171a8663bd8d7'\n"
|
| 210 |
+
]
|
| 211 |
+
},
|
| 212 |
+
{
|
| 213 |
+
"data": {
|
| 214 |
+
"application/vnd.jupyter.widget-view+json": {
|
| 215 |
+
"model_id": "54b0bd1230d749ec95d7a5a95804b680",
|
| 216 |
+
"version_major": 2,
|
| 217 |
+
"version_minor": 0
|
| 218 |
+
},
|
| 219 |
+
"text/plain": [
|
| 220 |
+
"Fetching 5 files: 0%| | 0/5 [00:00<?, ?it/s]"
|
| 221 |
+
]
|
| 222 |
+
},
|
| 223 |
+
"metadata": {},
|
| 224 |
+
"output_type": "display_data"
|
| 225 |
+
},
|
| 226 |
+
{
|
| 227 |
+
"name": "stdout",
|
| 228 |
+
"output_type": "stream",
|
| 229 |
+
"text": [
|
| 230 |
+
"The OrderedVocab you are attempting to save contains holes for indices [314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, 500], your vocabulary could be corrupted !\n",
|
| 231 |
+
"The OrderedVocab you are attempting to save contains holes for indices [314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, 500, 501, 502, 503, 504, 505, 506, 507, 508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518, 519, 520, 521, 522, 523, 524, 525, 526], your vocabulary could be corrupted !\n",
|
| 232 |
+
"The OrderedVocab you are attempting to save contains holes for indices [314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, 500, 501, 502, 503, 504, 505, 506, 507, 508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518, 519, 520, 521, 522, 523, 524, 525, 526, 527, 528, 529, 530, 531, 532, 533, 534, 535, 536, 537, 538, 539, 540, 541, 542, 543, 544, 545, 546, 547, 548, 549, 550, 551, 552, 553, 554, 555, 556, 557, 558, 559, 560, 561, 562, 563, 564, 565, 566, 567, 568, 569, 570, 571, 572, 573, 574, 575, 576, 577, 578, 579, 580, 581, 582, 583, 584, 585, 586, 587, 588, 589, 590, 591, 592, 593, 594, 595, 596, 597, 598, 599, 600, 601, 602, 603, 604, 605, 606, 607, 608, 609, 610, 611, 612, 613, 614, 615, 616, 617, 618, 619, 620, 621, 622, 623, 624, 625, 626, 627, 628, 629, 630, 631, 632, 633, 634, 635, 636, 637, 638, 639, 640, 641, 642, 643, 644, 645, 646, 647, 648, 649, 650, 651, 652, 653, 654, 655, 656, 657, 658, 659, 660, 661, 662, 663, 664, 665, 666, 667, 668, 669, 670, 671, 672, 673, 674, 675, 676, 677, 678, 679, 680, 681, 682, 683, 684, 685, 686, 687, 688, 689, 690, 691, 692, 693, 694, 695, 696, 697, 698, 699, 700, 701, 702, 703, 704, 705, 706, 707, 708, 709, 710, 711, 712, 713, 714, 715, 716, 717, 718, 719, 720, 721, 722, 723, 724, 725, 726, 727, 728, 729, 730, 731, 732, 733, 734, 735, 736, 737, 738, 739, 740, 741, 742, 743, 744, 745, 746, 747, 748, 749, 750, 751, 752, 753, 754, 755, 756, 757, 758, 759, 760, 761, 762, 763, 764, 765, 766, 767, 768, 769, 770, 771, 772, 773, 774, 775, 776, 777, 778, 779, 780, 781, 782, 783, 784, 785, 786, 787, 788, 789, 790, 791, 792, 793, 794, 795, 796, 797, 798, 799, 800, 801, 802, 803, 804, 805, 806, 807, 808, 809, 810, 811, 812, 813, 814, 815, 816, 817, 818, 819, 820, 821, 822, 823, 824, 825, 826, 827, 828, 829, 830, 831, 832, 833, 834, 835, 836, 837, 838, 839, 840, 841, 842, 843, 844, 845, 846, 847, 848, 849, 850, 851, 852, 853, 854, 855, 856, 857, 858, 859, 860, 861, 862, 863, 864, 865, 866, 867, 868, 869, 870, 871, 872, 873, 874, 875, 876, 877, 878, 879, 880, 881, 882, 883, 884, 885, 886, 887, 888, 889, 890, 891, 892, 893, 894, 895, 896, 897, 898, 899, 900, 901, 902, 903, 904, 905, 906, 907, 908, 909, 910, 911, 912, 913, 914, 915, 916, 917, 918, 919, 920, 921, 922, 923, 924, 925, 926, 927, 928, 929, 930, 931, 932, 933, 934, 935, 936, 937, 938, 939, 940, 941, 942, 943, 944, 945, 946, 947, 948, 949, 950, 951, 952, 953, 954, 955, 956, 957, 958, 959, 960, 961, 962, 963, 964, 965, 966, 967, 968, 969, 970, 971, 972, 973, 974, 975, 976, 977, 978, 979, 980, 981, 982, 983, 984, 985, 986, 987, 988, 989, 990, 991, 992, 993, 994, 995, 996, 997, 998, 999, 1000, 1001, 1002, 1003, 1004, 1005, 1006, 1007, 1008, 1009, 1010, 1011, 1012, 1013, 1014, 1015, 1016, 1017, 1018, 1019, 1020, 1021, 1022, 1023, 1024, 1025, 1026, 1027, 1028, 1029, 1030, 1031, 1032, 1033, 1034, 1035, 1036, 1037, 1038, 1039, 1040, 1041, 1042, 1043, 1044, 1045, 1046, 1047, 1048, 1049, 1050, 1051, 1052, 1053, 1054, 1055, 1056, 1057, 1058, 1059, 1060, 1061, 1062, 1063, 1064, 1065, 1066, 1067, 1068, 1069, 1070, 1071, 1072, 1073, 1074, 1075, 1076, 1077, 1078, 1079, 1080, 1081, 1082, 1083, 1084, 1085, 1086, 1087, 1088, 1089, 1090, 1091, 1092, 1093, 1094, 1095, 1096, 1097, 1098, 1099, 1100, 1101, 1102, 1103, 1104, 1105, 1106, 1107, 1108, 1109, 1110, 1111, 1112, 1113, 1114, 1115, 1116, 1117, 1118, 1119, 1120, 1121, 1122, 1123, 1124, 1125, 1126, 1127, 1128, 1129, 1130, 1131, 1132, 1133, 1134, 1135, 1136, 1137, 1138, 1139, 1140, 1141, 1142, 1143, 1144, 1145, 1146, 1147, 1148, 1149, 1150, 1151, 1152, 1153, 1154, 1155, 1156, 1157, 1158, 1159, 1160, 1161, 1162, 1163, 1164, 1165, 1166, 1167, 1168, 1169, 1170, 1171, 1172, 1173, 1174, 1175, 1176, 1177, 1178, 1179, 1180, 1181, 1182, 1183, 1184, 1185, 1186, 1187, 1188, 1189, 1190, 1191, 1192, 1193, 1194, 1195, 1196, 1197, 1198, 1199, 1200, 1201, 1202, 1203, 1204, 1205, 1206, 1207, 1208, 1209, 1210, 1211, 1212, 1213, 1214, 1215, 1216, 1217, 1218, 1219, 1220, 1221, 1222, 1223, 1224, 1225, 1226, 1227, 1228, 1229, 1230, 1231, 1232, 1233, 1234, 1235, 1236, 1237, 1238, 1239, 1240, 1241, 1242, 1243, 1244, 1245, 1246, 1247, 1248, 1249, 1250, 1251, 1252, 1253, 1254, 1255, 1256, 1257, 1258, 1259, 1260, 1261, 1262, 1263, 1264, 1265, 1266, 1267, 1268, 1269, 1270, 1271, 1272, 1273, 1274, 1275, 1276, 1277, 1278, 1279, 1280, 1281, 1282, 1283, 1284, 1285, 1286, 1287, 1288, 1289, 1290, 1291, 1292, 1293, 1294, 1295, 1296, 1297, 1298, 1299, 1300, 1301, 1302, 1303, 1304, 1305, 1306, 1307, 1308, 1309, 1310, 1311, 1312, 1313, 1314, 1315, 1316, 1317, 1318, 1319, 1320, 1321, 1322, 1323, 1324, 1325, 1326, 1327, 1328, 1329, 1330, 1331, 1332, 1333, 1334, 1335, 1336, 1337, 1338, 1339, 1340, 1341, 1342, 1343, 1344, 1345, 1346, 1347, 1348, 1349, 1350, 1351, 1352, 1353, 1354, 1355, 1356, 1357, 1358, 1359, 1360, 1361, 1362, 1363, 1364, 1365, 1366, 1367, 1368, 1369, 1370, 1371, 1372, 1373, 1374, 1375, 1376, 1377, 1378, 1379, 1380, 1381, 1382, 1383, 1384, 1385, 1386, 1387, 1388, 1389, 1390, 1391, 1392, 1393, 1394, 1395, 1396, 1397, 1398, 1399, 1400, 1401, 1402, 1403, 1404, 1405, 1406, 1407, 1408, 1409, 1410, 1411, 1412, 1413, 1414, 1415, 1416, 1417, 1418, 1419, 1420, 1421, 1422, 1423, 1424, 1425, 1426, 1427, 1428, 1429, 1430, 1431, 1432, 1433, 1434, 1435, 1436, 1437, 1438, 1439, 1440, 1441, 1442, 1443, 1444, 1445, 1446, 1447, 1448, 1449, 1450, 1451, 1452, 1453, 1454, 1455, 1456, 1457, 1458, 1459, 1460, 1461, 1462, 1463, 1464, 1465, 1466, 1467, 1468, 1469, 1470, 1471, 1472, 1473, 1474, 1475, 1476, 1477, 1478, 1479, 1480, 1481, 1482, 1483, 1484, 1485, 1486, 1487, 1488, 1489, 1490, 1491, 1492, 1493, 1494, 1495, 1496, 1497, 1498, 1499, 1500, 1501, 1502, 1503, 1504, 1505, 1506, 1507, 1508, 1509, 1510, 1511, 1512, 1513, 1514, 1515, 1516, 1517, 1518, 1519, 1520, 1521, 1522, 1523, 1524, 1525, 1526, 1527, 1528, 1529, 1530, 1531, 1532, 1533, 1534, 1535, 1536, 1537, 1538, 1539, 1540, 1541, 1542, 1543, 1544, 1545, 1546, 1547, 1548, 1549, 1550, 1551, 1552, 1553, 1554, 1555, 1556, 1557, 1558, 1559, 1560, 1561, 1562, 1563, 1564, 1565, 1566, 1567, 1568, 1569, 1570, 1571, 1572, 1573, 1574, 1575, 1576, 1577, 1578, 1579, 1580, 1581, 1582, 1583, 1584, 1585, 1586, 1587, 1588, 1589, 1590, 1591, 1592, 1593, 1594, 1595, 1596, 1597, 1598, 1599, 1600, 1601, 1602, 1603, 1604, 1605, 1606, 1607, 1608, 1609, 1610, 1611, 1612, 1613, 1614, 1615, 1616, 1617, 1618, 1619, 1620, 1621, 1622, 1623, 1624, 1625, 1626, 1627, 1628, 1629, 1630, 1631, 1632, 1633, 1634, 1635, 1636, 1637, 1638, 1639, 1640, 1641, 1642, 1643, 1644, 1645, 1646, 1647, 1648, 1649, 1650, 1651, 1652, 1653, 1654, 1655, 1656, 1657, 1658, 1659, 1660, 1661, 1662, 1663, 1664, 1665, 1666, 1667, 1668, 1669, 1670, 1671, 1672, 1673, 1674, 1675, 1676, 1677, 1678, 1679, 1680, 1681, 1682, 1683, 1684, 1685, 1686, 1687, 1688, 1689, 1690, 1691, 1692, 1693, 1694, 1695, 1696, 1697, 1698, 1699, 1700, 1701, 1702, 1703, 1704, 1705, 1706, 1707, 1708, 1709, 1710, 1711, 1712, 1713, 1714, 1715, 1716, 1717, 1718, 1719, 1720, 1721, 1722, 1723, 1724, 1725, 1726, 1727, 1728, 1729, 1730, 1731, 1732, 1733, 1734, 1735, 1736, 1737, 1738, 1739, 1740, 1741, 1742, 1743, 1744, 1745, 1746, 1747, 1748, 1749, 1750, 1751, 1752, 1753, 1754, 1755, 1756, 1757, 1758, 1759, 1760, 1761, 1762, 1763, 1764, 1765, 1766, 1767, 1768, 1769, 1770, 1771, 1772, 1773, 1774, 1775, 1776, 1777, 1778, 1779, 1780, 1781, 1782, 1783, 1784, 1785, 1786, 1787, 1788, 1789, 1790, 1791, 1792, 1793, 1794, 1795, 1796, 1797, 1798, 1799, 1800, 1801, 1802, 1803, 1804, 1805, 1806, 1807, 1808, 1809, 1810, 1811, 1812, 1813, 1814, 1815, 1816, 1817, 1818, 1819, 1820, 1821, 1822, 1823, 1824, 1825, 1826, 1827, 1828, 1829, 1830, 1831, 1832, 1833, 1834, 1835, 1836, 1837, 1838, 1839, 1840, 1841, 1842, 1843, 1844, 1845, 1846, 1847, 1848, 1849, 1850, 1851, 1852, 1853, 1854, 1855, 1856, 1857, 1858, 1859, 1860, 1861, 1862, 1863, 1864, 1865, 1866, 1867, 1868, 1869, 1870, 1871, 1872, 1873, 1874, 1875, 1876, 1877, 1878, 1879, 1880, 1881, 1882, 1883, 1884, 1885, 1886, 1887, 1888, 1889, 1890, 1891, 1892, 1893, 1894, 1895, 1896, 1897, 1898, 1899, 1900, 1901, 1902, 1903, 1904, 1905, 1906, 1907, 1908, 1909, 1910, 1911, 1912, 1913, 1914, 1915, 1916, 1917, 1918, 1919, 1920, 1921, 1922, 1923, 1924, 1925, 1926, 1927, 1928, 1929, 1930, 1931, 1932, 1933, 1934, 1935, 1936, 1937, 1938, 1939, 1940, 1941, 1942, 1943, 1944, 1945, 1946, 1947, 1948, 1949, 1950, 1951, 1952, 1953, 1954, 1955, 1956, 1957, 1958, 1959, 1960, 1961, 1962, 1963, 1964, 1965, 1966, 1967, 1968, 1969, 1970, 1971, 1972, 1973, 1974, 1975, 1976, 1977, 1978, 1979, 1980, 1981, 1982, 1983, 1984, 1985, 1986, 1987, 1988, 1989, 1990, 1991, 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018, 2019, 2020, 2021, 2022, 2023, 2024, 2025, 2026, 2027, 2028, 2029, 2030, 2031, 2032, 2033, 2034, 2035, 2036, 2037, 2038, 2039, 2040, 2041, 2042, 2043, 2044, 2045, 2046, 2047, 2048, 2049, 2050, 2051, 2052, 2053, 2054, 2055, 2056, 2057, 2058, 2059, 2060, 2061, 2062, 2063, 2064, 2065, 2066, 2067, 2068, 2069, 2070, 2071, 2072, 2073, 2074, 2075, 2076, 2077, 2078, 2079, 2080, 2081, 2082, 2083, 2084, 2085, 2086, 2087, 2088, 2089, 2090, 2091, 2092, 2093, 2094, 2095, 2096, 2097, 2098, 2099, 2100, 2101, 2102, 2103, 2104, 2105, 2106, 2107, 2108, 2109, 2110, 2111, 2112, 2113, 2114, 2115, 2116, 2117, 2118, 2119, 2120, 2121, 2122, 2123, 2124, 2125, 2126, 2127, 2128, 2129, 2130, 2131, 2132, 2133, 2134, 2135, 2136, 2137, 2138, 2139, 2140, 2141, 2142, 2143, 2144, 2145, 2146, 2147, 2148, 2149, 2150, 2151, 2152, 2153, 2154, 2155, 2156, 2157, 2158, 2159, 2160, 2161, 2162, 2163, 2164, 2165, 2166, 2167, 2168, 2169, 2170, 2171, 2172, 2173, 2174, 2175, 2176, 2177, 2178, 2179, 2180, 2181, 2182, 2183, 2184, 2185, 2186, 2187, 2188, 2189, 2190, 2191, 2192, 2193, 2194, 2195, 2196, 2197, 2198, 2199, 2200, 2201, 2202, 2203, 2204, 2205, 2206, 2207, 2208, 2209, 2210, 2211, 2212, 2213, 2214, 2215, 2216, 2217, 2218, 2219, 2220, 2221, 2222, 2223, 2224, 2225, 2226, 2227, 2228, 2229, 2230, 2231, 2232, 2233, 2234, 2235, 2236, 2237, 2238, 2239, 2240, 2241, 2242, 2243, 2244, 2245, 2246, 2247, 2248, 2249, 2250, 2251, 2252, 2253, 2254, 2255, 2256, 2257, 2258, 2259, 2260, 2261, 2262, 2263, 2264, 2265, 2266, 2267, 2268, 2269, 2270, 2271, 2272, 2273, 2274, 2275, 2276, 2277, 2278, 2279, 2280, 2281, 2282, 2283, 2284, 2285, 2286, 2287, 2288, 2289, 2290, 2291, 2292, 2293, 2294, 2295, 2296, 2297, 2298, 2299, 2300, 2301, 2302, 2303, 2304, 2305, 2306, 2307, 2308, 2309, 2310, 2311, 2312, 2313, 2314, 2315, 2316, 2317, 2318, 2319, 2320, 2321, 2322, 2323, 2324, 2325, 2326, 2327, 2328, 2329, 2330, 2331, 2332, 2333, 2334, 2335, 2336, 2337, 2338, 2339, 2340, 2341, 2342, 2343, 2344, 2345, 2346, 2347, 2348, 2349, 2350, 2351, 2352, 2353, 2354, 2355, 2356, 2357, 2358, 2359, 2360, 2361, 2362, 2363, 2364, 2365, 2366, 2367, 2368, 2369, 2370, 2371, 2372, 2373, 2374, 2375, 2376, 2377, 2378, 2379, 2380, 2381, 2382, 2383, 2384, 2385, 2386, 2387, 2388, 2389, 2390, 2391, 2392, 2393, 2394, 2395, 2396, 2397, 2398, 2399, 2400, 2401, 2402, 2403, 2404, 2405, 2406, 2407, 2408, 2409, 2410, 2411, 2412, 2413, 2414, 2415, 2416, 2417, 2418, 2419, 2420, 2421, 2422, 2423, 2424, 2425, 2426, 2427, 2428, 2429, 2430, 2431, 2432, 2433, 2434, 2435, 2436, 2437, 2438, 2439, 2440, 2441, 2442, 2443, 2444, 2445, 2446, 2447, 2448, 2449, 2450, 2451, 2452, 2453, 2454, 2455, 2456, 2457, 2458, 2459, 2460, 2461, 2462, 2463, 2464, 2465, 2466, 2467, 2468, 2469, 2470, 2471, 2472, 2473, 2474, 2475, 2476, 2477, 2478, 2479, 2480, 2481, 2482, 2483, 2484, 2485, 2486, 2487, 2488, 2489, 2490, 2491, 2492, 2493, 2494, 2495, 2496, 2497, 2498, 2499, 2500, 2501, 2502, 2503, 2504, 2505, 2506, 2507, 2508, 2509, 2510, 2511, 2512, 2513, 2514, 2515, 2516, 2517, 2518, 2519, 2520, 2521, 2522, 2523, 2524, 2525, 2526, 2527, 2528, 2529, 2530, 2531, 2532, 2533, 2534, 2535, 2536, 2537, 2538, 2539, 2540, 2541, 2542, 2543, 2544, 2545, 2546, 2547, 2548, 2549, 2550, 2551, 2552, 2553, 2554, 2555, 2556, 2557, 2558, 2559, 2560, 2561, 2562, 2563, 2564, 2565, 2566, 2567, 2568, 2569, 2570, 2571, 2572, 2573, 2574, 2575, 2576, 2577, 2578, 2579, 2580, 2581, 2582, 2583, 2584, 2585, 2586, 2587, 2588, 2589, 2590, 2591, 2592, 2593, 2594, 2595, 2596, 2597, 2598, 2599, 2600, 2601, 2602, 2603, 2604, 2605, 2606, 2607, 2608, 2609, 2610, 2611, 2612, 2613, 2614, 2615, 2616, 2617, 2618, 2619, 2620, 2621, 2622, 2623, 2624, 2625, 2626, 2627, 2628, 2629, 2630, 2631, 2632, 2633, 2634, 2635, 2636, 2637, 2638, 2639, 2640, 2641, 2642, 2643, 2644, 2645, 2646, 2647, 2648, 2649, 2650, 2651, 2652, 2653, 2654, 2655, 2656, 2657, 2658, 2659, 2660, 2661, 2662, 2663, 2664, 2665, 2666, 2667, 2668, 2669, 2670, 2671, 2672, 2673, 2674, 2675, 2676, 2677, 2678, 2679, 2680, 2681, 2682, 2683, 2684, 2685, 2686, 2687, 2688, 2689, 2690, 2691, 2692, 2693, 2694, 2695, 2696, 2697, 2698, 2699, 2700, 2701, 2702, 2703, 2704, 2705, 2706, 2707, 2708, 2709, 2710, 2711, 2712, 2713, 2714, 2715, 2716, 2717, 2718, 2719, 2720, 2721, 2722, 2723, 2724, 2725, 2726, 2727, 2728, 2729, 2730, 2731, 2732, 2733, 2734, 2735, 2736, 2737, 2738, 2739, 2740, 2741, 2742, 2743, 2744, 2745, 2746, 2747, 2748, 2749, 2750, 2751, 2752, 2753, 2754, 2755, 2756, 2757, 2758, 2759, 2760, 2761, 2762, 2763, 2764, 2765, 2766, 2767, 2768, 2769, 2770, 2771, 2772, 2773, 2774, 2775, 2776, 2777, 2778, 2779, 2780, 2781, 2782, 2783, 2784, 2785, 2786, 2787, 2788, 2789, 2790, 2791, 2792, 2793, 2794, 2795, 2796, 2797, 2798, 2799, 2800, 2801, 2802, 2803, 2804, 2805, 2806, 2807, 2808, 2809, 2810, 2811, 2812, 2813, 2814, 2815, 2816, 2817, 2818, 2819, 2820, 2821, 2822, 2823, 2824, 2825, 2826, 2827, 2828, 2829, 2830, 2831, 2832, 2833, 2834, 2835, 2836, 2837, 2838, 2839, 2840, 2841, 2842, 2843, 2844, 2845, 2846, 2847, 2848, 2849, 2850, 2851, 2852, 2853, 2854, 2855, 2856, 2857, 2858, 2859, 2860, 2861, 2862, 2863, 2864, 2865, 2866, 2867, 2868, 2869, 2870, 2871, 2872, 2873, 2874, 2875, 2876, 2877, 2878, 2879, 2880, 2881, 2882, 2883, 2884, 2885, 2886, 2887, 2888, 2889, 2890, 2891, 2892, 2893, 2894, 2895, 2896, 2897, 2898, 2899, 2900, 2901, 2902, 2903, 2904, 2905, 2906, 2907, 2908, 2909, 2910, 2911, 2912, 2913, 2914, 2915, 2916, 2917, 2918, 2919, 2920, 2921, 2922, 2923, 2924, 2925, 2926, 2927, 2928, 2929, 2930, 2931, 2932, 2933, 2934, 2935, 2936, 2937, 2938, 2939, 2940, 2941, 2942, 2943, 2944, 2945, 2946, 2947, 2948, 2949, 2950, 2951, 2952, 2953, 2954, 2955, 2956, 2957, 2958, 2959, 2960, 2961, 2962, 2963, 2964, 2965, 2966, 2967, 2968, 2969, 2970, 2971, 2972, 2973, 2974, 2975, 2976, 2977, 2978, 2979, 2980, 2981, 2982, 2983, 2984, 2985, 2986, 2987, 2988, 2989, 2990, 2991, 2992, 2993, 2994, 2995, 2996, 2997, 2998, 2999, 3000, 3001, 3002, 3003, 3004, 3005, 3006, 3007, 3008, 3009, 3010, 3011, 3012, 3013, 3014, 3015, 3016, 3017, 3018, 3019, 3020, 3021, 3022, 3023, 3024, 3025, 3026, 3027, 3028, 3029, 3030, 3031, 3032, 3033, 3034, 3035, 3036, 3037, 3038, 3039, 3040, 3041, 3042, 3043, 3044, 3045, 3046, 3047, 3048, 3049, 3050, 3051, 3052, 3053, 3054, 3055, 3056, 3057, 3058, 3059, 3060, 3061, 3062, 3063, 3064, 3065, 3066, 3067, 3068, 3069, 3070, 3071, 3072, 3073, 3074, 3075, 3076, 3077, 3078, 3079, 3080, 3081, 3082, 3083, 3084, 3085, 3086, 3087, 3088, 3089, 3090, 3091, 3092, 3093, 3094, 3095, 3096, 3097, 3098, 3099, 3100, 3101, 3102, 3103, 3104, 3105, 3106, 3107, 3108, 3109, 3110, 3111, 3112, 3113, 3114, 3115, 3116, 3117, 3118, 3119, 3120, 3121, 3122, 3123, 3124, 3125, 3126, 3127, 3128, 3129, 3130, 3131, 3132, 3133, 3134, 3135, 3136, 3137, 3138, 3139, 3140, 3141, 3142, 3143, 3144, 3145, 3146, 3147, 3148, 3149, 3150, 3151, 3152, 3153, 3154, 3155, 3156, 3157, 3158, 3159, 3160, 3161, 3162, 3163, 3164, 3165, 3166, 3167, 3168, 3169, 3170, 3171, 3172, 3173, 3174, 3175, 3176, 3177, 3178, 3179, 3180, 3181, 3182, 3183, 3184, 3185, 3186, 3187, 3188, 3189, 3190, 3191, 3192, 3193, 3194, 3195, 3196, 3197, 3198, 3199, 3200, 3201, 3202, 3203, 3204, 3205, 3206, 3207, 3208, 3209, 3210, 3211, 3212, 3213, 3214, 3215, 3216, 3217, 3218, 3219, 3220, 3221, 3222, 3223, 3224, 3225, 3226, 3227, 3228, 3229, 3230, 3231, 3232, 3233, 3234, 3235, 3236, 3237, 3238, 3239, 3240, 3241, 3242, 3243, 3244, 3245, 3246, 3247, 3248, 3249, 3250, 3251, 3252, 3253, 3254, 3255, 3256, 3257, 3258, 3259, 3260, 3261, 3262, 3263, 3264, 3265, 3266, 3267, 3268, 3269, 3270, 3271, 3272, 3273, 3274, 3275, 3276, 3277, 3278, 3279, 3280, 3281, 3282, 3283, 3284, 3285, 3286, 3287, 3288, 3289, 3290, 3291, 3292, 3293, 3294, 3295, 3296, 3297, 3298, 3299, 3300, 3301, 3302, 3303, 3304, 3305, 3306, 3307, 3308, 3309, 3310, 3311, 3312, 3313, 3314, 3315, 3316, 3317, 3318, 3319, 3320, 3321, 3322, 3323, 3324, 3325, 3326, 3327, 3328, 3329, 3330, 3331, 3332, 3333, 3334, 3335, 3336, 3337, 3338, 3339, 3340, 3341, 3342, 3343, 3344, 3345, 3346, 3347, 3348, 3349, 3350, 3351, 3352, 3353, 3354, 3355, 3356, 3357, 3358, 3359, 3360, 3361, 3362, 3363, 3364, 3365, 3366, 3367, 3368, 3369, 3370, 3371, 3372, 3373, 3374, 3375, 3376, 3377, 3378, 3379, 3380, 3381, 3382, 3383, 3384, 3385, 3386, 3387, 3388, 3389, 3390, 3391, 3392, 3393, 3394, 3395, 3396, 3397, 3398, 3399, 3400, 3401, 3402, 3403, 3404, 3405, 3406, 3407, 3408, 3409, 3410, 3411, 3412, 3413, 3414, 3415, 3416, 3417, 3418, 3419, 3420, 3421, 3422, 3423, 3424, 3425, 3426, 3427, 3428, 3429, 3430, 3431, 3432, 3433, 3434, 3435, 3436, 3437, 3438, 3439, 3440, 3441, 3442, 3443, 3444, 3445, 3446, 3447, 3448, 3449, 3450, 3451, 3452, 3453, 3454, 3455, 3456, 3457, 3458, 3459, 3460, 3461, 3462, 3463, 3464, 3465, 3466, 3467, 3468, 3469, 3470, 3471, 3472, 3473, 3474, 3475, 3476, 3477, 3478, 3479, 3480, 3481, 3482, 3483, 3484, 3485, 3486, 3487, 3488, 3489, 3490, 3491, 3492, 3493, 3494, 3495, 3496, 3497, 3498, 3499, 3500, 3501, 3502, 3503, 3504, 3505, 3506, 3507, 3508, 3509, 3510, 3511, 3512, 3513, 3514, 3515, 3516, 3517, 3518, 3519, 3520, 3521], your vocabulary could be corrupted !\n",
|
| 233 |
+
"The OrderedVocab you are attempting to save contains holes for indices [314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, 500, 501, 502, 503, 504, 505, 506, 507, 508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518, 519, 520, 521, 522, 523, 524, 525, 526, 527, 528, 529, 530, 531, 532, 533, 534, 535, 536, 537, 538, 539, 540, 541, 542, 543, 544, 545, 546, 547, 548, 549, 550, 551, 552, 553, 554, 555, 556, 557, 558, 559, 560, 561, 562, 563, 564, 565, 566, 567, 568, 569, 570, 571, 572, 573, 574, 575, 576, 577, 578, 579, 580, 581, 582, 583, 584, 585, 586, 587, 588, 589, 590, 591, 592, 593, 594, 595, 596, 597, 598, 599, 600, 601, 602, 603, 604, 605, 606, 607, 608, 609, 610, 611, 612, 613, 614, 615, 616, 617, 618, 619, 620, 621, 622, 623, 624, 625, 626, 627, 628, 629, 630, 631, 632, 633, 634, 635, 636, 637, 638, 639, 640, 641, 642, 643, 644, 645, 646, 647, 648, 649, 650, 651, 652, 653, 654, 655, 656, 657, 658, 659, 660, 661, 662, 663, 664, 665, 666, 667, 668, 669, 670, 671, 672, 673, 674, 675, 676, 677, 678, 679, 680, 681, 682, 683, 684, 685, 686, 687, 688, 689, 690, 691, 692, 693, 694, 695, 696, 697, 698, 699, 700, 701, 702, 703, 704, 705, 706, 707, 708, 709, 710, 711, 712, 713, 714, 715, 716, 717, 718, 719, 720, 721, 722, 723, 724, 725, 726, 727, 728, 729, 730, 731, 732, 733, 734, 735, 736, 737, 738, 739, 740, 741, 742, 743, 744, 745, 746, 747, 748, 749, 750, 751, 752, 753, 754, 755, 756, 757, 758, 759, 760, 761, 762, 763, 764, 765, 766, 767, 768, 769, 770, 771, 772, 773, 774, 775, 776, 777, 778, 779, 780, 781, 782, 783, 784, 785, 786, 787, 788, 789, 790, 791, 792, 793, 794, 795, 796, 797, 798, 799, 800, 801, 802, 803, 804, 805, 806, 807, 808, 809, 810, 811, 812, 813, 814, 815, 816, 817, 818, 819, 820, 821, 822, 823, 824, 825, 826, 827, 828, 829, 830, 831, 832, 833, 834, 835, 836, 837, 838, 839, 840, 841, 842, 843, 844, 845, 846, 847, 848, 849, 850, 851, 852, 853, 854, 855, 856, 857, 858, 859, 860, 861, 862, 863, 864, 865, 866, 867, 868, 869, 870, 871, 872, 873, 874, 875, 876, 877, 878, 879, 880, 881, 882, 883, 884, 885, 886, 887, 888, 889, 890, 891, 892, 893, 894, 895, 896, 897, 898, 899, 900, 901, 902, 903, 904, 905, 906, 907, 908, 909, 910, 911, 912, 913, 914, 915, 916, 917, 918, 919, 920, 921, 922, 923, 924, 925, 926, 927, 928, 929, 930, 931, 932, 933, 934, 935, 936, 937, 938, 939, 940, 941, 942, 943, 944, 945, 946, 947, 948, 949, 950, 951, 952, 953, 954, 955, 956, 957, 958, 959, 960, 961, 962, 963, 964, 965, 966, 967, 968, 969, 970, 971, 972, 973, 974, 975, 976, 977, 978, 979, 980, 981, 982, 983, 984, 985, 986, 987, 988, 989, 990, 991, 992, 993, 994, 995, 996, 997, 998, 999, 1000, 1001, 1002, 1003, 1004, 1005, 1006, 1007, 1008, 1009, 1010, 1011, 1012, 1013, 1014, 1015, 1016, 1017, 1018, 1019, 1020, 1021, 1022, 1023, 1024, 1025, 1026, 1027, 1028, 1029, 1030, 1031, 1032, 1033, 1034, 1035, 1036, 1037, 1038, 1039, 1040, 1041, 1042, 1043, 1044, 1045, 1046, 1047, 1048, 1049, 1050, 1051, 1052, 1053, 1054, 1055, 1056, 1057, 1058, 1059, 1060, 1061, 1062, 1063, 1064, 1065, 1066, 1067, 1068, 1069, 1070, 1071, 1072, 1073, 1074, 1075, 1076, 1077, 1078, 1079, 1080, 1081, 1082, 1083, 1084, 1085, 1086, 1087, 1088, 1089, 1090, 1091, 1092, 1093, 1094, 1095, 1096, 1097, 1098, 1099, 1100, 1101, 1102, 1103, 1104, 1105, 1106, 1107, 1108, 1109, 1110, 1111, 1112, 1113, 1114, 1115, 1116, 1117, 1118, 1119, 1120, 1121, 1122, 1123, 1124, 1125, 1126, 1127, 1128, 1129, 1130, 1131, 1132, 1133, 1134, 1135, 1136, 1137, 1138, 1139, 1140, 1141, 1142, 1143, 1144, 1145, 1146, 1147, 1148, 1149, 1150, 1151, 1152, 1153, 1154, 1155, 1156, 1157, 1158, 1159, 1160, 1161, 1162, 1163, 1164, 1165, 1166, 1167, 1168, 1169, 1170, 1171, 1172, 1173, 1174, 1175, 1176, 1177, 1178, 1179, 1180, 1181, 1182, 1183, 1184, 1185, 1186, 1187, 1188, 1189, 1190, 1191, 1192, 1193, 1194, 1195, 1196, 1197, 1198, 1199, 1200, 1201, 1202, 1203, 1204, 1205, 1206, 1207, 1208, 1209, 1210, 1211, 1212, 1213, 1214, 1215, 1216, 1217, 1218, 1219, 1220, 1221, 1222, 1223, 1224, 1225, 1226, 1227, 1228, 1229, 1230, 1231, 1232, 1233, 1234, 1235, 1236, 1237, 1238, 1239, 1240, 1241, 1242, 1243, 1244, 1245, 1246, 1247, 1248, 1249, 1250, 1251, 1252, 1253, 1254, 1255, 1256, 1257, 1258, 1259, 1260, 1261, 1262, 1263, 1264, 1265, 1266, 1267, 1268, 1269, 1270, 1271, 1272, 1273, 1274, 1275, 1276, 1277, 1278, 1279, 1280, 1281, 1282, 1283, 1284, 1285, 1286, 1287, 1288, 1289, 1290, 1291, 1292, 1293, 1294, 1295, 1296, 1297, 1298, 1299, 1300, 1301, 1302, 1303, 1304, 1305, 1306, 1307, 1308, 1309, 1310, 1311, 1312, 1313, 1314, 1315, 1316, 1317, 1318, 1319, 1320, 1321, 1322, 1323, 1324, 1325, 1326, 1327, 1328, 1329, 1330, 1331, 1332, 1333, 1334, 1335, 1336, 1337, 1338, 1339, 1340, 1341, 1342, 1343, 1344, 1345, 1346, 1347, 1348, 1349, 1350, 1351, 1352, 1353, 1354, 1355, 1356, 1357, 1358, 1359, 1360, 1361, 1362, 1363, 1364, 1365, 1366, 1367, 1368, 1369, 1370, 1371, 1372, 1373, 1374, 1375, 1376, 1377, 1378, 1379, 1380, 1381, 1382, 1383, 1384, 1385, 1386, 1387, 1388, 1389, 1390, 1391, 1392, 1393, 1394, 1395, 1396, 1397, 1398, 1399, 1400, 1401, 1402, 1403, 1404, 1405, 1406, 1407, 1408, 1409, 1410, 1411, 1412, 1413, 1414, 1415, 1416, 1417, 1418, 1419, 1420, 1421, 1422, 1423, 1424, 1425, 1426, 1427, 1428, 1429, 1430, 1431, 1432, 1433, 1434, 1435, 1436, 1437, 1438, 1439, 1440, 1441, 1442, 1443, 1444, 1445, 1446, 1447, 1448, 1449, 1450, 1451, 1452, 1453, 1454, 1455, 1456, 1457, 1458, 1459, 1460, 1461, 1462, 1463, 1464, 1465, 1466, 1467, 1468, 1469, 1470, 1471, 1472, 1473, 1474, 1475, 1476, 1477, 1478, 1479, 1480, 1481, 1482, 1483, 1484, 1485, 1486, 1487, 1488, 1489, 1490, 1491, 1492, 1493, 1494, 1495, 1496, 1497, 1498, 1499, 1500, 1501, 1502, 1503, 1504, 1505, 1506, 1507, 1508, 1509, 1510, 1511, 1512, 1513, 1514, 1515, 1516, 1517, 1518, 1519, 1520, 1521, 1522, 1523, 1524, 1525, 1526, 1527, 1528, 1529, 1530, 1531, 1532, 1533, 1534, 1535, 1536, 1537, 1538, 1539, 1540, 1541, 1542, 1543, 1544, 1545, 1546, 1547, 1548, 1549, 1550, 1551, 1552, 1553, 1554, 1555, 1556, 1557, 1558, 1559, 1560, 1561, 1562, 1563, 1564, 1565, 1566, 1567, 1568, 1569, 1570, 1571, 1572, 1573, 1574, 1575, 1576, 1577, 1578, 1579, 1580, 1581, 1582, 1583, 1584, 1585, 1586, 1587, 1588, 1589, 1590, 1591, 1592, 1593, 1594, 1595, 1596, 1597, 1598, 1599, 1600, 1601, 1602, 1603, 1604, 1605, 1606, 1607, 1608, 1609, 1610, 1611, 1612, 1613, 1614, 1615, 1616, 1617, 1618, 1619, 1620, 1621, 1622, 1623, 1624, 1625, 1626, 1627, 1628, 1629, 1630, 1631, 1632, 1633, 1634, 1635, 1636, 1637, 1638, 1639, 1640, 1641, 1642, 1643, 1644, 1645, 1646, 1647, 1648, 1649, 1650, 1651, 1652, 1653, 1654, 1655, 1656, 1657, 1658, 1659, 1660, 1661, 1662, 1663, 1664, 1665, 1666, 1667, 1668, 1669, 1670, 1671, 1672, 1673, 1674, 1675, 1676, 1677, 1678, 1679, 1680, 1681, 1682, 1683, 1684, 1685, 1686, 1687, 1688, 1689, 1690, 1691, 1692, 1693, 1694, 1695, 1696, 1697, 1698, 1699, 1700, 1701, 1702, 1703, 1704, 1705, 1706, 1707, 1708, 1709, 1710, 1711, 1712, 1713, 1714, 1715, 1716, 1717, 1718, 1719, 1720, 1721, 1722, 1723, 1724, 1725, 1726, 1727, 1728, 1729, 1730, 1731, 1732, 1733, 1734, 1735, 1736, 1737, 1738, 1739, 1740, 1741, 1742, 1743, 1744, 1745, 1746, 1747, 1748, 1749, 1750, 1751, 1752, 1753, 1754, 1755, 1756, 1757, 1758, 1759, 1760, 1761, 1762, 1763, 1764, 1765, 1766, 1767, 1768, 1769, 1770, 1771, 1772, 1773, 1774, 1775, 1776, 1777, 1778, 1779, 1780, 1781, 1782, 1783, 1784, 1785, 1786, 1787, 1788, 1789, 1790, 1791, 1792, 1793, 1794, 1795, 1796, 1797, 1798, 1799, 1800, 1801, 1802, 1803, 1804, 1805, 1806, 1807, 1808, 1809, 1810, 1811, 1812, 1813, 1814, 1815, 1816, 1817, 1818, 1819, 1820, 1821, 1822, 1823, 1824, 1825, 1826, 1827, 1828, 1829, 1830, 1831, 1832, 1833, 1834, 1835, 1836, 1837, 1838, 1839, 1840, 1841, 1842, 1843, 1844, 1845, 1846, 1847, 1848, 1849, 1850, 1851, 1852, 1853, 1854, 1855, 1856, 1857, 1858, 1859, 1860, 1861, 1862, 1863, 1864, 1865, 1866, 1867, 1868, 1869, 1870, 1871, 1872, 1873, 1874, 1875, 1876, 1877, 1878, 1879, 1880, 1881, 1882, 1883, 1884, 1885, 1886, 1887, 1888, 1889, 1890, 1891, 1892, 1893, 1894, 1895, 1896, 1897, 1898, 1899, 1900, 1901, 1902, 1903, 1904, 1905, 1906, 1907, 1908, 1909, 1910, 1911, 1912, 1913, 1914, 1915, 1916, 1917, 1918, 1919, 1920, 1921, 1922, 1923, 1924, 1925, 1926, 1927, 1928, 1929, 1930, 1931, 1932, 1933, 1934, 1935, 1936, 1937, 1938, 1939, 1940, 1941, 1942, 1943, 1944, 1945, 1946, 1947, 1948, 1949, 1950, 1951, 1952, 1953, 1954, 1955, 1956, 1957, 1958, 1959, 1960, 1961, 1962, 1963, 1964, 1965, 1966, 1967, 1968, 1969, 1970, 1971, 1972, 1973, 1974, 1975, 1976, 1977, 1978, 1979, 1980, 1981, 1982, 1983, 1984, 1985, 1986, 1987, 1988, 1989, 1990, 1991, 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018, 2019, 2020, 2021, 2022, 2023, 2024, 2025, 2026, 2027, 2028, 2029, 2030, 2031, 2032, 2033, 2034, 2035, 2036, 2037, 2038, 2039, 2040, 2041, 2042, 2043, 2044, 2045, 2046, 2047, 2048, 2049, 2050, 2051, 2052, 2053, 2054, 2055, 2056, 2057, 2058, 2059, 2060, 2061, 2062, 2063, 2064, 2065, 2066, 2067, 2068, 2069, 2070, 2071, 2072, 2073, 2074, 2075, 2076, 2077, 2078, 2079, 2080, 2081, 2082, 2083, 2084, 2085, 2086, 2087, 2088, 2089, 2090, 2091, 2092, 2093, 2094, 2095, 2096, 2097, 2098, 2099, 2100, 2101, 2102, 2103, 2104, 2105, 2106, 2107, 2108, 2109, 2110, 2111, 2112, 2113, 2114, 2115, 2116, 2117, 2118, 2119, 2120, 2121, 2122, 2123, 2124, 2125, 2126, 2127, 2128, 2129, 2130, 2131, 2132, 2133, 2134, 2135, 2136, 2137, 2138, 2139, 2140, 2141, 2142, 2143, 2144, 2145, 2146, 2147, 2148, 2149, 2150, 2151, 2152, 2153, 2154, 2155, 2156, 2157, 2158, 2159, 2160, 2161, 2162, 2163, 2164, 2165, 2166, 2167, 2168, 2169, 2170, 2171, 2172, 2173, 2174, 2175, 2176, 2177, 2178, 2179, 2180, 2181, 2182, 2183, 2184, 2185, 2186, 2187, 2188, 2189, 2190, 2191, 2192, 2193, 2194, 2195, 2196, 2197, 2198, 2199, 2200, 2201, 2202, 2203, 2204, 2205, 2206, 2207, 2208, 2209, 2210, 2211, 2212, 2213, 2214, 2215, 2216, 2217, 2218, 2219, 2220, 2221, 2222, 2223, 2224, 2225, 2226, 2227, 2228, 2229, 2230, 2231, 2232, 2233, 2234, 2235, 2236, 2237, 2238, 2239, 2240, 2241, 2242, 2243, 2244, 2245, 2246, 2247, 2248, 2249, 2250, 2251, 2252, 2253, 2254, 2255, 2256, 2257, 2258, 2259, 2260, 2261, 2262, 2263, 2264, 2265, 2266, 2267, 2268, 2269, 2270, 2271, 2272, 2273, 2274, 2275, 2276, 2277, 2278, 2279, 2280, 2281, 2282, 2283, 2284, 2285, 2286, 2287, 2288, 2289, 2290, 2291, 2292, 2293, 2294, 2295, 2296, 2297, 2298, 2299, 2300, 2301, 2302, 2303, 2304, 2305, 2306, 2307, 2308, 2309, 2310, 2311, 2312, 2313, 2314, 2315, 2316, 2317, 2318, 2319, 2320, 2321, 2322, 2323, 2324, 2325, 2326, 2327, 2328, 2329, 2330, 2331, 2332, 2333, 2334, 2335, 2336, 2337, 2338, 2339, 2340, 2341, 2342, 2343, 2344, 2345, 2346, 2347, 2348, 2349, 2350, 2351, 2352, 2353, 2354, 2355, 2356, 2357, 2358, 2359, 2360, 2361, 2362, 2363, 2364, 2365, 2366, 2367, 2368, 2369, 2370, 2371, 2372, 2373, 2374, 2375, 2376, 2377, 2378, 2379, 2380, 2381, 2382, 2383, 2384, 2385, 2386, 2387, 2388, 2389, 2390, 2391, 2392, 2393, 2394, 2395, 2396, 2397, 2398, 2399, 2400, 2401, 2402, 2403, 2404, 2405, 2406, 2407, 2408, 2409, 2410, 2411, 2412, 2413, 2414, 2415, 2416, 2417, 2418, 2419, 2420, 2421, 2422, 2423, 2424, 2425, 2426, 2427, 2428, 2429, 2430, 2431, 2432, 2433, 2434, 2435, 2436, 2437, 2438, 2439, 2440, 2441, 2442, 2443, 2444, 2445, 2446, 2447, 2448, 2449, 2450, 2451, 2452, 2453, 2454, 2455, 2456, 2457, 2458, 2459, 2460, 2461, 2462, 2463, 2464, 2465, 2466, 2467, 2468, 2469, 2470, 2471, 2472, 2473, 2474, 2475, 2476, 2477, 2478, 2479, 2480, 2481, 2482, 2483, 2484, 2485, 2486, 2487, 2488, 2489, 2490, 2491, 2492, 2493, 2494, 2495, 2496, 2497, 2498, 2499, 2500, 2501, 2502, 2503, 2504, 2505, 2506, 2507, 2508, 2509, 2510, 2511, 2512, 2513, 2514, 2515, 2516, 2517, 2518, 2519, 2520, 2521, 2522, 2523, 2524, 2525, 2526, 2527, 2528, 2529, 2530, 2531, 2532, 2533, 2534, 2535, 2536, 2537, 2538, 2539, 2540, 2541, 2542, 2543, 2544, 2545, 2546, 2547, 2548, 2549, 2550, 2551, 2552, 2553, 2554, 2555, 2556, 2557, 2558, 2559, 2560, 2561, 2562, 2563, 2564, 2565, 2566, 2567, 2568, 2569, 2570, 2571, 2572, 2573, 2574, 2575, 2576, 2577, 2578, 2579, 2580, 2581, 2582, 2583, 2584, 2585, 2586, 2587, 2588, 2589, 2590, 2591, 2592, 2593, 2594, 2595, 2596, 2597, 2598, 2599, 2600, 2601, 2602, 2603, 2604, 2605, 2606, 2607, 2608, 2609, 2610, 2611, 2612, 2613, 2614, 2615, 2616, 2617, 2618, 2619, 2620, 2621, 2622, 2623, 2624, 2625, 2626, 2627, 2628, 2629, 2630, 2631, 2632, 2633, 2634, 2635, 2636, 2637, 2638, 2639, 2640, 2641, 2642, 2643, 2644, 2645, 2646, 2647, 2648, 2649, 2650, 2651, 2652, 2653, 2654, 2655, 2656, 2657, 2658, 2659, 2660, 2661, 2662, 2663, 2664, 2665, 2666, 2667, 2668, 2669, 2670, 2671, 2672, 2673, 2674, 2675, 2676, 2677, 2678, 2679, 2680, 2681, 2682, 2683, 2684, 2685, 2686, 2687, 2688, 2689, 2690, 2691, 2692, 2693, 2694, 2695, 2696, 2697, 2698, 2699, 2700, 2701, 2702, 2703, 2704, 2705, 2706, 2707, 2708, 2709, 2710, 2711, 2712, 2713, 2714, 2715, 2716, 2717, 2718, 2719, 2720, 2721, 2722, 2723, 2724, 2725, 2726, 2727, 2728, 2729, 2730, 2731, 2732, 2733, 2734, 2735, 2736, 2737, 2738, 2739, 2740, 2741, 2742, 2743, 2744, 2745, 2746, 2747, 2748, 2749, 2750, 2751, 2752, 2753, 2754, 2755, 2756, 2757, 2758, 2759, 2760, 2761, 2762, 2763, 2764, 2765, 2766, 2767, 2768, 2769, 2770, 2771, 2772, 2773, 2774, 2775, 2776, 2777, 2778, 2779, 2780, 2781, 2782, 2783, 2784, 2785, 2786, 2787, 2788, 2789, 2790, 2791, 2792, 2793, 2794, 2795, 2796, 2797, 2798, 2799, 2800, 2801, 2802, 2803, 2804, 2805, 2806, 2807, 2808, 2809, 2810, 2811, 2812, 2813, 2814, 2815, 2816, 2817, 2818, 2819, 2820, 2821, 2822, 2823, 2824, 2825, 2826, 2827, 2828, 2829, 2830, 2831, 2832, 2833, 2834, 2835, 2836, 2837, 2838, 2839, 2840, 2841, 2842, 2843, 2844, 2845, 2846, 2847, 2848, 2849, 2850, 2851, 2852, 2853, 2854, 2855, 2856, 2857, 2858, 2859, 2860, 2861, 2862, 2863, 2864, 2865, 2866, 2867, 2868, 2869, 2870, 2871, 2872, 2873, 2874, 2875, 2876, 2877, 2878, 2879, 2880, 2881, 2882, 2883, 2884, 2885, 2886, 2887, 2888, 2889, 2890, 2891, 2892, 2893, 2894, 2895, 2896, 2897, 2898, 2899, 2900, 2901, 2902, 2903, 2904, 2905, 2906, 2907, 2908, 2909, 2910, 2911, 2912, 2913, 2914, 2915, 2916, 2917, 2918, 2919, 2920, 2921, 2922, 2923, 2924, 2925, 2926, 2927, 2928, 2929, 2930, 2931, 2932, 2933, 2934, 2935, 2936, 2937, 2938, 2939, 2940, 2941, 2942, 2943, 2944, 2945, 2946, 2947, 2948, 2949, 2950, 2951, 2952, 2953, 2954, 2955, 2956, 2957, 2958, 2959, 2960, 2961, 2962, 2963, 2964, 2965, 2966, 2967, 2968, 2969, 2970, 2971, 2972, 2973, 2974, 2975, 2976, 2977, 2978, 2979, 2980, 2981, 2982, 2983, 2984, 2985, 2986, 2987, 2988, 2989, 2990, 2991, 2992, 2993, 2994, 2995, 2996, 2997, 2998, 2999, 3000, 3001, 3002, 3003, 3004, 3005, 3006, 3007, 3008, 3009, 3010, 3011, 3012, 3013, 3014, 3015, 3016, 3017, 3018, 3019, 3020, 3021, 3022, 3023, 3024, 3025, 3026, 3027, 3028, 3029, 3030, 3031, 3032, 3033, 3034, 3035, 3036, 3037, 3038, 3039, 3040, 3041, 3042, 3043, 3044, 3045, 3046, 3047, 3048, 3049, 3050, 3051, 3052, 3053, 3054, 3055, 3056, 3057, 3058, 3059, 3060, 3061, 3062, 3063, 3064, 3065, 3066, 3067, 3068, 3069, 3070, 3071, 3072, 3073, 3074, 3075, 3076, 3077, 3078, 3079, 3080, 3081, 3082, 3083, 3084, 3085, 3086, 3087, 3088, 3089, 3090, 3091, 3092, 3093, 3094, 3095, 3096, 3097, 3098, 3099, 3100, 3101, 3102, 3103, 3104, 3105, 3106, 3107, 3108, 3109, 3110, 3111, 3112, 3113, 3114, 3115, 3116, 3117, 3118, 3119, 3120, 3121, 3122, 3123, 3124, 3125, 3126, 3127, 3128, 3129, 3130, 3131, 3132, 3133, 3134, 3135, 3136, 3137, 3138, 3139, 3140, 3141, 3142, 3143, 3144, 3145, 3146, 3147, 3148, 3149, 3150, 3151, 3152, 3153, 3154, 3155, 3156, 3157, 3158, 3159, 3160, 3161, 3162, 3163, 3164, 3165, 3166, 3167, 3168, 3169, 3170, 3171, 3172, 3173, 3174, 3175, 3176, 3177, 3178, 3179, 3180, 3181, 3182, 3183, 3184, 3185, 3186, 3187, 3188, 3189, 3190, 3191, 3192, 3193, 3194, 3195, 3196, 3197, 3198, 3199, 3200, 3201, 3202, 3203, 3204, 3205, 3206, 3207, 3208, 3209, 3210, 3211, 3212, 3213, 3214, 3215, 3216, 3217, 3218, 3219, 3220, 3221, 3222, 3223, 3224, 3225, 3226, 3227, 3228, 3229, 3230, 3231, 3232, 3233, 3234, 3235, 3236, 3237, 3238, 3239, 3240, 3241, 3242, 3243, 3244, 3245, 3246, 3247, 3248, 3249, 3250, 3251, 3252, 3253, 3254, 3255, 3256, 3257, 3258, 3259, 3260, 3261, 3262, 3263, 3264, 3265, 3266, 3267, 3268, 3269, 3270, 3271, 3272, 3273, 3274, 3275, 3276, 3277, 3278, 3279, 3280, 3281, 3282, 3283, 3284, 3285, 3286, 3287, 3288, 3289, 3290, 3291, 3292, 3293, 3294, 3295, 3296, 3297, 3298, 3299, 3300, 3301, 3302, 3303, 3304, 3305, 3306, 3307, 3308, 3309, 3310, 3311, 3312, 3313, 3314, 3315, 3316, 3317, 3318, 3319, 3320, 3321, 3322, 3323, 3324, 3325, 3326, 3327, 3328, 3329, 3330, 3331, 3332, 3333, 3334, 3335, 3336, 3337, 3338, 3339, 3340, 3341, 3342, 3343, 3344, 3345, 3346, 3347, 3348, 3349, 3350, 3351, 3352, 3353, 3354, 3355, 3356, 3357, 3358, 3359, 3360, 3361, 3362, 3363, 3364, 3365, 3366, 3367, 3368, 3369, 3370, 3371, 3372, 3373, 3374, 3375, 3376, 3377, 3378, 3379, 3380, 3381, 3382, 3383, 3384, 3385, 3386, 3387, 3388, 3389, 3390, 3391, 3392, 3393, 3394, 3395, 3396, 3397, 3398, 3399, 3400, 3401, 3402, 3403, 3404, 3405, 3406, 3407, 3408, 3409, 3410, 3411, 3412, 3413, 3414, 3415, 3416, 3417, 3418, 3419, 3420, 3421, 3422, 3423, 3424, 3425, 3426, 3427, 3428, 3429, 3430, 3431, 3432, 3433, 3434, 3435, 3436, 3437, 3438, 3439, 3440, 3441, 3442, 3443, 3444, 3445, 3446, 3447, 3448, 3449, 3450, 3451, 3452, 3453, 3454, 3455, 3456, 3457, 3458, 3459, 3460, 3461, 3462, 3463, 3464, 3465, 3466, 3467, 3468, 3469, 3470, 3471, 3472, 3473, 3474, 3475, 3476, 3477, 3478, 3479, 3480, 3481, 3482, 3483, 3484, 3485, 3486, 3487, 3488, 3489, 3490, 3491, 3492, 3493, 3494, 3495, 3496, 3497, 3498, 3499, 3500, 3501, 3502, 3503, 3504, 3505, 3506, 3507, 3508, 3509, 3510, 3511, 3512, 3513, 3514, 3515, 3516, 3517, 3518, 3519, 3520, 3521, 3522, 3523, 3524, 3525, 3526, 3527, 3528, 3529, 3530, 3531, 3532, 3533, 3534, 3535, 3536, 3537, 3538, 3539, 3540, 3541, 3542, 3543, 3544, 3545, 3546, 3547, 3548, 3549, 3550, 3551, 3552, 3553, 3554, 3555, 3556, 3557, 3558, 3559, 3560, 3561, 3562, 3563, 3564, 3565, 3566, 3567, 3568, 3569, 3570, 3571, 3572, 3573, 3574, 3575, 3576, 3577, 3578, 3579, 3580, 3581, 3582, 3583, 3584, 3585, 3586, 3587, 3588, 3589, 3590, 3591, 3592, 3593, 3594, 3595, 3596, 3597, 3598, 3599, 3600, 3601, 3602, 3603, 3604, 3605, 3606, 3607, 3608, 3609, 3610, 3611, 3612, 3613, 3614, 3615, 3616, 3617, 3618, 3619, 3620, 3621, 3622, 3623, 3624, 3625, 3626, 3627, 3628, 3629, 3630, 3631, 3632, 3633, 3634, 3635, 3636, 3637, 3638, 3639, 3640, 3641, 3642, 3643, 3644, 3645, 3646, 3647, 3648, 3649, 3650, 3651, 3652, 3653, 3654, 3655, 3656, 3657, 3658, 3659, 3660, 3661, 3662, 3663, 3664, 3665, 3666, 3667, 3668, 3669, 3670, 3671, 3672, 3673, 3674, 3675, 3676, 3677, 3678, 3679, 3680, 3681, 3682, 3683, 3684, 3685, 3686, 3687, 3688, 3689, 3690, 3691, 3692, 3693, 3694, 3695, 3696, 3697, 3698, 3699, 3700, 3701, 3702, 3703, 3704, 3705, 3706, 3707, 3708, 3709, 3710, 3711, 3712, 3713, 3714, 3715, 3716, 3717, 3718, 3719, 3720, 3721, 3722, 3723, 3724, 3725, 3726, 3727, 3728, 3729, 3730, 3731, 3732, 3733, 3734, 3735, 3736, 3737, 3738, 3739, 3740, 3741, 3742, 3743, 3744, 3745, 3746, 3747, 3748, 3749, 3750, 3751, 3752, 3753, 3754, 3755, 3756, 3757, 3758, 3759, 3760, 3761, 3762, 3763, 3764, 3765, 3766, 3767, 3768, 3769, 3770, 3771, 3772, 3773, 3774, 3775, 3776, 3777, 3778, 3779, 3780, 3781, 3782, 3783, 3784, 3785, 3786, 3787, 3788, 3789, 3790, 3791, 3792, 3793, 3794, 3795, 3796, 3797, 3798, 3799, 3800, 3801, 3802, 3803, 3804, 3805, 3806, 3807, 3808, 3809, 3810, 3811, 3812, 3813, 3814, 3815, 3816, 3817, 3818, 3819, 3820, 3821, 3822, 3823, 3824, 3825, 3826, 3827, 3828, 3829, 3830, 3831, 3832, 3833, 3834, 3835, 3836, 3837, 3838, 3839, 3840, 3841, 3842, 3843, 3844, 3845, 3846, 3847, 3848, 3849, 3850, 3851, 3852, 3853, 3854, 3855, 3856, 3857, 3858, 3859, 3860, 3861, 3862, 3863, 3864, 3865, 3866, 3867, 3868, 3869, 3870, 3871, 3872, 3873, 3874, 3875, 3876, 3877, 3878, 3879, 3880, 3881, 3882, 3883, 3884, 3885, 3886, 3887, 3888, 3889, 3890, 3891, 3892, 3893, 3894, 3895, 3896, 3897, 3898, 3899, 3900, 3901, 3902, 3903, 3904, 3905, 3906, 3907, 3908, 3909, 3910, 3911, 3912, 3913, 3914, 3915, 3916, 3917, 3918, 3919, 3920, 3921, 3922, 3923, 3924, 3925, 3926, 3927, 3928, 3929, 3930, 3931, 3932, 3933, 3934, 3935, 3936, 3937, 3938, 3939, 3940, 3941, 3942, 3943, 3944, 3945, 3946, 3947, 3948, 3949, 3950, 3951, 3952, 3953, 3954, 3955, 3956, 3957, 3958, 3959, 3960, 3961, 3962, 3963, 3964, 3965, 3966, 3967, 3968, 3969, 3970, 3971, 3972, 3973, 3974, 3975, 3976, 3977, 3978, 3979, 3980, 3981, 3982, 3983, 3984, 3985, 3986, 3987, 3988, 3989, 3990, 3991, 3992, 3993, 3994, 3995, 3996, 3997, 3998, 3999, 4000, 4001, 4002, 4003, 4004, 4005, 4006, 4007, 4008, 4009, 4010, 4011, 4012, 4013, 4014, 4015, 4016, 4017, 4018, 4019, 4020, 4021, 4022, 4023, 4024, 4025, 4026, 4027, 4028, 4029, 4030, 4031, 4032, 4033, 4034, 4035, 4036, 4037, 4038, 4039, 4040, 4041, 4042, 4043, 4044, 4045, 4046, 4047, 4048, 4049, 4050, 4051, 4052, 4053, 4054, 4055, 4056, 4057, 4058, 4059, 4060, 4061, 4062, 4063, 4064, 4065, 4066, 4067, 4068, 4069, 4070, 4071, 4072, 4073, 4074, 4075, 4076, 4077, 4078, 4079, 4080, 4081, 4082, 4083, 4084, 4085, 4086, 4087, 4088, 4089, 4090, 4091, 4092, 4093, 4094, 4095, 4096, 4097, 4098, 4099, 4100, 4101, 4102, 4103, 4104, 4105, 4106, 4107, 4108, 4109, 4110, 4111, 4112, 4113, 4114, 4115, 4116, 4117, 4118, 4119, 4120, 4121, 4122, 4123, 4124, 4125, 4126, 4127, 4128, 4129, 4130, 4131, 4132, 4133, 4134, 4135, 4136, 4137, 4138, 4139, 4140, 4141, 4142, 4143, 4144, 4145, 4146, 4147, 4148, 4149, 4150, 4151, 4152, 4153, 4154, 4155, 4156, 4157, 4158, 4159, 4160, 4161, 4162, 4163, 4164, 4165, 4166, 4167, 4168, 4169, 4170, 4171, 4172, 4173, 4174, 4175, 4176, 4177, 4178, 4179, 4180, 4181, 4182, 4183, 4184, 4185, 4186, 4187, 4188, 4189, 4190, 4191, 4192, 4193, 4194, 4195, 4196, 4197, 4198, 4199, 4200, 4201, 4202, 4203, 4204, 4205, 4206, 4207, 4208, 4209, 4210, 4211, 4212, 4213, 4214, 4215, 4216, 4217, 4218, 4219, 4220, 4221, 4222, 4223, 4224, 4225, 4226, 4227, 4228, 4229, 4230, 4231, 4232, 4233, 4234, 4235, 4236, 4237, 4238, 4239, 4240, 4241, 4242, 4243, 4244, 4245, 4246, 4247, 4248, 4249, 4250, 4251, 4252, 4253, 4254, 4255, 4256, 4257, 4258, 4259, 4260, 4261, 4262, 4263, 4264, 4265, 4266, 4267, 4268, 4269, 4270, 4271, 4272, 4273, 4274, 4275, 4276, 4277, 4278, 4279, 4280, 4281, 4282, 4283, 4284, 4285, 4286, 4287, 4288, 4289, 4290, 4291, 4292, 4293, 4294, 4295, 4296, 4297, 4298, 4299, 4300, 4301, 4302, 4303, 4304, 4305, 4306, 4307, 4308, 4309, 4310, 4311, 4312, 4313, 4314, 4315, 4316, 4317, 4318, 4319, 4320, 4321, 4322, 4323, 4324, 4325, 4326, 4327, 4328, 4329, 4330, 4331, 4332, 4333, 4334, 4335, 4336, 4337, 4338, 4339, 4340, 4341, 4342, 4343, 4344, 4345, 4346, 4347, 4348, 4349, 4350, 4351, 4352, 4353, 4354, 4355, 4356, 4357, 4358, 4359, 4360, 4361, 4362, 4363, 4364, 4365, 4366, 4367, 4368, 4369, 4370, 4371, 4372, 4373, 4374, 4375, 4376, 4377, 4378, 4379, 4380, 4381, 4382, 4383, 4384, 4385, 4386, 4387, 4388, 4389, 4390, 4391, 4392, 4393, 4394, 4395, 4396, 4397, 4398, 4399, 4400, 4401, 4402, 4403, 4404, 4405, 4406, 4407, 4408, 4409, 4410, 4411, 4412, 4413, 4414, 4415, 4416, 4417, 4418, 4419, 4420, 4421, 4422, 4423, 4424, 4425, 4426, 4427, 4428, 4429, 4430, 4431, 4432, 4433, 4434, 4435, 4436, 4437, 4438, 4439, 4440, 4441, 4442, 4443, 4444, 4445, 4446, 4447, 4448, 4449, 4450, 4451, 4452, 4453, 4454, 4455, 4456, 4457, 4458, 4459, 4460, 4461, 4462, 4463, 4464, 4465, 4466, 4467, 4468, 4469, 4470, 4471, 4472, 4473, 4474, 4475, 4476, 4477, 4478, 4479, 4480, 4481, 4482, 4483, 4484, 4485, 4486, 4487, 4488, 4489, 4490, 4491, 4492, 4493, 4494, 4495, 4496, 4497, 4498, 4499, 4500, 4501, 4502, 4503, 4504, 4505, 4506, 4507, 4508, 4509, 4510, 4511, 4512, 4513, 4514, 4515, 4516, 4517, 4518, 4519, 4520, 4521, 4522, 4523, 4524, 4525, 4526, 4527, 4528, 4529, 4530, 4531, 4532, 4533, 4534, 4535, 4536, 4537, 4538, 4539, 4540, 4541, 4542, 4543, 4544, 4545, 4546, 4547, 4548, 4549, 4550, 4551, 4552, 4553, 4554, 4555, 4556, 4557, 4558, 4559, 4560, 4561, 4562, 4563, 4564, 4565, 4566, 4567, 4568, 4569, 4570, 4571, 4572, 4573, 4574, 4575, 4576, 4577, 4578, 4579, 4580, 4581, 4582, 4583, 4584, 4585, 4586, 4587, 4588, 4589, 4590, 4591, 4592, 4593, 4594, 4595, 4596, 4597, 4598, 4599, 4600, 4601, 4602, 4603, 4604, 4605, 4606, 4607, 4608, 4609, 4610, 4611, 4612, 4613, 4614, 4615, 4616, 4617, 4618, 4619, 4620, 4621, 4622, 4623, 4624, 4625, 4626, 4627, 4628, 4629, 4630, 4631, 4632, 4633, 4634, 4635, 4636, 4637, 4638, 4639, 4640, 4641, 4642, 4643, 4644, 4645, 4646, 4647, 4648, 4649, 4650, 4651, 4652, 4653, 4654, 4655, 4656, 4657, 4658, 4659, 4660, 4661, 4662, 4663, 4664, 4665, 4666, 4667, 4668, 4669, 4670, 4671, 4672, 4673, 4674, 4675, 4676, 4677, 4678, 4679, 4680, 4681, 4682, 4683, 4684, 4685, 4686, 4687, 4688, 4689, 4690, 4691, 4692, 4693, 4694, 4695, 4696, 4697, 4698, 4699, 4700, 4701, 4702, 4703, 4704, 4705, 4706, 4707, 4708, 4709, 4710, 4711, 4712, 4713, 4714, 4715, 4716, 4717, 4718, 4719, 4720, 4721, 4722, 4723, 4724, 4725, 4726, 4727, 4728, 4729, 4730, 4731, 4732, 4733, 4734, 4735, 4736, 4737, 4738, 4739, 4740, 4741, 4742, 4743, 4744, 4745, 4746, 4747, 4748, 4749, 4750, 4751, 4752, 4753, 4754, 4755, 4756, 4757, 4758, 4759, 4760, 4761, 4762, 4763, 4764, 4765, 4766, 4767, 4768, 4769, 4770, 4771, 4772, 4773, 4774, 4775, 4776, 4777, 4778, 4779, 4780, 4781, 4782, 4783, 4784, 4785, 4786, 4787, 4788, 4789, 4790, 4791, 4792, 4793, 4794, 4795, 4796, 4797, 4798, 4799, 4800, 4801, 4802, 4803, 4804, 4805, 4806, 4807, 4808, 4809, 4810, 4811, 4812, 4813, 4814, 4815, 4816, 4817, 4818, 4819, 4820, 4821, 4822, 4823, 4824, 4825, 4826, 4827, 4828, 4829, 4830, 4831, 4832, 4833, 4834, 4835, 4836, 4837, 4838, 4839, 4840, 4841, 4842, 4843, 4844, 4845, 4846, 4847, 4848, 4849, 4850, 4851, 4852, 4853, 4854, 4855, 4856, 4857, 4858, 4859, 4860, 4861, 4862, 4863, 4864, 4865, 4866, 4867, 4868, 4869, 4870, 4871, 4872, 4873, 4874, 4875, 4876, 4877, 4878, 4879, 4880, 4881, 4882, 4883, 4884, 4885, 4886, 4887, 4888, 4889, 4890, 4891, 4892, 4893, 4894, 4895, 4896, 4897, 4898, 4899, 4900, 4901, 4902, 4903, 4904, 4905, 4906, 4907, 4908, 4909, 4910, 4911, 4912, 4913, 4914, 4915, 4916, 4917, 4918, 4919, 4920, 4921, 4922, 4923, 4924, 4925, 4926, 4927, 4928, 4929, 4930, 4931, 4932, 4933, 4934, 4935, 4936, 4937, 4938, 4939, 4940, 4941, 4942, 4943, 4944, 4945, 4946, 4947, 4948, 4949, 4950, 4951, 4952, 4953, 4954, 4955, 4956, 4957, 4958, 4959, 4960, 4961, 4962, 4963, 4964, 4965, 4966, 4967, 4968, 4969, 4970, 4971, 4972, 4973, 4974, 4975, 4976, 4977, 4978, 4979, 4980, 4981, 4982, 4983, 4984, 4985, 4986, 4987, 4988, 4989, 4990, 4991, 4992, 4993, 4994, 4995, 4996, 4997, 4998, 4999], your vocabulary could be corrupted !\n"
|
| 234 |
+
]
|
| 235 |
+
}
|
| 236 |
+
],
|
| 237 |
+
"source": [
|
| 238 |
+
"\n",
|
| 239 |
+
"\n",
|
| 240 |
+
"ppi = \"Protein-Protein Interaction (PPI)\"\n",
|
| 241 |
+
"dti = \"Drug-Target Binding Affinity\"\n",
|
| 242 |
+
"\n",
|
| 243 |
+
"\n",
|
| 244 |
+
"model_paths={ppi:\"ibm/biomed.omics.bl.sm.ma-ted-458m\",dti: \"ibm/biomed.omics.bl.sm.ma-ted-458m.dti_bindingdb_pkd\"}\n",
|
| 245 |
+
"# Load Models\n",
|
| 246 |
+
"models=dict()\n",
|
| 247 |
+
"tokenizer_op = dict()\n",
|
| 248 |
+
"for model_type in [ppi,dti]:\n",
|
| 249 |
+
" models[model_type] = Mammal.from_pretrained(model_paths[model_type])\n",
|
| 250 |
+
" models[model_type].eval()\n",
|
| 251 |
+
" # Load Tokenizer\n",
|
| 252 |
+
" tokenizer_op[model_type] = ModularTokenizerOp.from_pretrained(model_paths[model_type])\n",
|
| 253 |
+
"\n"
|
| 254 |
+
]
|
| 255 |
+
},
|
| 256 |
+
{
|
| 257 |
+
"cell_type": "code",
|
| 258 |
+
"execution_count": 4,
|
| 259 |
+
"metadata": {},
|
| 260 |
+
"outputs": [],
|
| 261 |
+
"source": [
|
| 262 |
+
"\n",
|
| 263 |
+
"# Load Model\n",
|
| 264 |
+
"# model_dti = Mammal.from_pretrained()\n",
|
| 265 |
+
"# model_dti.eval()\n"
|
| 266 |
+
]
|
| 267 |
+
},
|
| 268 |
+
{
|
| 269 |
+
"cell_type": "code",
|
| 270 |
+
"execution_count": 23,
|
| 271 |
+
"metadata": {},
|
| 272 |
+
"outputs": [],
|
| 273 |
+
"source": [
|
| 274 |
+
"\n",
|
| 275 |
+
"\n",
|
| 276 |
+
"\n",
|
| 277 |
+
"#token for positive binding\n",
|
| 278 |
+
"positive_token_id=tokenizer_op[ppi].get_token_id(\"<1>\")\n",
|
| 279 |
+
"\n",
|
| 280 |
+
"# Default input proteins\n",
|
| 281 |
+
"protein_calmodulin = \"MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMISELDQDGFIDKEDLHDGDGKISFEEFLNLVNKEMTADVDGDGQVNYEEFVTMMTSK\"\n",
|
| 282 |
+
"protein_calcineurin = \"MSSKLLLAGLDIERVLAEKNFYKEWDTWIIEAMNVGDEEVDRIKEFKEDEIFEEAKTLGTAEMQEYKKQKLEEAIEGAFDIFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRQMWDQNGDWDRIKELKFGEIKKLSAKDTRGTIFIKVFENLGTGVDSEYEDVSKYMLKHQ\"\n",
|
| 283 |
+
"\n",
|
| 284 |
+
"\n",
|
| 285 |
+
"# input\n",
|
| 286 |
+
"target_seq = \"NLMKRCTRGFRKLGKCTTLEEEKCKTLYPRGQCTCSDSKMNTHSCDCKSC\"\n",
|
| 287 |
+
"drug_seq = \"CC(=O)NCCC1=CNc2c1cc(OC)cc2\"\n",
|
| 288 |
+
"\n",
|
| 289 |
+
"def format_prompt_ppi(prot1,prot2):\n",
|
| 290 |
+
" # Formatting prompt to match pre-training syntax\n",
|
| 291 |
+
" return f\"<@TOKENIZER-TYPE=AA><BINDING_AFFINITY_CLASS><SENTINEL_ID_0><MOLECULAR_ENTITY><MOLECULAR_ENTITY_GENERAL_PROTEIN><SEQUENCE_NATURAL_START>{prot1}<SEQUENCE_NATURAL_END><MOLECULAR_ENTITY><MOLECULAR_ENTITY_GENERAL_PROTEIN><SEQUENCE_NATURAL_START>{prot2}<SEQUENCE_NATURAL_END><EOS>\"\n",
|
| 292 |
+
"def format_prompt_dti(prot,drug):\n",
|
| 293 |
+
" sample_dict = {\"target_seq\": target_seq, \"drug_seq\": drug_seq}\n",
|
| 294 |
+
" sample_dict = DtiBindingdbKdTask.data_preprocessing(\n",
|
| 295 |
+
" sample_dict=sample_dict,\n",
|
| 296 |
+
" tokenizer_op=tokenizer_op[dti],\n",
|
| 297 |
+
" target_sequence_key=\"target_seq\",\n",
|
| 298 |
+
" drug_sequence_key=\"drug_seq\",\n",
|
| 299 |
+
" norm_y_mean=None,\n",
|
| 300 |
+
" norm_y_std=None,\n",
|
| 301 |
+
" device=models[dti].device,\n",
|
| 302 |
+
" )\n",
|
| 303 |
+
" return sample_dict\n",
|
| 304 |
+
"\n",
|
| 305 |
+
"def run_prompt(prompt):\n",
|
| 306 |
+
" # Create and load sample\n",
|
| 307 |
+
" sample_dict = dict()\n",
|
| 308 |
+
" sample_dict[ENCODER_INPUTS_STR] = prompt\n",
|
| 309 |
+
"\n",
|
| 310 |
+
" # Tokenize\n",
|
| 311 |
+
" sample_dict=tokenizer_op[ppi](\n",
|
| 312 |
+
" sample_dict=sample_dict,\n",
|
| 313 |
+
" key_in=ENCODER_INPUTS_STR,\n",
|
| 314 |
+
" key_out_tokens_ids=ENCODER_INPUTS_TOKENS,\n",
|
| 315 |
+
" key_out_attention_mask=ENCODER_INPUTS_ATTENTION_MASK,\n",
|
| 316 |
+
" )\n",
|
| 317 |
+
" sample_dict[ENCODER_INPUTS_TOKENS] = torch.tensor(sample_dict[ENCODER_INPUTS_TOKENS])\n",
|
| 318 |
+
" sample_dict[ENCODER_INPUTS_ATTENTION_MASK] = torch.tensor(sample_dict[ENCODER_INPUTS_ATTENTION_MASK])\n",
|
| 319 |
+
"\n",
|
| 320 |
+
"\n",
|
| 321 |
+
" # Generate Prediction\n",
|
| 322 |
+
" batch_dict = models[ppi].generate(\n",
|
| 323 |
+
" [sample_dict],\n",
|
| 324 |
+
" output_scores=True,\n",
|
| 325 |
+
" return_dict_in_generate=True,\n",
|
| 326 |
+
" max_new_tokens=5,\n",
|
| 327 |
+
")\n",
|
| 328 |
+
"\n",
|
| 329 |
+
"\n",
|
| 330 |
+
" # Get output\n",
|
| 331 |
+
" generated_output = tokenizer_op[ppi]._tokenizer.decode(batch_dict[CLS_PRED][0])\n",
|
| 332 |
+
" score = batch_dict['model.out.scores'][0][1][positive_token_id].item()\n",
|
| 333 |
+
" \n",
|
| 334 |
+
" return generated_output,score\n",
|
| 335 |
+
"\n",
|
| 336 |
+
"def create_and_run_prompt(prot1, prot2):\n",
|
| 337 |
+
" prompt = format_prompt_ppi(prot1, prot2)\n",
|
| 338 |
+
" res=prompt, *run_prompt(prompt=prompt)\n",
|
| 339 |
+
" return res\n",
|
| 340 |
+
"\n",
|
| 341 |
+
"def create_and_run_prompt_dtb(prot, drug):\n",
|
| 342 |
+
" sample_dict = format_prompt_dti(prot, drug)\n",
|
| 343 |
+
" # Post-process the model's output\n",
|
| 344 |
+
" # batch_dict = model_dti.forward_encoder_only([sample_dict])\n",
|
| 345 |
+
" batch_dict = models[dti].forward_encoder_only([sample_dict])\n",
|
| 346 |
+
" batch_dict = DtiBindingdbKdTask.process_model_output(\n",
|
| 347 |
+
" batch_dict,\n",
|
| 348 |
+
" scalars_preds_processed_key=\"model.out.dti_bindingdb_kd\",\n",
|
| 349 |
+
" norm_y_mean=5.79384684128215,\n",
|
| 350 |
+
" norm_y_std=1.33808027428196,\n",
|
| 351 |
+
" )\n",
|
| 352 |
+
" ans = [\n",
|
| 353 |
+
" \"model.out.dti_bindingdb_kd\", float(batch_dict[\"model.out.dti_bindingdb_kd\"][0])\n",
|
| 354 |
+
" ]\n",
|
| 355 |
+
" res=sample_dict[\"data.query.encoder_input\"], *ans\n",
|
| 356 |
+
" return res\n",
|
| 357 |
+
"\n"
|
| 358 |
+
]
|
| 359 |
+
},
|
| 360 |
+
{
|
| 361 |
+
"cell_type": "code",
|
| 362 |
+
"execution_count": null,
|
| 363 |
+
"metadata": {},
|
| 364 |
+
"outputs": [],
|
| 365 |
+
"source": [
|
| 366 |
+
"\n"
|
| 367 |
+
]
|
| 368 |
+
},
|
| 369 |
+
{
|
| 370 |
+
"cell_type": "code",
|
| 371 |
+
"execution_count": 28,
|
| 372 |
+
"metadata": {},
|
| 373 |
+
"outputs": [],
|
| 374 |
+
"source": [
|
| 375 |
+
"def create_ppi_demo():\n",
|
| 376 |
+
" markup_text = f\"\"\"\n",
|
| 377 |
+
"# Mammal based Protein-Protein Interaction (PPI) demonstration\n",
|
| 378 |
+
"\n",
|
| 379 |
+
"Given two protein sequences, estimate if the proteins interact or not.\n",
|
| 380 |
+
"\n",
|
| 381 |
+
"### Using the model from \n",
|
| 382 |
+
"\n",
|
| 383 |
+
" ```{model_paths[ppi]} ```\n",
|
| 384 |
+
"\"\"\"\n",
|
| 385 |
+
" with gr.Group() as ppi_demo:\n",
|
| 386 |
+
" gr.Markdown(markup_text)\n",
|
| 387 |
+
" with gr.Row():\n",
|
| 388 |
+
" prot1 = gr.Textbox(\n",
|
| 389 |
+
" label=\"Protein 1 sequence\",\n",
|
| 390 |
+
" # info=\"standard\",\n",
|
| 391 |
+
" interactive=True,\n",
|
| 392 |
+
" lines=3,\n",
|
| 393 |
+
" value=protein_calmodulin,\n",
|
| 394 |
+
" )\n",
|
| 395 |
+
" prot2 = gr.Textbox(\n",
|
| 396 |
+
" label=\"Protein 2 sequence\",\n",
|
| 397 |
+
" # info=\"standard\",\n",
|
| 398 |
+
" interactive=True,\n",
|
| 399 |
+
" lines=3,\n",
|
| 400 |
+
" value=protein_calcineurin,\n",
|
| 401 |
+
" )\n",
|
| 402 |
+
" with gr.Row():\n",
|
| 403 |
+
" run_mammal = gr.Button(\"Run Mammal prompt for Protein-Protein Interaction\",variant='primary')\n",
|
| 404 |
+
" with gr.Row():\n",
|
| 405 |
+
" prompt_box = gr.Textbox(label=\"Mammal prompt\",lines=5)\n",
|
| 406 |
+
" \n",
|
| 407 |
+
" with gr.Row():\n",
|
| 408 |
+
" decoded = gr.Textbox(label=\"Mammal output\")\n",
|
| 409 |
+
" run_mammal.click(\n",
|
| 410 |
+
" fn=create_and_run_prompt,\n",
|
| 411 |
+
" inputs=[prot1,prot2],\n",
|
| 412 |
+
" outputs=[prompt_box,decoded,gr.Number(label='PPI score')]\n",
|
| 413 |
+
" )\n",
|
| 414 |
+
" with gr.Row():\n",
|
| 415 |
+
" gr.Markdown(\"```<SENTINEL_ID_0>``` contains the binding affinity class, which is ```<1>``` for interacting and ```<0>``` for non-interacting\")\n",
|
| 416 |
+
" ppi_demo.visible=False\n",
|
| 417 |
+
" return ppi_demo\n",
|
| 418 |
+
" \n",
|
| 419 |
+
" \n",
|
| 420 |
+
"def create_tdb_demo():\n",
|
| 421 |
+
" markup_text = f\"\"\"\n",
|
| 422 |
+
"# Mammal based Target-Drug binding affinity demonstration\n",
|
| 423 |
+
"\n",
|
| 424 |
+
"Given a protein sequence and a drug (in SMILES), estimate the binding affinity.\n",
|
| 425 |
+
"\n",
|
| 426 |
+
"### Using the model from \n",
|
| 427 |
+
"\n",
|
| 428 |
+
" ```{model_paths[dti]} ```\n",
|
| 429 |
+
"\"\"\"\n",
|
| 430 |
+
" with gr.Group() as tdb_demo:\n",
|
| 431 |
+
" gr.Markdown(markup_text)\n",
|
| 432 |
+
" with gr.Row():\n",
|
| 433 |
+
" prot = gr.Textbox(\n",
|
| 434 |
+
" label=\"Protein sequence\",\n",
|
| 435 |
+
" # info=\"standard\",\n",
|
| 436 |
+
" interactive=True,\n",
|
| 437 |
+
" lines=3,\n",
|
| 438 |
+
" value=target_seq\n",
|
| 439 |
+
" )\n",
|
| 440 |
+
" drug = gr.Textbox(\n",
|
| 441 |
+
" label=\"drug sequence (SMILES)\",\n",
|
| 442 |
+
" # info=\"standard\",\n",
|
| 443 |
+
" interactive=True,\n",
|
| 444 |
+
" lines=3,\n",
|
| 445 |
+
" value=drug_seq,\n",
|
| 446 |
+
" )\n",
|
| 447 |
+
" with gr.Row():\n",
|
| 448 |
+
" run_mammal = gr.Button(\"Run Mammal prompt for Protein-Protein Interaction\",variant='primary')\n",
|
| 449 |
+
" with gr.Row():\n",
|
| 450 |
+
" prompt_box = gr.Textbox(label=\"Mammal prompt\",lines=5)\n",
|
| 451 |
+
" \n",
|
| 452 |
+
" with gr.Row():\n",
|
| 453 |
+
" decoded = gr.Textbox(label=\"Mammal output\")\n",
|
| 454 |
+
" run_mammal.click(\n",
|
| 455 |
+
" fn=create_and_run_prompt_dtb,\n",
|
| 456 |
+
" inputs=[prot,drug],\n",
|
| 457 |
+
" outputs=[prompt_box,decoded,gr.Number(label='DTI score')]\n",
|
| 458 |
+
" )\n",
|
| 459 |
+
" with gr.Row():\n",
|
| 460 |
+
" gr.Markdown(\"```<SENTINEL_ID_0>``` contains the binding affinity class, which is ```<1>``` for interacting and ```<0>``` for non-interacting\")\n",
|
| 461 |
+
" tdb_demo.visible=False\n",
|
| 462 |
+
" return tdb_demo\n",
|
| 463 |
+
"\n"
|
| 464 |
+
]
|
| 465 |
+
},
|
| 466 |
+
{
|
| 467 |
+
"cell_type": "code",
|
| 468 |
+
"execution_count": 25,
|
| 469 |
+
"metadata": {},
|
| 470 |
+
"outputs": [],
|
| 471 |
+
"source": [
|
| 472 |
+
"\n",
|
| 473 |
+
"def create_application():\n",
|
| 474 |
+
" \n",
|
| 475 |
+
"\n",
|
| 476 |
+
" with gr.Blocks() as demo:\n",
|
| 477 |
+
" main_dropdown = gr.Dropdown(choices=[\"select demo\",ppi,dti])\n",
|
| 478 |
+
" main_dropdown.interactive=True\n",
|
| 479 |
+
" ppi_demo = create_ppi_demo()\n",
|
| 480 |
+
" dtb_demo = create_tdb_demo()\n",
|
| 481 |
+
" def set_ppi_vis(main_text):\n",
|
| 482 |
+
" return gr.Group(visible=main_text==ppi),gr.Group(visible=main_text==dti)\n",
|
| 483 |
+
" main_dropdown.change(set_ppi_vis, inputs=main_dropdown, outputs=[ppi_demo,dtb_demo])\n",
|
| 484 |
+
" \n",
|
| 485 |
+
" \n",
|
| 486 |
+
" # # part II\n",
|
| 487 |
+
" \n",
|
| 488 |
+
" # gr.Markdown(markup_text)\n",
|
| 489 |
+
" # with gr.Row():\n",
|
| 490 |
+
" # target = gr.Textbox(\n",
|
| 491 |
+
" # label=\"target sequence\",\n",
|
| 492 |
+
" # # info=\"standard\",\n",
|
| 493 |
+
" # interactive=True,\n",
|
| 494 |
+
" # lines=1,\n",
|
| 495 |
+
" # value=\"NLMKRCTRGFRKLGKCTTLEEEKCKTLYPRGQCTCSDSKMNTHSCDCKSC\",\n",
|
| 496 |
+
" # )\n",
|
| 497 |
+
" # drug = gr.Textbox(\n",
|
| 498 |
+
" # label=\"drug sequence\",\n",
|
| 499 |
+
" # # info=\"standard\",\n",
|
| 500 |
+
" # interactive=True,\n",
|
| 501 |
+
" # lines=1,\n",
|
| 502 |
+
" # value=\"CC(=O)NCCC1=CNc2c1cc(OC)cc2\",\n",
|
| 503 |
+
" # )\n",
|
| 504 |
+
" # with gr.Row():\n",
|
| 505 |
+
" # dt_run_mammal = gr.Button(\"Run Mammal prompt for drug-target binding affinity\",variant='primary')\n",
|
| 506 |
+
" # with gr.Row():\n",
|
| 507 |
+
" # dt_prompt_box = gr.Textbox(label=\"Mammal prompt\",lines=5)\n",
|
| 508 |
+
" \n",
|
| 509 |
+
" # with gr.Row():\n",
|
| 510 |
+
" # dt_decoded = gr.Textbox(label=\"Mammal output\")\n",
|
| 511 |
+
" # dt_run_mammal.click(\n",
|
| 512 |
+
" # fn=create_and_run_prompt,\n",
|
| 513 |
+
" # inputs=[target,drug],\n",
|
| 514 |
+
" # outputs=[dt_prompt_box,dt_decoded,gr.Number(label='PPI score')]\n",
|
| 515 |
+
" # )\n",
|
| 516 |
+
" # with gr.Row():\n",
|
| 517 |
+
" # gr.Markdown(\"```<SENTINEL_ID_0>``` contains the binding affinity class, which is ```<1>``` for interacting and ```<0>``` for non-interacting\")\n",
|
| 518 |
+
" \n",
|
| 519 |
+
" return demo\n",
|
| 520 |
+
"\n"
|
| 521 |
+
]
|
| 522 |
+
},
|
| 523 |
+
{
|
| 524 |
+
"cell_type": "code",
|
| 525 |
+
"execution_count": 29,
|
| 526 |
+
"metadata": {},
|
| 527 |
+
"outputs": [
|
| 528 |
+
{
|
| 529 |
+
"name": "stderr",
|
| 530 |
+
"output_type": "stream",
|
| 531 |
+
"text": [
|
| 532 |
+
"huggingface/tokenizers: The current process just got forked, after parallelism has already been used. Disabling parallelism to avoid deadlocks...\n",
|
| 533 |
+
"To disable this warning, you can either:\n",
|
| 534 |
+
"\t- Avoid using `tokenizers` before the fork if possible\n",
|
| 535 |
+
"\t- Explicitly set the environment variable TOKENIZERS_PARALLELISM=(true | false)\n"
|
| 536 |
+
]
|
| 537 |
+
},
|
| 538 |
+
{
|
| 539 |
+
"name": "stdout",
|
| 540 |
+
"output_type": "stream",
|
| 541 |
+
"text": [
|
| 542 |
+
"* Running on local URL: http://127.0.0.1:7865\n",
|
| 543 |
+
"\n",
|
| 544 |
+
"To create a public link, set `share=True` in `launch()`.\n"
|
| 545 |
+
]
|
| 546 |
+
},
|
| 547 |
+
{
|
| 548 |
+
"data": {
|
| 549 |
+
"text/html": [
|
| 550 |
+
"<div><iframe src=\"http://127.0.0.1:7865/\" width=\"100%\" height=\"500\" allow=\"autoplay; camera; microphone; clipboard-read; clipboard-write;\" frameborder=\"0\" allowfullscreen></iframe></div>"
|
| 551 |
+
],
|
| 552 |
+
"text/plain": [
|
| 553 |
+
"<IPython.core.display.HTML object>"
|
| 554 |
+
]
|
| 555 |
+
},
|
| 556 |
+
"metadata": {},
|
| 557 |
+
"output_type": "display_data"
|
| 558 |
+
},
|
| 559 |
+
{
|
| 560 |
+
"data": {
|
| 561 |
+
"text/plain": []
|
| 562 |
+
},
|
| 563 |
+
"execution_count": 29,
|
| 564 |
+
"metadata": {},
|
| 565 |
+
"output_type": "execute_result"
|
| 566 |
+
}
|
| 567 |
+
],
|
| 568 |
+
"source": [
|
| 569 |
+
"\n",
|
| 570 |
+
"demo = create_application()\n",
|
| 571 |
+
"\n",
|
| 572 |
+
"demo.launch(show_error=True, share=False)\n",
|
| 573 |
+
"\n"
|
| 574 |
+
]
|
| 575 |
+
},
|
| 576 |
+
{
|
| 577 |
+
"cell_type": "code",
|
| 578 |
+
"execution_count": null,
|
| 579 |
+
"metadata": {},
|
| 580 |
+
"outputs": [],
|
| 581 |
+
"source": [
|
| 582 |
+
"# demo.blocks[7].show_label = True\n",
|
| 583 |
+
"demo.children\n"
|
| 584 |
+
]
|
| 585 |
+
},
|
| 586 |
+
{
|
| 587 |
+
"cell_type": "code",
|
| 588 |
+
"execution_count": null,
|
| 589 |
+
"metadata": {},
|
| 590 |
+
"outputs": [],
|
| 591 |
+
"source": [
|
| 592 |
+
"i=-1"
|
| 593 |
+
]
|
| 594 |
+
},
|
| 595 |
+
{
|
| 596 |
+
"cell_type": "code",
|
| 597 |
+
"execution_count": null,
|
| 598 |
+
"metadata": {},
|
| 599 |
+
"outputs": [],
|
| 600 |
+
"source": [
|
| 601 |
+
"i = i+1\n",
|
| 602 |
+
"print(i)\n",
|
| 603 |
+
"demo.blocks[i].label"
|
| 604 |
+
]
|
| 605 |
+
},
|
| 606 |
+
{
|
| 607 |
+
"cell_type": "code",
|
| 608 |
+
"execution_count": null,
|
| 609 |
+
"metadata": {},
|
| 610 |
+
"outputs": [],
|
| 611 |
+
"source": [
|
| 612 |
+
"demo.blocks[7].value = \"changed\"\n",
|
| 613 |
+
"demo.blocks[7].visible = True "
|
| 614 |
+
]
|
| 615 |
+
},
|
| 616 |
+
{
|
| 617 |
+
"cell_type": "code",
|
| 618 |
+
"execution_count": null,
|
| 619 |
+
"metadata": {},
|
| 620 |
+
"outputs": [],
|
| 621 |
+
"source": [
|
| 622 |
+
"gr.close_all()"
|
| 623 |
+
]
|
| 624 |
+
},
|
| 625 |
+
{
|
| 626 |
+
"cell_type": "code",
|
| 627 |
+
"execution_count": null,
|
| 628 |
+
"metadata": {},
|
| 629 |
+
"outputs": [],
|
| 630 |
+
"source": [
|
| 631 |
+
"demo.close()"
|
| 632 |
+
]
|
| 633 |
+
},
|
| 634 |
+
{
|
| 635 |
+
"cell_type": "code",
|
| 636 |
+
"execution_count": null,
|
| 637 |
+
"metadata": {},
|
| 638 |
+
"outputs": [],
|
| 639 |
+
"source": [
|
| 640 |
+
"demo.visible=False"
|
| 641 |
+
]
|
| 642 |
+
},
|
| 643 |
+
{
|
| 644 |
+
"cell_type": "code",
|
| 645 |
+
"execution_count": null,
|
| 646 |
+
"metadata": {},
|
| 647 |
+
"outputs": [],
|
| 648 |
+
"source": [
|
| 649 |
+
"demo.clear()"
|
| 650 |
+
]
|
| 651 |
+
},
|
| 652 |
+
{
|
| 653 |
+
"cell_type": "code",
|
| 654 |
+
"execution_count": null,
|
| 655 |
+
"metadata": {},
|
| 656 |
+
"outputs": [],
|
| 657 |
+
"source": [
|
| 658 |
+
"def dropdown_change(val):\n",
|
| 659 |
+
" if val==\"other\":\n",
|
| 660 |
+
" visibility=False\n",
|
| 661 |
+
" else:\n",
|
| 662 |
+
" visibility=True\n",
|
| 663 |
+
" return gr.Radio([\"y\",\"N\",val], interactive=True, visible=visibility)\n",
|
| 664 |
+
"\n",
|
| 665 |
+
"with gr.Blocks() as d2:\n",
|
| 666 |
+
" n1 = gr.Radio([\"y\",\"N\"])\n",
|
| 667 |
+
" n3=gr.Radio([\"nothing\",\"here\"])\n",
|
| 668 |
+
" @gr.render(inputs=[n1])\n",
|
| 669 |
+
" def do_something(text, outputs=[n3]):\n",
|
| 670 |
+
" print(text)\n",
|
| 671 |
+
" # gr.Radio([text,\"not\"])\n",
|
| 672 |
+
" # n3=gr.Button(\"bbb\")\n",
|
| 673 |
+
" dr1 = gr.Dropdown(choices=[\"one\",\"two\",\"other\"], )\n",
|
| 674 |
+
" dr1.interactive=True\n",
|
| 675 |
+
" \n",
|
| 676 |
+
" b1=gr.Button(\"asf\",interactive=True,)\n",
|
| 677 |
+
" b1.click(dropdown_change, inputs=[n1], outputs=[n3] )\n",
|
| 678 |
+
" \n",
|
| 679 |
+
" dr1.change(fn=dropdown_change, inputs=[dr1], outputs=[n1])\n",
|
| 680 |
+
" \n",
|
| 681 |
+
"d2.launch()"
|
| 682 |
+
]
|
| 683 |
+
},
|
| 684 |
+
{
|
| 685 |
+
"cell_type": "code",
|
| 686 |
+
"execution_count": null,
|
| 687 |
+
"metadata": {},
|
| 688 |
+
"outputs": [],
|
| 689 |
+
"source": [
|
| 690 |
+
"n1=gr.Radio(gr.update(n1, kwargs={\"interactive\": False}))"
|
| 691 |
+
]
|
| 692 |
+
},
|
| 693 |
+
{
|
| 694 |
+
"cell_type": "code",
|
| 695 |
+
"execution_count": null,
|
| 696 |
+
"metadata": {},
|
| 697 |
+
"outputs": [],
|
| 698 |
+
"source": [
|
| 699 |
+
"gr.update(n1, kwargs={\"interactive\": False})"
|
| 700 |
+
]
|
| 701 |
+
},
|
| 702 |
+
{
|
| 703 |
+
"cell_type": "code",
|
| 704 |
+
"execution_count": null,
|
| 705 |
+
"metadata": {},
|
| 706 |
+
"outputs": [],
|
| 707 |
+
"source": [
|
| 708 |
+
"n1.visible"
|
| 709 |
+
]
|
| 710 |
+
},
|
| 711 |
+
{
|
| 712 |
+
"cell_type": "code",
|
| 713 |
+
"execution_count": null,
|
| 714 |
+
"metadata": {},
|
| 715 |
+
"outputs": [],
|
| 716 |
+
"source": []
|
| 717 |
+
}
|
| 718 |
+
],
|
| 719 |
+
"metadata": {
|
| 720 |
+
"kernelspec": {
|
| 721 |
+
"display_name": "mammal",
|
| 722 |
+
"language": "python",
|
| 723 |
+
"name": "python3"
|
| 724 |
+
},
|
| 725 |
+
"language_info": {
|
| 726 |
+
"codemirror_mode": {
|
| 727 |
+
"name": "ipython",
|
| 728 |
+
"version": 3
|
| 729 |
+
},
|
| 730 |
+
"file_extension": ".py",
|
| 731 |
+
"mimetype": "text/x-python",
|
| 732 |
+
"name": "python",
|
| 733 |
+
"nbconvert_exporter": "python",
|
| 734 |
+
"pygments_lexer": "ipython3",
|
| 735 |
+
"version": "3.10.0"
|
| 736 |
+
}
|
| 737 |
+
},
|
| 738 |
+
"nbformat": 4,
|
| 739 |
+
"nbformat_minor": 2
|
| 740 |
+
}
|
mammal_demo/__pycache__/__init__.cpython-310.pyc
ADDED
|
Binary file (185 Bytes). View file
|
|
|
mammal_demo/__pycache__/demo_framework.cpython-310.pyc
ADDED
|
Binary file (4.19 kB). View file
|
|
|
mammal_demo/__pycache__/dti_task.cpython-310.pyc
ADDED
|
Binary file (3.78 kB). View file
|
|
|
mammal_demo/__pycache__/ibm_theme.cpython-310.pyc
ADDED
|
Binary file (1.63 kB). View file
|
|
|
mammal_demo/__pycache__/ppi_task.cpython-310.pyc
ADDED
|
Binary file (5.05 kB). View file
|
|
|
mammal_demo/__pycache__/ps_task.cpython-310.pyc
ADDED
|
Binary file (4.06 kB). View file
|
|
|
mammal_demo/__pycache__/tcr_task.cpython-310.pyc
ADDED
|
Binary file (5.68 kB). View file
|
|
|
mammal_demo/ibm_theme.py
ADDED
|
@@ -0,0 +1,76 @@
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
| 1 |
+
from __future__ import annotations
|
| 2 |
+
from typing import Iterable
|
| 3 |
+
import gradio as gr
|
| 4 |
+
from gradio.themes.base import Base
|
| 5 |
+
from gradio.themes.utils import colors, fonts, sizes
|
| 6 |
+
from gradio.themes.utils.colors import Color
|
| 7 |
+
|
| 8 |
+
|
| 9 |
+
IBM_blue = Color(
|
| 10 |
+
name="blue",
|
| 11 |
+
c50="#edf5ff",
|
| 12 |
+
c100="#d0e2ff",
|
| 13 |
+
c200="#bfdbfe",
|
| 14 |
+
c300="#a6c8ff",
|
| 15 |
+
c400="#78a9ff",
|
| 16 |
+
c500="#4589ff",
|
| 17 |
+
c600="#0f62fe",
|
| 18 |
+
c700="#0043ce",
|
| 19 |
+
c800="#002d9c",
|
| 20 |
+
c900="#001d6c",
|
| 21 |
+
c950="#001141",
|
| 22 |
+
)
|
| 23 |
+
class IBMTheme(Base):
|
| 24 |
+
def __init__(
|
| 25 |
+
self,
|
| 26 |
+
*,
|
| 27 |
+
primary_hue: colors.Color | str = IBM_blue,
|
| 28 |
+
# secondary_hue: colors.Color | str = colors.blue,
|
| 29 |
+
# neutral_hue: colors.Color | str = colors.blue,
|
| 30 |
+
# spacing_size: sizes.Size | str = sizes.spacing_md,
|
| 31 |
+
# radius_size: sizes.Size | str = sizes.radius_md,
|
| 32 |
+
# text_size: sizes.Size | str = sizes.text_lg,
|
| 33 |
+
# font: fonts.Font
|
| 34 |
+
# | str
|
| 35 |
+
# | Iterable[fonts.Font | str] = (
|
| 36 |
+
# fonts.GoogleFont("Quicksand"),
|
| 37 |
+
# "ui-sans-serif",
|
| 38 |
+
# "sans-serif",
|
| 39 |
+
# ),
|
| 40 |
+
font_mono: fonts.Font
|
| 41 |
+
| str
|
| 42 |
+
| Iterable[fonts.Font | str] = (
|
| 43 |
+
fonts.GoogleFont("IBM Plex Mono"),
|
| 44 |
+
"ui-monospace",
|
| 45 |
+
"monospace",
|
| 46 |
+
),
|
| 47 |
+
):
|
| 48 |
+
super().__init__(
|
| 49 |
+
primary_hue=primary_hue,
|
| 50 |
+
# secondary_hue=secondary_hue,
|
| 51 |
+
# neutral_hue=neutral_hue,
|
| 52 |
+
# spacing_size=spacing_size,
|
| 53 |
+
# radius_size=radius_size,
|
| 54 |
+
# text_size=text_size,
|
| 55 |
+
# font=font,
|
| 56 |
+
font_mono=font_mono,
|
| 57 |
+
)
|
| 58 |
+
super().set(
|
| 59 |
+
body_background_fill="#8d8d8d @ 12%",
|
| 60 |
+
body_text_color_dark="white",
|
| 61 |
+
body_text_color="#161616",
|
| 62 |
+
body_background_fill_dark="",
|
| 63 |
+
# button_primary_background_fill="linear-gradient(90deg, *primary_300, *secondary_400)",
|
| 64 |
+
# button_primary_background_fill_hover="linear-gradient(90deg, *primary_200, *secondary_300)",
|
| 65 |
+
button_primary_text_color="white",
|
| 66 |
+
button_primary_text_color_dark="white",
|
| 67 |
+
# button_primary_background_fill_dark="linear-gradient(90deg, *primary_600, *secondary_800)",
|
| 68 |
+
# slider_color="*secondary_300",
|
| 69 |
+
# slider_color_dark="*secondary_600",
|
| 70 |
+
# block_title_text_weight="600",
|
| 71 |
+
block_border_width="3px",
|
| 72 |
+
block_border_color=IBM_blue.c500,
|
| 73 |
+
block_info_text_color="#990000",
|
| 74 |
+
# button_primary_shadow="*shadow_drop_lg",
|
| 75 |
+
# button_large_padding="32px",
|
| 76 |
+
)
|
modular.ipynb
ADDED
|
The diff for this file is too large to render.
See raw diff
|
|
|