Spaces:
Runtime error
Runtime error
xuyingli commited on
Commit ·
6cdc778
1
Parent(s): 9716a19
Update app.py
Browse files
app.py
CHANGED
|
@@ -314,7 +314,7 @@ if 'xq' not in st.session_state:
|
|
| 314 |
|
| 315 |
st.session_state.db_name_ref = 'default.esm_protein'
|
| 316 |
if option == function_list[0]:
|
| 317 |
-
sequence = st.text_input('protein sequence', '')
|
| 318 |
if st.button('Cas9 Enzyme'):
|
| 319 |
sequence = 'GSGHMDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRILYLQEIFSNEMAKV'
|
| 320 |
elif st.button('PETase'):
|
|
@@ -330,7 +330,7 @@ if 'xq' not in st.session_state:
|
|
| 330 |
(Rao et al. 2020) The MSA Transformer (ESM-MSA-1) takes a multiple sequence alignment (MSA) as input, and uses the tied row self-attention maps in the same way.""")
|
| 331 |
st.session_state['xq'] = st.session_state.model
|
| 332 |
elif option == function_list[1]:
|
| 333 |
-
sequence = st.text_input('protein sequence', '')
|
| 334 |
st.write('Try an example:')
|
| 335 |
if st.button('Cas9 Enzyme'):
|
| 336 |
sequence = 'GSGHMDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRILYLQEIFSNEMAKV'
|
|
@@ -391,7 +391,7 @@ else:
|
|
| 391 |
|
| 392 |
st.session_state.db_name_ref = 'default.esm_protein'
|
| 393 |
if option == 'self-contact prediction':
|
| 394 |
-
sequence = st.text_input('protein sequence', '')
|
| 395 |
if st.button('Cas9 Enzyme'):
|
| 396 |
sequence = 'GSGHMDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRILYLQEIFSNEMAKV'
|
| 397 |
elif st.button('PETase'):
|
|
@@ -406,7 +406,7 @@ else:
|
|
| 406 |
"""<span style="word-wrap:break-word;">Contact prediction is based on a logistic regression over the model's attention maps. This methodology is based on ICLR 2021 paper, Transformer protein language models are unsupervised structure learners. (Rao et al. 2020)The MSA Transformer (ESM-MSA-1) takes a multiple sequence alignment (MSA) as input, and uses the tied row self-attention maps in the same way.</span>
|
| 407 |
""", unsafe_allow_html=True)
|
| 408 |
elif option == 'search the database for similar proteins':
|
| 409 |
-
sequence = st.text_input('protein sequence', '')
|
| 410 |
st.write('Try an example:')
|
| 411 |
if st.button('Cas9 Enzyme'):
|
| 412 |
sequence = 'GSGHMDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRILYLQEIFSNEMAKV'
|
|
|
|
| 314 |
|
| 315 |
st.session_state.db_name_ref = 'default.esm_protein'
|
| 316 |
if option == function_list[0]:
|
| 317 |
+
sequence = st.text_input('protein sequence(Capital letters only)', '')
|
| 318 |
if st.button('Cas9 Enzyme'):
|
| 319 |
sequence = 'GSGHMDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRILYLQEIFSNEMAKV'
|
| 320 |
elif st.button('PETase'):
|
|
|
|
| 330 |
(Rao et al. 2020) The MSA Transformer (ESM-MSA-1) takes a multiple sequence alignment (MSA) as input, and uses the tied row self-attention maps in the same way.""")
|
| 331 |
st.session_state['xq'] = st.session_state.model
|
| 332 |
elif option == function_list[1]:
|
| 333 |
+
sequence = st.text_input('protein sequence(Capital letters only)', '')
|
| 334 |
st.write('Try an example:')
|
| 335 |
if st.button('Cas9 Enzyme'):
|
| 336 |
sequence = 'GSGHMDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRILYLQEIFSNEMAKV'
|
|
|
|
| 391 |
|
| 392 |
st.session_state.db_name_ref = 'default.esm_protein'
|
| 393 |
if option == 'self-contact prediction':
|
| 394 |
+
sequence = st.text_input('protein sequence(Capital letters only)', '')
|
| 395 |
if st.button('Cas9 Enzyme'):
|
| 396 |
sequence = 'GSGHMDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRILYLQEIFSNEMAKV'
|
| 397 |
elif st.button('PETase'):
|
|
|
|
| 406 |
"""<span style="word-wrap:break-word;">Contact prediction is based on a logistic regression over the model's attention maps. This methodology is based on ICLR 2021 paper, Transformer protein language models are unsupervised structure learners. (Rao et al. 2020)The MSA Transformer (ESM-MSA-1) takes a multiple sequence alignment (MSA) as input, and uses the tied row self-attention maps in the same way.</span>
|
| 407 |
""", unsafe_allow_html=True)
|
| 408 |
elif option == 'search the database for similar proteins':
|
| 409 |
+
sequence = st.text_input('protein sequence(Capital letters only)', '')
|
| 410 |
st.write('Try an example:')
|
| 411 |
if st.button('Cas9 Enzyme'):
|
| 412 |
sequence = 'GSGHMDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRILYLQEIFSNEMAKV'
|