Update app.py

app.py

@@ -241,8 +241,11 @@ def dna_embed(seq: str, model_name: str = "zhihan1996/DNABERT-2-117M") -> Dict:
         except ImportError:
             return {"error": "einops package required. Installing..."}
         
-        tokenizer = AutoTokenizer.from_pretrained(model_name, trust_remote_code=True)
-        model = AutoModel.from_pretrained(model_name, trust_remote_code=True)
+        # DNABERT-2 특별 처리
+        from transformers import BertModel, BertTokenizer
+        
+        tokenizer = BertTokenizer.from_pretrained(model_name, trust_remote_code=True)
+        model = BertModel.from_pretrained(model_name, trust_remote_code=True)
         model.eval()
         
         with torch.no_grad():
@@ -289,18 +292,34 @@ def build_context(query: str, docs: List[str], index, model, use_web: bool, web_
 def answer_question(query: str, context: str) -> str:
     """Generate answer"""
     system = (
-        "You are a bioinformatics assistant. Be concise and factual. "
-        "Never give medical advice. Answer in the user's language."
+        "You are an expert bioinformatics assistant who explains complex biological concepts in an accessible way. "
+        "Your responses should be:\n"
+        "1. Comprehensive yet easy to understand\n"
+        "2. Well-structured with clear sections\n"
+        "3. Include relevant examples and analogies\n"
+        "4. Provide actionable insights when appropriate\n"
+        "5. Use Korean if the user writes in Korean, otherwise English\n"
+        "6. Never provide medical diagnosis or treatment advice\n"
+        "7. Format your response with headers, bullet points, and clear paragraphs\n"
+        "8. Aim for 300-500 words minimum for complex questions"
     )
     
-    user_msg = f"Context:\n{context}\n\nQuestion: {query}"
+    user_msg = f"""Context information:\n{context}\n\n
+User Question: {query}
+
+Please provide a detailed, well-structured response that:
+- Directly answers the question
+- Explains the biological background
+- Includes practical implications when relevant
+- Uses simple analogies to explain complex concepts
+- Cites the context when appropriate"""
     
     messages = [
         {"role": "system", "content": system},
         {"role": "user", "content": user_msg}
     ]
     
-    return call_llm(messages, temperature=0.4, max_tokens=1000)
+    return call_llm(messages, temperature=0.4, max_tokens=1500)
 
 # --------------- Streamlit UI ---------------
 
@@ -423,73 +442,191 @@ with tab1:
 with tab2:
     st.subheader("🧬 Protein Analysis")
     
+    st.info("""
+    **단백질 서열 분석이란?**
+    - 단백질의 아미노산 서열을 AI가 분석하여 기능과 구조를 예측합니다
+    - ESM-2는 Meta가 개발한 AI로, 6억 5천만개 단백질을 학습했습니다
+    - 용도: 신약 개발, 질병 연구, 진화 분석 등
+    """)
+    
     protein_seq = st.text_area(
-        "Enter protein sequence:",
+        "단백질 서열 입력 (복사-붙여넣기 가능):",
         value="MKTIIALSYIFCLVFA",
+        help="단백질 서열은 20개 아미노산 문자(A,C,D,E,F,G,H,I,K,L,M,N,P,Q,R,S,T,V,W,Y)로 구성됩니다",
         height=100
     )
     
-    col1, col2 = st.columns(2)
-    
+    st.markdown("**예제 서열 (클릭해서 복사):**")
+    col1, col2, col3 = st.columns(3)
     with col1:
-        if st.button("Analyze Protein"):
-            seq = protein_seq.strip().upper()
-            
-            # Basic stats
-            st.write(f"**Length:** {len(seq)}")
-            st.write(f"**Unique AAs:** {len(set(seq))}")
-            
-            # ESM-2 embedding
-            if TORCH_AVAILABLE and TRANSFORMERS_AVAILABLE:
-                with st.spinner("Computing embedding..."):
-                    result = esm2_embed(seq, esm_model)
-                    if "error" in result:
-                        st.error(result["error"])
-                    else:
-                        st.success(f"Embedding size: {result['size']}")
-                        st.json({"preview": result["embedding"][:5]})
-            else:
-                st.warning("PyTorch not available for embeddings")
-    
+        if st.button("인슐린", key="ins"):
+            st.code("FVNQHLCGSHLVEALYLVCGERGFFYTPKT", language=None)
     with col2:
-        st.info("Amino acid composition and structure prediction features coming soon")
+        if st.button("엔돌핀", key="end"):
+            st.code("YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE", language=None)
+    with col3:
+        if st.button("옥시토신", key="oxy"):
+            st.code("CYIQNCPLG", language=None)
+    
+    if st.button("🔬 단백질 분석 시작", type="primary"):
+        seq = protein_seq.strip().upper()
+        
+        # Basic stats
+        st.markdown("### 📊 기본 분석 결과")
+        col1, col2 = st.columns(2)
+        
+        with col1:
+            st.metric("서열 길이", f"{len(seq)} 아미노산")
+            st.metric("분자량 (추정)", f"~{len(seq) * 110} Da")
+            
+        with col2:
+            unique_aa = len(set(seq))
+            st.metric("사용된 아미노산 종류", f"{unique_aa}개")
+            hydrophobic = sum(1 for aa in seq if aa in "AVILMFYW")
+            st.metric("소수성 비율", f"{hydrophobic/len(seq)*100:.1f}%")
+        
+        # AI Analysis
+        if TORCH_AVAILABLE and TRANSFORMERS_AVAILABLE:
+            st.markdown("### 🤖 AI 임베딩 분석")
+            with st.spinner("AI 모델이 단백질을 분석중... (10-30초)"):
+                result = esm2_embed(seq, esm_model)
+                if "error" in result:
+                    st.error(result["error"])
+                else:
+                    st.success("✅ AI 분석 완료!")
+                    
+                    col1, col2 = st.columns(2)
+                    with col1:
+                        st.metric("벡터 차원", result['size'])
+                        st.caption("이 숫자들은 단백질의 특성을 수치화한 것입니다")
+                    
+                    with col2:
+                        st.markdown("**임베딩 벡터 미리보기:**")
+                        st.code(result["embedding"][:5])
+                    
+                    st.markdown("""
+                    **🎯 이 분석의 활용:**
+                    - 유사한 기능의 단백질 찾기
+                    - 구조 예측의 기초 데이터
+                    - 돌연변이 영향 예측
+                    - 신약 타겟 발굴
+                    """)
+        else:
+            st.warning("⚠️ AI 모델 로딩 중... 잠시 후 다시 시도해주세요")
 
 # DNA tab
 with tab3:
     st.subheader("🧬 DNA Analysis")
     
+    st.info("""
+    **DNA 서열 분석이란?**
+    - DNA의 염기서열(A,T,G,C)을 AI가 분석하여 기능을 예측합니다
+    - DNABERT-2는 인간 게놈 전체를 학습한 AI 모델입니다
+    - 용도: 유전자 기능 예측, 질병 변이 발견, 진화 연구 등
+    """)
+    
     dna_seq = st.text_area(
-        "Enter DNA sequence:",
+        "DNA 서열 입력 (복사-붙여넣기 가능):",
         value="ATGCGATCGTAGC",
+        help="DNA는 4개 염기(A: 아데닌, T: 티민, G: 구아닌, C: 시토신)로 구성됩니다",
         height=100
     )
     
-    col1, col2 = st.columns(2)
-    
+    st.markdown("**예제 서열 (클릭해서 복사):**")
+    col1, col2, col3 = st.columns(3)
     with col1:
-        if st.button("Analyze DNA"):
-            seq = dna_seq.strip().upper()
+        if st.button("TATA 박스", key="tata"):
+            st.code("GCGCGATATAAAGGCGCGGGCGCGCG", language=None)
+            st.caption("유전자 발현 시작 신호")
+    with col2:
+        if st.button("프로모터", key="prom"):
+            st.code("TTGACAGGCTAGCTCAGTCCTAGGTATAATGCTAGC", language=None)
+            st.caption("유전자 조절 영역")
+    with col3:
+        if st.button("CRISPR 타겟", key="crispr"):
+            st.code("GTCACCTCCAATGACTAGGGTGG", language=None)
+            st.caption("유전자 편집 부위")
+    
+    if st.button("🔬 DNA 분석 시작", type="primary"):
+        seq = dna_seq.strip().upper().replace("U", "T")  # RNA의 U를 T로 변환
+        seq = ''.join(c for c in seq if c in 'ATGC')  # ATGC만 남기기
+        
+        if len(seq) < 3:
+            st.error("최소 3개 이상의 염기를 입력해주세요")
+        else:
+            st.markdown("### 📊 기본 분석 결과")
+            col1, col2 = st.columns(2)
             
-            # GC content
-            gc = (seq.count("G") + seq.count("C")) / len(seq) if seq else 0
+            with col1:
+                st.metric("서열 길이", f"{len(seq)} bp")
+                gc = (seq.count("G") + seq.count("C")) / len(seq) * 100
+                st.metric("GC 함량", f"{gc:.1f}%")
+                if gc > 60:
+                    st.caption("🔴 높음: 안정적이지만 복제 어려움")
+                elif gc < 40:
+                    st.caption("🔵 낮음: 불안정하지만 복제 용이")
+                else:
+                    st.caption("🟢 적정: 일반적인 범위")
             
-            st.write(f"**Length:** {len(seq)}")
-            st.write(f"**GC Content:** {gc:.2%}")
+            with col2:
+                at = (seq.count("A") + seq.count("T")) / len(seq) * 100
+                st.metric("AT 함량", f"{at:.1f}%")
+                
+                # 코돈 분석 (3의 배수인 경우)
+                if len(seq) % 3 == 0:
+                    st.metric("가능한 코돈 수", f"{len(seq)//3}개")
+                    st.caption("단백질로 번역 가능")
+            
+            # 특별 서열 찾기
+            st.markdown("### 🔍 주요 모티프 검색")
+            motifs_found = []
             
-            # DNA embedding
+            if "TATAAAA" in seq or "TATAAA" in seq:
+                motifs_found.append("✅ TATA box 발견 (전사 시작 신호)")
+            if "CAAT" in seq or "CCAAT" in seq:
+                motifs_found.append("✅ CAAT box 발견 (전사 조절)")
+            if "ATG" in seq:
+                motifs_found.append("✅ 시작 코돈(ATG) 발견")
+            if "TAA" in seq or "TAG" in seq or "TGA" in seq:
+                motifs_found.append("✅ 정지 코돈 발견")
+            if seq.count("CG") > len(seq)/20:
+                motifs_found.append("✅ CpG 섬 가능성 (유전자 조절)")
+            
+            if motifs_found:
+                for motif in motifs_found:
+                    st.write(motif)
+            else:
+                st.write("특별한 모티프가 발견되지 않았습니다")
+            
+            # AI Analysis
             if TORCH_AVAILABLE and TRANSFORMERS_AVAILABLE:
-                with st.spinner("Computing embedding..."):
+                st.markdown("### 🤖 AI 임베딩 분석")
+                with st.spinner("AI 모델이 DNA를 분석중... (10-30초)"):
                     result = dna_embed(seq, dna_model)
                     if "error" in result:
                         st.error(result["error"])
                     else:
-                        st.success(f"Embedding size: {result['size']}")
-                        st.json({"preview": result["embedding"][:5]})
+                        st.success("✅ AI 분석 완료!")
+                        
+                        col1, col2 = st.columns(2)
+                        with col1:
+                            st.metric("벡터 차원", result['size'])
+                            st.caption("DNA 특성을 수치화한 결과입니다")
+                        
+                        with col2:
+                            st.markdown("**임베딩 벡터 미리보기:**")
+                            st.code(result["embedding"][:5])
+                        
+                        st.markdown("""
+                        **🎯 이 분석의 활용:**
+                        - 유전자 기능 예측
+                        - 프로모터/인핸서 찾기
+                        - 진화적 보존 영역 발견
+                        - 질병 관련 변이 예측
+                        - CRISPR 타겟 부위 평가
+                        """)
             else:
-                st.warning("PyTorch not available for embeddings")
-    
-    with col2:
-        st.info("Motif analysis and structure prediction coming soon")
+                st.warning("⚠️ AI 모델 로딩 중... 잠시 후 다시 시도해주세요")
 
 # About tab
 with tab4: