Spaces:
Sleeping
Sleeping
File size: 17,984 Bytes
8715adc c8c1410 8715adc a18b22a 654a357 a18b22a 654a357 8715adc 654a357 8715adc 654a357 8715adc 654a357 8715adc 654a357 8715adc 654a357 8715adc 654a357 8715adc a18b22a 654a357 a18b22a 654a357 8715adc 654a357 a18b22a 654a357 a18b22a 654a357 a18b22a 654a357 a18b22a 8715adc a18b22a 8715adc a18b22a 8715adc a18b22a 8715adc 88d8634 8715adc f868a9f 8715adc c8c1410 8715adc c8c1410 8715adc c8c1410 8715adc 7595b98 8715adc a18b22a 8715adc 88d8634 8715adc 88d8634 8715adc a18b22a 8715adc | 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 | """
Codon Optimizer - Gradio Web Application
Based on GenScript GenSmart algorithm (Patent WO2020024917A1)
A multi-objective codon optimization tool using NSGA-III algorithm.
"""
import gradio as gr
from typing import Optional
import textwrap
from codon_tables import get_organism_list, CODON_TO_AA, AA_TO_CODONS
from indices import (
sequence_to_codons, codons_to_protein, calculate_cai, calculate_gc_content,
mRNAStructureAnalyzer, SEQFOLD_AVAILABLE
)
from optimizer import optimize_sequence, CodonOptimizer, SimpleOptimizer
# Restriction enzymes organized by type
# Only 6-cutters and above (6bp+ recognition sequences)
# Type II: Orthodox restriction enzymes that cut within or near recognition sequence
TYPE_II_ENZYMES = {
# 6-cutters (palindromic)
"AatII": "GACGTC",
"AccI": "GTMKAC", # Degenerate: GT(A/C)(G/T)AC
"AclI": "AACGTT",
"AfeI": "AGCGCT",
"AflII": "CTTAAG",
"AgeI": "ACCGGT",
"AhdI": "GACNNNNNGTC",
"AleI": "CACNNNNGTG",
"ApaI": "GGGCCC",
"ApaLI": "GTGCAC",
"AscI": "GGCGCGCC", # 8-cutter
"AseI": "ATTAAT",
"AsiSI": "GCGATCGC", # 8-cutter
"AvrII": "CCTAGG",
"BamHI": "GGATCC",
"BclI": "TGATCA",
"BglII": "AGATCT",
"BlpI": "GCTNAGC",
"BmtI": "GCTAGC",
"BsiWI": "CGTACG",
"BspEI": "TCCGGA",
"BspHI": "TCATGA",
"BsrGI": "TGTACA",
"BssHII": "GCGCGC",
"BstAPI": "GCANNNNNTGC",
"BstBI": "TTCGAA",
"BstEII": "GGTNACC",
"BstXI": "CCANNNNNNTGG",
"BstZ17I": "GTATAC",
"Cac8I": "GCNNGC",
"ClaI": "ATCGAT",
"DraI": "TTTAAA",
"DraIII": "CACNNNGTG",
"EagI": "CGGCCG",
"EcoRI": "GAATTC",
"EcoRV": "GATATC",
"FseI": "GGCCGGCC", # 8-cutter
"FspI": "TGCGCA",
"HincII": "GTYRAC",
"HindIII": "AAGCTT",
"HpaI": "GTTAAC",
"KasI": "GGCGCC",
"KpnI": "GGTACC",
"MfeI": "CAATTG",
"MluI": "ACGCGT",
"MscI": "TGGCCA",
"MspA1I": "CMGCKG",
"NaeI": "GCCGGC",
"NarI": "GGCGCC",
"NcoI": "CCATGG",
"NdeI": "CATATG",
"NgoMIV": "GCCGGC",
"NheI": "GCTAGC",
"NotI": "GCGGCCGC", # 8-cutter
"NruI": "TCGCGA",
"NsiI": "ATGCAT",
"NspI": "RCATGY",
"PacI": "TTAATTAA", # 8-cutter
"PciI": "ACATGT",
"PflMI": "CCANNNNNTGG",
"PmeI": "GTTTAAAC", # 8-cutter
"PmlI": "CACGTG",
"PpuMI": "RGGWCCY",
"PshAI": "GACNNNNGTC",
"PsiI": "TTATAA",
"PspOMI": "GGGCCC",
"PstI": "CTGCAG",
"PvuI": "CGATCG",
"PvuII": "CAGCTG",
"RsrII": "CGGWCCG",
"SacI": "GAGCTC",
"SacII": "CCGCGG",
"SalI": "GTCGAC",
"SbfI": "CCTGCAGG", # 8-cutter
"ScaI": "AGTACT",
"SexAI": "ACCWGGT",
"SfiI": "GGCCNNNNNGGCC",
"SfoI": "GGCGCC",
"SgrAI": "CRCCGGYG", # 8-cutter
"SmaI": "CCCGGG",
"SmlI": "CTYRAG",
"SnaBI": "TACGTA",
"SpeI": "ACTAGT",
"SphI": "GCATGC",
"SrfI": "GCCCGGGC", # 8-cutter
"SspI": "AATATT",
"StuI": "AGGCCT",
"SwaI": "ATTTAAAT", # 8-cutter
"TliI": "CTCGAG",
"TspMI": "CCCGGG",
"Tth111I": "GACNNNGTC",
"XbaI": "TCTAGA",
"XcmI": "CCANNNNNNNNNTGG",
"XhoI": "CTCGAG",
"XmaI": "CCCGGG",
"ZraI": "GACGTC",
}
# Type IIS: Cut outside recognition sequence (6bp+ only)
# Used in Golden Gate, MoClo, and other scarless cloning methods
TYPE_IIS_ENZYMES = {
"AarI": "CACCTGC", # 7bp
"BbsI": "GAAGAC", # 6bp - Golden Gate alternative
"BfuAI": "ACCTGC", # 6bp
"BpiI": "GAAGAC", # 6bp - BbsI isoschizomer
"BsaI": "GGTCTC", # 6bp - Golden Gate standard
"BsaI-HFv2": "GGTCTC", # 6bp - High-fidelity BsaI
"BseRI": "GAGGAG", # 6bp
"BsmBI": "CGTCTC", # 6bp - MoClo standard
"BspMI": "ACCTGC", # 6bp
"BtgZI": "GCGATG", # 6bp
"BtsI": "GCAGTG", # 6bp
"BspQI": "GCTCTTC", # 7bp - SapI isoschizomer
"Esp3I": "CGTCTC", # 6bp - BsmBI isoschizomer
"LguI": "GCTCTTC", # 7bp - SapI isoschizomer
"PaqCI": "CACCTGC", # 7bp - AarI isoschizomer
"SapI": "GCTCTTC", # 7bp - Used in SapTrap
}
# Type III: Require two recognition sites in inverse orientation (6bp+ only)
TYPE_III_ENZYMES = {
"EcoP15I": "CAGCAG", # 6bp
}
# Combine all for backward compatibility
COMMON_RESTRICTION_SITES = {**TYPE_II_ENZYMES, **TYPE_IIS_ENZYMES, **TYPE_III_ENZYMES}
# Create labeled choices for UI
def get_enzyme_choices():
"""Get enzyme choices with category labels for display."""
choices = []
# Type II
for name in sorted(TYPE_II_ENZYMES.keys()):
choices.append(f"[Type II] {name}")
# Type IIS
for name in sorted(TYPE_IIS_ENZYMES.keys()):
choices.append(f"[Type IIS] {name}")
# Type III
for name in sorted(TYPE_III_ENZYMES.keys()):
choices.append(f"[Type III] {name}")
return choices
def parse_enzyme_name(labeled_name: str) -> str:
"""Extract enzyme name from labeled choice."""
if "] " in labeled_name:
return labeled_name.split("] ")[1]
return labeled_name
def parse_sequence(sequence: str) -> tuple:
"""
Parse and validate input sequence.
Returns: (cleaned_sequence, is_protein, error_message)
"""
if not sequence or len(sequence.strip()) == 0:
return None, None, "Please enter a sequence"
# Clean sequence
cleaned = sequence.upper().replace(" ", "").replace("\n", "").replace("\r", "")
cleaned = ''.join(c for c in cleaned if c.isalpha())
if len(cleaned) == 0:
return None, None, "No valid characters found in sequence"
# Detect if protein or DNA
dna_chars = set('ATGC')
protein_chars = set('ACDEFGHIKLMNPQRSTVWY')
unique_chars = set(cleaned)
# If only ATGC, likely DNA
if unique_chars.issubset(dna_chars):
# Could be DNA or protein with limited amino acids
# Check length - if divisible by 3 and reasonably long, assume DNA
if len(cleaned) >= 30 and len(cleaned) % 3 == 0:
return cleaned, False, None # DNA
elif len(cleaned) < 30:
# Short sequence - could be either
return cleaned, True, None # Assume protein for short sequences
# If has characters outside ATGC, must be protein
if not unique_chars.issubset(dna_chars):
if unique_chars.issubset(protein_chars):
return cleaned, True, None # Protein
else:
invalid = unique_chars - protein_chars
return None, None, f"Invalid characters found: {invalid}"
return cleaned, False, None # Default to DNA
def format_sequence(sequence: str, line_length: int = 60) -> str:
"""Format sequence with line breaks for display."""
return '\n'.join(textwrap.wrap(sequence, line_length))
def get_excluded_sites(site_names: list) -> list:
"""Convert site names to sequences."""
sites = []
for name in site_names or []:
# Handle labeled names like "[Type II] EcoRI"
enzyme_name = parse_enzyme_name(name)
if enzyme_name in COMMON_RESTRICTION_SITES:
sites.append(COMMON_RESTRICTION_SITES[enzyme_name])
return sites
def optimize_codon(
input_sequence: str,
sequence_type: str,
organism: str,
type_ii_sites: list,
type_iis_sites: list,
type_iii_sites: list,
optimization_quality: str,
) -> tuple:
"""
Main optimization function for Gradio interface.
"""
# Parse sequence
cleaned, auto_is_protein, error = parse_sequence(input_sequence)
if error:
return error, "", "", "", ""
# Determine sequence type
if sequence_type == "Auto-detect":
is_protein = auto_is_protein
else:
is_protein = (sequence_type == "Protein")
# Combine all excluded restriction sites
all_excluded_sites = (type_ii_sites or []) + (type_iis_sites or []) + (type_iii_sites or [])
excluded = get_excluded_sites(all_excluded_sites)
# Map quality
quality_map = {
"Fast": "fast",
"Standard": "standard",
"Thorough": "thorough",
}
quality = quality_map.get(optimization_quality, "standard")
try:
# Run optimization
result = optimize_sequence(
sequence=cleaned,
organism=organism,
is_protein=is_protein,
excluded_sites=excluded,
use_nsga3=False, # Use fast hill-climbing optimizer
quality=quality
)
# Format outputs
input_info = f"""**Input Analysis:**
- Detected as: {'Protein' if is_protein else 'DNA'}
- {'Amino acids' if is_protein else 'Nucleotides'}: {len(cleaned)}
- Target organism: {organism}
"""
optimized_dna = format_sequence(result['optimized_dna'])
protein_seq = format_sequence(result['protein'])
metrics = result['metrics']
# Perform mRNA structure analysis
mrna_analyzer = mRNAStructureAnalyzer()
mrna_analysis = mrna_analyzer.analyze(result['optimized_dna'])
metrics_text = f"""**Optimization Metrics:**
| Metric | Value |
|--------|-------|
| Codon Adaptation Index (CAI) | {metrics['cai']:.3f} |
| Harmony Index | {metrics['harmony_index']:.3f} |
| Codon Context Index | {metrics['context_index']:.3f} |
| Outlier Index | {metrics['outlier_index']:.3f} |
| GC Content | {metrics['gc_content']:.1f}% |
| Sequence Length | {metrics['length_bp']} bp ({metrics['length_aa']} aa) |
"""
# Add mRNA structure metrics if available
if mrna_analysis['available']:
five_prime_status = "Good" if mrna_analysis['five_prime_mfe'] > -30 else "Warning: stable structure"
metrics_text += f"""**mRNA Secondary Structure:**
| Metric | Value | Status |
|--------|-------|--------|
| 5' Region MFE (50 nt) | {mrna_analysis['five_prime_mfe']:.1f} kcal/mol | {five_prime_status} |
| Full Sequence MFE | {mrna_analysis['full_mfe']:.1f} kcal/mol | - |
| Hairpins Detected | {mrna_analysis['hairpin_count']} | {"None" if mrna_analysis['hairpin_count'] == 0 else "Review recommended"} |
"""
else:
metrics_text += "*mRNA structure analysis not available (seqfold not installed)*\n\n"
metrics_text += """**Interpretation:**
- CAI: Higher is better (1.0 = perfect match to highly expressed genes)
- Harmony Index: Higher is better (codon usage match)
- Context Index: Higher is better (codon pair optimization)
- Outlier Index: Lower is better (fewer adverse features)
- GC Content: Optimal range is 40-60%
- 5' MFE: > -30 kcal/mol recommended (less stable = better translation initiation)
"""
# Generate codon comparison if input was DNA
if not is_protein:
original_codons = sequence_to_codons(cleaned)
optimized_codons = result['codons']
changes = 0
for i, (orig, opt) in enumerate(zip(original_codons, optimized_codons)):
if orig != opt:
changes += 1
comparison = f"\n**Codon Changes:** {changes} of {len(original_codons)} codons modified ({100*changes/len(original_codons):.1f}%)"
metrics_text += comparison
return input_info, optimized_dna, protein_seq, metrics_text, ""
except Exception as e:
return f"Error: {str(e)}", "", "", "", str(e)
def download_fasta(optimized_dna: str, organism: str) -> str:
"""Generate FASTA format for download."""
if not optimized_dna:
return ""
clean_dna = optimized_dna.replace('\n', '').replace(' ', '')
organism_short = organism.replace(' ', '_').replace('(', '').replace(')', '')
fasta = f">Optimized_sequence|{organism_short}|{len(clean_dna)}bp\n"
fasta += '\n'.join(textwrap.wrap(clean_dna, 60))
return fasta
# Example sequences
EXAMPLE_PROTEIN = """MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL
VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLV
NRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLAD
HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK"""
EXAMPLE_DNA = """ATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTAATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACATACGGAAAACTTACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACACTTGTCACTACTTTCTCTTATGGTGTTCAATGCTTTTCAAGATACCCAGATCATATGAAACAGCATGACTTTTTCAAGAGTGCCATGCCTGAAGGTTATGTACAGGAAAGAACTATATTTTTCAAAGATGACGGGAACTACAAGACACGTGCTGAAGTCAAGTTTGAAGGTGATACCCTTGTTAATAGAATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTTGGACACAAATTGGAATACAACTATAACTCACACAATGTATACATCATGGCAGACAAACAAAAGAATGGAATCAAAGTTAACTTCAAAATTAGACACAACATTGAAGATGGAAGCGTTCAACTAGCAGACCATTATCAACAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCATTACCTGTCCACACAATCTGCCCTTTCGAAAGATCCCAACGAAAAGAGAGACCACATGGTCCTTCTTGAGTTTGTAACAGCTGCTGGGATTACACATGGCATGGATGAACTATACAAATAA"""
# Build Gradio interface
with gr.Blocks(
title="Codon Optimizer",
theme=gr.themes.Soft(),
) as demo:
gr.Markdown("""
# Codon Optimizer
`joeyisgoed/codon-optimizer`
Multi-objective codon optimization tool based on the GenScript GenSmart algorithm.
Uses NSGA-III genetic algorithm to optimize for:
- **Harmony Index**: Match codon usage to highly-expressed genes
- **Codon Context Index**: Optimize codon pair preferences
- **Outlier Index**: Minimize adverse sequence features
Enter a protein or DNA sequence below to optimize it for your target expression host.
""")
with gr.Row():
with gr.Column(scale=1):
input_sequence = gr.Textbox(
label="Input Sequence",
placeholder="Paste your protein or DNA sequence here...",
lines=8,
max_lines=20,
)
with gr.Row():
sequence_type = gr.Radio(
choices=["Auto-detect", "Protein", "DNA"],
value="Auto-detect",
label="Sequence Type",
)
organism = gr.Dropdown(
choices=get_organism_list(),
value="Escherichia coli K12",
label="Target Organism",
)
with gr.Accordion("Exclude Restriction Sites", open=False):
gr.Markdown("*Select restriction enzyme sites to avoid in the optimized sequence*")
with gr.Accordion("Type II Enzymes (Standard)", open=False):
type_ii_sites = gr.CheckboxGroup(
choices=[f"[Type II] {name}" for name in sorted(TYPE_II_ENZYMES.keys())],
label="Type II",
info="Orthodox enzymes that cut within recognition sequence",
)
with gr.Accordion("Type IIS Enzymes (Golden Gate/MoClo)", open=True):
type_iis_sites = gr.CheckboxGroup(
choices=[f"[Type IIS] {name}" for name in sorted(TYPE_IIS_ENZYMES.keys())],
label="Type IIS",
info="Cut outside recognition site - used for scarless cloning",
)
with gr.Accordion("Type III Enzymes", open=False):
type_iii_sites = gr.CheckboxGroup(
choices=[f"[Type III] {name}" for name in sorted(TYPE_III_ENZYMES.keys())],
label="Type III",
info="Require two recognition sites in inverse orientation",
)
optimization_quality = gr.Radio(
choices=[
"Fast",
"Standard",
"Thorough",
],
value="Fast", # Default to fast for better UX
label="Optimization Quality",
)
with gr.Row():
optimize_btn = gr.Button("Optimize Sequence", variant="primary", size="lg")
clear_btn = gr.Button("Clear", size="lg")
with gr.Accordion("Example Sequences", open=False):
example_protein_btn = gr.Button("Load GFP Protein")
example_dna_btn = gr.Button("Load GFP DNA")
with gr.Column(scale=1):
input_info = gr.Markdown(label="Input Analysis")
optimized_dna = gr.Textbox(
label="Optimized DNA Sequence",
lines=8,
max_lines=20,
show_copy_button=True,
)
protein_output = gr.Textbox(
label="Protein Sequence",
lines=4,
max_lines=10,
show_copy_button=True,
)
metrics_output = gr.Markdown(label="Optimization Metrics")
error_output = gr.Textbox(label="Errors", visible=False)
# Event handlers
optimize_btn.click(
fn=optimize_codon,
inputs=[input_sequence, sequence_type, organism, type_ii_sites, type_iis_sites, type_iii_sites, optimization_quality],
outputs=[input_info, optimized_dna, protein_output, metrics_output, error_output],
)
clear_btn.click(
fn=lambda: ("", "", "", "", ""),
outputs=[input_info, optimized_dna, protein_output, metrics_output, error_output],
)
example_protein_btn.click(
fn=lambda: EXAMPLE_PROTEIN.replace('\n', ''),
outputs=[input_sequence],
)
example_dna_btn.click(
fn=lambda: EXAMPLE_DNA.replace('\n', ''),
outputs=[input_sequence],
)
gr.Markdown("""
---
### About
This tool implements a codon optimization algorithm inspired by GenScript's GenSmart system
([Patent WO2020024917A1](https://patents.google.com/patent/WO2020024917A1/en)).
**Features:**
- Multi-objective optimization using NSGA-III algorithm
- Support for 10 common expression hosts
- Optional restriction site exclusion
- Comprehensive optimization metrics
**References:**
- GenScript GenSmart Codon Optimization
- NSGA-III: Deb & Jain (2014)
- Codon Adaptation Index (CAI): Sharp & Li (1987)
""")
if __name__ == "__main__":
demo.launch()
|