""" File: CodonPrediction.py --------------------------- Includes functions to tokenize input, load models, infer predicted dna sequences and helper functions related to processing data for passing to the model. """ import warnings from typing import Any, Dict, List, Optional, Tuple, Union import heapq from dataclasses import dataclass import numpy as np import onnxruntime as rt import torch import transformers from transformers import ( AutoTokenizer, BatchEncoding, BigBirdConfig, BigBirdForMaskedLM, PreTrainedTokenizerFast, ) from CodonTransformer.CodonData import get_merged_seq from CodonTransformer.CodonUtils import ( AMINO_ACID_TO_INDEX, INDEX2TOKEN, NUM_ORGANISMS, ORGANISM2ID, TOKEN2INDEX, DNASequencePrediction, GC_COUNTS_PER_TOKEN, CODON_GC_CONTENT, AA_MIN_GC, AA_MAX_GC, ) def predict_dna_sequence( protein: str, organism: Union[int, str], device: torch.device, tokenizer: Union[str, PreTrainedTokenizerFast] = None, model: Union[str, torch.nn.Module] = None, attention_type: str = "original_full", deterministic: bool = True, temperature: float = 0.2, top_p: float = 0.95, num_sequences: int = 1, match_protein: bool = False, use_constrained_search: bool = False, gc_bounds: Tuple[float, float] = (0.30, 0.70), beam_size: int = 5, length_penalty: float = 1.0, diversity_penalty: float = 0.0, ) -> Union[DNASequencePrediction, List[DNASequencePrediction]]: """ Predict the DNA sequence(s) for a given protein using the CodonTransformer model. This function takes a protein sequence and an organism (as ID or name) as input and returns the predicted DNA sequence(s) using the CodonTransformer model. It can use either provided tokenizer and model objects or load them from specified paths. Args: protein (str): The input protein sequence for which to predict the DNA sequence. organism (Union[int, str]): Either the ID of the organism or its name (e.g., "Escherichia coli general"). If a string is provided, it will be converted to the corresponding ID using ORGANISM2ID. device (torch.device): The device (CPU or GPU) to run the model on. tokenizer (Union[str, PreTrainedTokenizerFast, None], optional): Either a file path to load the tokenizer from, a pre-loaded tokenizer object, or None. If None, it will be loaded from HuggingFace. Defaults to None. model (Union[str, torch.nn.Module, None], optional): Either a file path to load the model from, a pre-loaded model object, or None. If None, it will be loaded from HuggingFace. Defaults to None. attention_type (str, optional): The type of attention mechanism to use in the model. Can be either 'block_sparse' or 'original_full'. Defaults to "original_full". deterministic (bool, optional): Whether to use deterministic decoding (most likely tokens). If False, samples tokens according to their probabilities adjusted by the temperature. Defaults to True. temperature (float, optional): A value controlling the randomness of predictions during non-deterministic decoding. Lower values (e.g., 0.2) make the model more conservative, while higher values (e.g., 0.8) increase randomness. Using high temperatures may result in prediction of DNA sequences that do not translate to the input protein. Recommended values are: - Low randomness: 0.2 - Medium randomness: 0.5 - High randomness: 0.8 The temperature must be a positive float. Defaults to 0.2. top_p (float, optional): The cumulative probability threshold for nucleus sampling. Tokens with cumulative probability up to top_p are considered for sampling. This parameter helps balance diversity and coherence in the predicted DNA sequences. The value must be a float between 0 and 1. Defaults to 0.95. num_sequences (int, optional): The number of DNA sequences to generate. Only applicable when deterministic is False. Defaults to 1. match_protein (bool, optional): Ensures the predicted DNA sequence is translated to the input protein sequence by sampling from only the respective codons of given amino acids. Defaults to False. use_constrained_search (bool, optional): Whether to use constrained beam search with GC content bounds. Defaults to False. gc_bounds (Tuple[float, float], optional): GC content bounds (min, max) for constrained search. Defaults to (0.30, 0.70). beam_size (int, optional): Beam size for constrained search. Defaults to 5. length_penalty (float, optional): Length penalty for beam search scoring. Defaults to 1.0. diversity_penalty (float, optional): Diversity penalty to reduce repetitive sequences. Defaults to 0.0. Returns: Union[DNASequencePrediction, List[DNASequencePrediction]]: An object or list of objects containing the prediction results: - organism (str): Name of the organism used for prediction. - protein (str): Input protein sequence for which DNA sequence is predicted. - processed_input (str): Processed input sequence (merged protein and DNA). - predicted_dna (str): Predicted DNA sequence. Raises: ValueError: If the protein sequence is empty, if the organism is invalid, if the temperature is not a positive float, if top_p is not between 0 and 1, or if num_sequences is less than 1 or used with deterministic mode. Note: This function uses ORGANISM2ID, INDEX2TOKEN, and AMINO_ACID_TO_INDEX dictionaries imported from CodonTransformer.CodonUtils. ORGANISM2ID maps organism names to their corresponding IDs. INDEX2TOKEN maps model output indices (token IDs) to respective codons. AMINO_ACID_TO_INDEX maps each amino acid and stop symbol to indices of codon tokens that translate to it. Example: >>> import torch >>> from transformers import AutoTokenizer, BigBirdForMaskedLM >>> from CodonTransformer.CodonPrediction import predict_dna_sequence >>> from CodonTransformer.CodonJupyter import format_model_output >>> >>> # Set up device >>> device = torch.device("cuda" if torch.cuda.is_available() else "cpu") >>> >>> # Load tokenizer and model >>> tokenizer = AutoTokenizer.from_pretrained("adibvafa/CodonTransformer") >>> model = BigBirdForMaskedLM.from_pretrained("adibvafa/CodonTransformer") >>> model = model.to(device) >>> >>> # Define protein sequence and organism >>> protein = "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLA" >>> organism = "Escherichia coli general" >>> >>> # Predict DNA sequence with deterministic decoding (single sequence) >>> output = predict_dna_sequence( ... protein=protein, ... organism=organism, ... device=device, ... tokenizer=tokenizer, ... model=model, ... attention_type="original_full", ... deterministic=True ... ) >>> >>> # Predict DNA sequence with constrained beam search >>> output_constrained = predict_dna_sequence( ... protein=protein, ... organism=organism, ... device=device, ... tokenizer=tokenizer, ... model=model, ... use_constrained_search=True, ... gc_bounds=(0.40, 0.60), ... beam_size=10, ... length_penalty=1.2, ... diversity_penalty=0.1 ... ) >>> >>> # Predict multiple DNA sequences with low randomness and top_p sampling >>> output_random = predict_dna_sequence( ... protein=protein, ... organism=organism, ... device=device, ... tokenizer=tokenizer, ... model=model, ... attention_type="original_full", ... deterministic=False, ... temperature=0.2, ... top_p=0.95, ... num_sequences=3 ... ) >>> >>> print(format_model_output(output)) >>> for i, seq in enumerate(output_random, 1): ... print(f"Sequence {i}:") ... print(format_model_output(seq)) ... print() """ if not protein: raise ValueError("Protein sequence cannot be empty.") if not isinstance(temperature, (float, int)) or temperature <= 0: raise ValueError("Temperature must be a positive float.") if not isinstance(top_p, (float, int)) or not 0 < top_p <= 1.0: raise ValueError("top_p must be a float between 0 and 1.") if not isinstance(num_sequences, int) or num_sequences < 1: raise ValueError("num_sequences must be a positive integer.") if use_constrained_search: if not isinstance(gc_bounds, tuple) or len(gc_bounds) != 2: raise ValueError("gc_bounds must be a tuple of (min_gc, max_gc).") if not (0.0 <= gc_bounds[0] <= gc_bounds[1] <= 1.0): raise ValueError("gc_bounds must be between 0.0 and 1.0 with min <= max.") if not isinstance(beam_size, int) or beam_size < 1: raise ValueError("beam_size must be a positive integer.") if deterministic and num_sequences > 1 and not use_constrained_search: raise ValueError( "Multiple sequences can only be generated in non-deterministic mode " "(unless using constrained search)." ) if use_constrained_search and num_sequences > 1: raise ValueError( "Constrained beam search currently supports only single sequence generation." ) # Load tokenizer if not isinstance(tokenizer, PreTrainedTokenizerFast): tokenizer = load_tokenizer(tokenizer) # Load model if not isinstance(model, torch.nn.Module): model = load_model(model_path=model, device=device, attention_type=attention_type) else: model.eval() model.bert.set_attention_type(attention_type) model.to(device) # Validate organism and convert to organism_id and organism_name organism_id, organism_name = validate_and_convert_organism(organism) # Inference loop with torch.no_grad(): # Tokenize the input sequence merged_seq = get_merged_seq(protein=protein, dna="") input_dict = { "idx": 0, # sample index "codons": merged_seq, "organism": organism_id, } tokenized_input = tokenize([input_dict], tokenizer=tokenizer).to(device) # Get the model predictions output_dict = model(**tokenized_input, return_dict=True) logits = output_dict.logits.detach().cpu() logits = logits[:, 1:-1, :] # Remove [CLS] and [SEP] tokens # Mask the logits of codons that do not correspond to the input protein sequence if match_protein: possible_tokens_per_position = [ AMINO_ACID_TO_INDEX[token[0]] for token in merged_seq.split(" ") ] seq_len = logits.shape[1] if len(possible_tokens_per_position) > seq_len: possible_tokens_per_position = possible_tokens_per_position[:seq_len] mask = torch.full_like(logits, float("-inf")) for pos, possible_tokens in enumerate(possible_tokens_per_position): mask[:, pos, possible_tokens] = 0 logits = mask + logits predictions = [] for _ in range(num_sequences): # Decode the predicted DNA sequence from the model output if use_constrained_search: # Use constrained beam search with GC bounds predicted_indices = constrained_beam_search_simple( logits=logits.squeeze(0), protein_sequence=protein, gc_bounds=gc_bounds, max_attempts=50, ) elif deterministic: predicted_indices = logits.argmax(dim=-1).squeeze().tolist() else: predicted_indices = sample_non_deterministic( logits=logits, temperature=temperature, top_p=top_p ) predicted_dna = list(map(INDEX2TOKEN.__getitem__, predicted_indices)) predicted_dna = ( "".join([token[-3:] for token in predicted_dna]).strip().upper() ) predictions.append( DNASequencePrediction( organism=organism_name, protein=protein, processed_input=merged_seq, predicted_dna=predicted_dna, ) ) return predictions[0] if num_sequences == 1 else predictions @dataclass class BeamCandidate: """Represents a candidate sequence in the beam search.""" tokens: List[int] score: float gc_count: int length: int def __post_init__(self): self.gc_ratio = self.gc_count / max(self.length, 1) def __lt__(self, other): return self.score < other.score def _calculate_true_future_gc_range( current_pos: int, protein_sequence: str, current_gc_count: int, current_length: int ) -> Tuple[float, float]: """ Calculate the true minimum and maximum possible final GC content given current state and remaining amino acids (perfect foresight). Args: current_pos: Current position in protein sequence protein_sequence: Full protein sequence current_gc_count: Current GC count in partial sequence current_length: Current length in nucleotides Returns: Tuple of (min_possible_final_gc_ratio, max_possible_final_gc_ratio) """ if current_pos >= len(protein_sequence): # Already at end, return current ratio final_ratio = current_gc_count / max(current_length, 1) return final_ratio, final_ratio # Calculate remaining amino acids remaining_aas = protein_sequence[current_pos:] # Calculate min/max possible GC from remaining amino acids min_future_gc = 0 max_future_gc = 0 for aa in remaining_aas: if aa.upper() in AA_MIN_GC and aa.upper() in AA_MAX_GC: min_future_gc += AA_MIN_GC[aa.upper()] max_future_gc += AA_MAX_GC[aa.upper()] else: # If amino acid not found, assume moderate GC (1-2 range) min_future_gc += 1 max_future_gc += 2 # Calculate final sequence length final_length = current_length + len(remaining_aas) * 3 # Calculate min/max possible final GC ratios min_final_gc_ratio = (current_gc_count + min_future_gc) / final_length max_final_gc_ratio = (current_gc_count + max_future_gc) / final_length return min_final_gc_ratio, max_final_gc_ratio def constrained_beam_search_simple( logits: torch.Tensor, protein_sequence: str, gc_bounds: Tuple[float, float] = (0.30, 0.70), max_attempts: int = 100, ) -> List[int]: """ Simple constrained search - try multiple greedy samples and pick best one within GC bounds. """ min_gc, max_gc = gc_bounds seq_len = min(logits.shape[0], len(protein_sequence)) # Convert to probabilities probs = torch.softmax(logits, dim=-1) valid_sequences = [] for attempt in range(max_attempts): tokens = [] total_gc = 0 # Generate sequence position by position for pos in range(seq_len): aa = protein_sequence[pos] possible_tokens = AMINO_ACID_TO_INDEX.get(aa, []) if not possible_tokens: continue # Filter tokens by current constraints and get probabilities candidates = [] for token_idx in possible_tokens: if token_idx < len(probs[pos]) and token_idx < len(GC_COUNTS_PER_TOKEN): prob = probs[pos][token_idx].item() gc_contribution = int(GC_COUNTS_PER_TOKEN[token_idx].item()) # Check if this token could still lead to a valid final sequence (perfect foresight) new_gc_total = total_gc + gc_contribution new_length = (pos + 1) * 3 # Calculate what's possible for the final sequence given this choice min_final_gc, max_final_gc = _calculate_true_future_gc_range( pos + 1, protein_sequence, new_gc_total, new_length ) # Only prune if there's NO OVERLAP between possible final range and target bounds if max_final_gc >= min_gc and min_final_gc <= max_gc: # Calculate gentle GC penalty to steer toward target center target_gc = (min_gc + max_gc) / 2 # Target center (e.g., 0.50 for bounds 0.45-0.55) current_projected_gc = (min_final_gc + max_final_gc) / 2 # Projected center # Only apply penalty if we're significantly off-target AND late in sequence sequence_progress = (pos + 1) / seq_len if sequence_progress > 0.3: # Only apply penalty after 30% of sequence gc_deviation = abs(current_projected_gc - target_gc) if gc_deviation > 0.05: # Only if >5% deviation from target # Gentle penalty: reduce probability by small factor penalty_factor = max(0.7, 1.0 - 0.3 * gc_deviation) # 0.7-1.0 range prob = prob * penalty_factor candidates.append((token_idx, prob, gc_contribution)) if not candidates: # If no valid candidates, break and try next attempt break # Sample from valid candidates (with temperature) if attempt == 0: # First attempt: greedy (highest probability) best_token = max(candidates, key=lambda x: x[1]) else: # Other attempts: sample with some randomness probs_list = [c[1] for c in candidates] if sum(probs_list) > 0: # Normalize probabilities probs_array = np.array(probs_list) probs_array = probs_array / probs_array.sum() # Sample chosen_idx = np.random.choice(len(candidates), p=probs_array) best_token = candidates[chosen_idx] else: best_token = candidates[0] tokens.append(best_token[0]) total_gc += best_token[2] # Check if we got a complete sequence if len(tokens) == seq_len: final_gc_ratio = total_gc / (seq_len * 3) if min_gc <= final_gc_ratio <= max_gc: # Calculate sequence score (sum of log probabilities) score = sum(np.log(probs[i][tokens[i]].item() + 1e-8) for i in range(len(tokens))) valid_sequences.append((tokens, score, final_gc_ratio)) if not valid_sequences: raise ValueError(f"Could not generate valid sequence within GC bounds {gc_bounds} after {max_attempts} attempts") # Return the sequence with highest score best_sequence = max(valid_sequences, key=lambda x: x[1]) return best_sequence[0] def constrained_beam_search( logits: torch.Tensor, protein_sequence: str, gc_bounds: Tuple[float, float] = (0.30, 0.70), beam_size: int = 5, length_penalty: float = 1.0, diversity_penalty: float = 0.0, temperature: float = 1.0, max_candidates: int = 100, position_aware_gc_penalty: bool = True, gc_penalty_strength: float = 2.0, ) -> List[int]: """ Constrained beam search with exact per-residue GC bounds tracking. Priority #1: Exact per-residue GC bounds tracking - Tracks cumulative GC content after each codon selection - Prunes candidates that would violate GC bounds - Maintains beam of valid candidates Priority #2: Position-aware GC penalty mechanism - Applies variable penalty weights based on sequence position - Preserves flexibility early, applies pressure when necessary - Uses progressive penalty scaling based on deviation severity Args: logits (torch.Tensor): Model logits of shape [seq_len, vocab_size] protein_sequence (str): Input protein sequence gc_bounds (Tuple[float, float]): (min_gc, max_gc) bounds beam_size (int): Number of candidates to maintain length_penalty (float): Length penalty for scoring diversity_penalty (float): Diversity penalty for scoring temperature (float): Temperature for probability scaling max_candidates (int): Maximum candidates to consider per position position_aware_gc_penalty (bool): Whether to use position-aware GC penalties gc_penalty_strength (float): Strength of GC penalty adjustment Returns: List[int]: Best sequence token indices """ min_gc, max_gc = gc_bounds seq_len = logits.shape[0] protein_len = len(protein_sequence) # Ensure we don't go beyond the protein sequence if seq_len > protein_len: print(f"Warning: logits length ({seq_len}) > protein length ({protein_len}). Truncating to protein length.") seq_len = protein_len logits = logits[:protein_len] # Initialize beam with empty candidate beam = [BeamCandidate(tokens=[], score=0.0, gc_count=0, length=0)] # Apply temperature scaling if temperature != 1.0: logits = logits / temperature # Convert to probabilities probs = torch.softmax(logits, dim=-1) for pos in range(min(seq_len, len(protein_sequence))): # Get possible tokens for current amino acid aa = protein_sequence[pos] possible_tokens = AMINO_ACID_TO_INDEX.get(aa, []) if not possible_tokens: # Fallback to all tokens if amino acid not found possible_tokens = list(range(probs.shape[1])) # Get top candidates for this position pos_probs = probs[pos] top_candidates = [] for token_idx in possible_tokens: if token_idx < len(pos_probs) and token_idx < len(GC_COUNTS_PER_TOKEN): prob = pos_probs[token_idx].item() gc_contribution = int(GC_COUNTS_PER_TOKEN[token_idx].item()) # Only include tokens with valid probabilities if prob > 1e-10: # Avoid extremely low probabilities top_candidates.append((token_idx, prob, gc_contribution)) # Sort by probability and take top max_candidates top_candidates.sort(key=lambda x: x[1], reverse=True) top_candidates = top_candidates[:max_candidates] # If no valid candidates found, fallback to all possible tokens for this amino acid if not top_candidates: for token_idx in possible_tokens[:min(len(possible_tokens), max_candidates)]: if token_idx < len(pos_probs) and token_idx < len(GC_COUNTS_PER_TOKEN): prob = max(pos_probs[token_idx].item(), 1e-10) # Ensure minimum probability gc_contribution = int(GC_COUNTS_PER_TOKEN[token_idx].item()) top_candidates.append((token_idx, prob, gc_contribution)) # Generate new beam candidates new_beam = [] for candidate in beam: for token_idx, prob, gc_contribution in top_candidates: # Calculate new GC stats new_gc_count = candidate.gc_count + gc_contribution new_length = candidate.length + 3 # Each codon is 3 nucleotides new_gc_ratio = new_gc_count / new_length # Priority #2: Position-aware GC penalty mechanism gc_penalty = 0.0 if position_aware_gc_penalty: # Calculate position weight (more penalty towards end of sequence) position_weight = (pos + 1) / seq_len # Calculate GC deviation severity target_gc = (min_gc + max_gc) / 2 gc_deviation = abs(new_gc_ratio - target_gc) deviation_severity = gc_deviation / ((max_gc - min_gc) / 2) # Apply progressive penalty if deviation_severity > 0.5: # Soft penalty zone gc_penalty = gc_penalty_strength * position_weight * (deviation_severity - 0.5) ** 2 # Hard constraint: still prune sequences that exceed bounds if new_gc_ratio < min_gc or new_gc_ratio > max_gc: continue # Prune invalid candidates else: # Priority #1: Hard GC bounds only if new_gc_ratio < min_gc or new_gc_ratio > max_gc: continue # Prune invalid candidates # Calculate score with GC penalty new_score = candidate.score + np.log(prob + 1e-8) - gc_penalty # Apply length penalty if length_penalty != 1.0: length_norm = ((pos + 1) ** length_penalty) normalized_score = new_score / length_norm else: normalized_score = new_score # Create new candidate new_candidate = BeamCandidate( tokens=candidate.tokens + [token_idx], score=normalized_score, gc_count=new_gc_count, length=new_length ) new_beam.append(new_candidate) # Apply diversity penalty if specified if diversity_penalty > 0.0: new_beam = _apply_diversity_penalty(new_beam, diversity_penalty) # Keep top beam_size candidates beam = sorted(new_beam, key=lambda x: x.score, reverse=True)[:beam_size] # Priority #3: Adaptive beam rescue for difficult sequences if not beam: # Attempt beam rescue by relaxing constraints progressively rescue_attempts = 0 max_rescue_attempts = 3 while not beam and rescue_attempts < max_rescue_attempts: rescue_attempts += 1 # Progressive relaxation strategy if rescue_attempts == 1: # First attempt: increase beam size and relax GC bounds slightly temp_beam_size = min(beam_size * 2, max_candidates) temp_gc_bounds = (min_gc * 0.95, max_gc * 1.05) elif rescue_attempts == 2: # Second attempt: further relax GC bounds and increase candidates temp_beam_size = min(beam_size * 3, max_candidates) temp_gc_bounds = (min_gc * 0.9, max_gc * 1.1) else: # Final attempt: maximum relaxation temp_beam_size = max_candidates temp_gc_bounds = (min_gc * 0.85, max_gc * 1.15) # Retry beam generation with relaxed parameters rescue_beam = [] # Use previous beam state or start fresh if this is the first position with no beam previous_beam = beam if beam else [BeamCandidate(tokens=[], score=0.0, gc_count=0, length=0)] for candidate in previous_beam: for token_idx, prob, gc_contribution in top_candidates: new_gc_count = candidate.gc_count + gc_contribution new_length = candidate.length + 3 new_gc_ratio = new_gc_count / new_length # Check relaxed bounds if temp_gc_bounds[0] <= new_gc_ratio <= temp_gc_bounds[1]: # Apply reduced GC penalty for rescue gc_penalty = 0.0 if position_aware_gc_penalty: position_weight = (pos + 1) / seq_len target_gc = (min_gc + max_gc) / 2 gc_deviation = abs(new_gc_ratio - target_gc) deviation_severity = gc_deviation / ((max_gc - min_gc) / 2) # Reduced penalty for rescue if deviation_severity > 0.7: gc_penalty = (gc_penalty_strength * 0.5) * position_weight * (deviation_severity - 0.7) ** 2 new_score = candidate.score + np.log(prob + 1e-8) - gc_penalty if length_penalty != 1.0: length_norm = ((pos + 1) ** length_penalty) normalized_score = new_score / length_norm else: normalized_score = new_score rescue_candidate = BeamCandidate( tokens=candidate.tokens + [token_idx], score=normalized_score, gc_count=new_gc_count, length=new_length ) rescue_beam.append(rescue_candidate) # Keep top candidates from rescue attempt if rescue_beam: beam = sorted(rescue_beam, key=lambda x: x.score, reverse=True)[:temp_beam_size] break # If all rescue attempts failed, raise error if not beam: raise ValueError( f"Beam rescue failed at position {pos} after {max_rescue_attempts} attempts. " f"The GC constraints {gc_bounds} may be too restrictive for this protein sequence. " f"Consider relaxing constraints or using a different approach." ) # Return best candidate best_candidate = max(beam, key=lambda x: x.score) return best_candidate.tokens # Wrapper function that tries simple approach first def constrained_beam_search_wrapper( logits: torch.Tensor, protein_sequence: str, gc_bounds: Tuple[float, float] = (0.30, 0.70), **kwargs ) -> List[int]: """Wrapper that tries simple approach first, falls back to complex beam search.""" try: # Try simple approach first return constrained_beam_search_simple(logits, protein_sequence, gc_bounds) except ValueError: # Fall back to complex beam search return constrained_beam_search(logits, protein_sequence, gc_bounds, **kwargs) def _apply_diversity_penalty(candidates: List[BeamCandidate], penalty: float) -> List[BeamCandidate]: """ Apply diversity penalty to reduce repetitive sequences. Args: candidates (List[BeamCandidate]): List of candidates penalty (float): Diversity penalty strength Returns: List[BeamCandidate]: Candidates with diversity penalty applied """ if not candidates: return candidates # Count token occurrences token_counts = {} for candidate in candidates: for token in candidate.tokens: token_counts[token] = token_counts.get(token, 0) + 1 # Apply penalty for candidate in candidates: diversity_score = 0.0 for token in candidate.tokens: if token_counts[token] > 1: diversity_score += penalty * np.log(token_counts[token]) candidate.score -= diversity_score return candidates def sample_non_deterministic( logits: torch.Tensor, temperature: float = 0.2, top_p: float = 0.95, ) -> List[int]: """ Sample token indices from logits using temperature scaling and nucleus (top-p) sampling. This function applies temperature scaling to the logits, computes probabilities, and then performs nucleus sampling to select token indices. It is used for non-deterministic decoding in language models to introduce randomness while maintaining coherence in the generated sequences. Args: logits (torch.Tensor): The logits output from the model of shape [seq_len, vocab_size] or [batch_size, seq_len, vocab_size]. temperature (float, optional): Temperature value for scaling logits. Must be a positive float. Defaults to 1.0. top_p (float, optional): Cumulative probability threshold for nucleus sampling. Must be a float between 0 and 1. Tokens with cumulative probability up to `top_p` are considered for sampling. Defaults to 0.95. Returns: List[int]: A list of sampled token indices corresponding to the predicted tokens. Raises: ValueError: If `temperature` is not a positive float or if `top_p` is not between 0 and 1. Example: >>> logits = model_output.logits # Assume logits is a tensor of shape [seq_len, vocab_size] >>> predicted_indices = sample_non_deterministic(logits, temperature=0.7, top_p=0.9) """ if not isinstance(temperature, (float, int)) or temperature <= 0: raise ValueError("Temperature must be a positive float.") if not isinstance(top_p, (float, int)) or not 0 < top_p <= 1.0: raise ValueError("top_p must be a float between 0 and 1.") # Compute probabilities using temperature scaling probs = torch.softmax(logits / temperature, dim=-1) # Remove batch dimension if present if probs.dim() == 3: probs = probs.squeeze(0) # Shape: [seq_len, vocab_size] # Sort probabilities in descending order probs_sort, probs_idx = torch.sort(probs, dim=-1, descending=True) probs_sum = torch.cumsum(probs_sort, dim=-1) mask = probs_sum - probs_sort > top_p # Zero out probabilities for tokens beyond the top-p threshold probs_sort[mask] = 0.0 # Renormalize the probabilities probs_sort.div_(probs_sort.sum(dim=-1, keepdim=True)) next_token = torch.multinomial(probs_sort, num_samples=1) predicted_indices = torch.gather(probs_idx, -1, next_token).squeeze(-1) return predicted_indices.tolist() def load_model( model_path: Optional[str] = None, device: torch.device = None, attention_type: str = "original_full", num_organisms: int = None, remove_prefix: bool = True, ) -> torch.nn.Module: """ Load a BigBirdForMaskedLM model from a model file, checkpoint, or HuggingFace. Args: model_path (Optional[str]): Path to the model file or checkpoint. If None, load from HuggingFace. device (torch.device, optional): The device to load the model onto. attention_type (str, optional): The type of attention, 'block_sparse' or 'original_full'. num_organisms (int, optional): Number of organisms, needed if loading from a checkpoint that requires this. remove_prefix (bool, optional): Whether to remove the "model." prefix from the keys in the state dict. Returns: torch.nn.Module: The loaded model. """ if not model_path: warnings.warn("Model path not provided. Loading from HuggingFace.", UserWarning) model = BigBirdForMaskedLM.from_pretrained("adibvafa/CodonTransformer") elif model_path.endswith(".ckpt"): checkpoint = torch.load(model_path, map_location="cpu") # Detect Lightning checkpoint vs raw state dict if isinstance(checkpoint, dict) and "state_dict" in checkpoint: state_dict = checkpoint["state_dict"] if remove_prefix: state_dict = { k.replace("model.", ""): v for k, v in state_dict.items() } else: # assume checkpoint itself is state_dict state_dict = checkpoint if num_organisms is None: num_organisms = NUM_ORGANISMS # Load model configuration and instantiate the model config = load_bigbird_config(num_organisms) model = BigBirdForMaskedLM(config=config) model.load_state_dict(state_dict, strict=False) elif model_path.endswith(".pt"): state_dict = torch.load(model_path) config = state_dict.pop("self.config") model = BigBirdForMaskedLM(config=config) model.load_state_dict(state_dict, strict=False) else: raise ValueError( "Unsupported file type. Please provide a .ckpt or .pt file, " "or None to load from HuggingFace." ) # Prepare model for evaluation model.bert.set_attention_type(attention_type) model.eval() if device: model.to(device) return model def load_bigbird_config(num_organisms: int) -> BigBirdConfig: """ Load the config object used to train the BigBird transformer. Args: num_organisms (int): The number of organisms. Returns: BigBirdConfig: The configuration object for BigBird. """ config = transformers.BigBirdConfig( vocab_size=len(TOKEN2INDEX), # Equal to len(tokenizer) type_vocab_size=num_organisms, sep_token_id=2, ) return config def create_model_from_checkpoint( checkpoint_dir: str, output_model_dir: str, num_organisms: int ) -> None: """ Save a model to disk using a previous checkpoint. Args: checkpoint_dir (str): Directory where the checkpoint is stored. output_model_dir (str): Directory where the model will be saved. num_organisms (int): Number of organisms. """ checkpoint = load_model(model_path=checkpoint_dir, num_organisms=num_organisms) state_dict = checkpoint.state_dict() state_dict["self.config"] = load_bigbird_config(num_organisms=num_organisms) # Save the model state dict to the output directory torch.save(state_dict, output_model_dir) def load_tokenizer(tokenizer_path: Optional[Union[str, PreTrainedTokenizerFast]] = None) -> PreTrainedTokenizerFast: """ Create and return a tokenizer object from tokenizer path or HuggingFace. Args: tokenizer_path (Optional[Union[str, PreTrainedTokenizerFast]]): Path to the tokenizer file, a pre-loaded tokenizer object, or None. If None, load from HuggingFace. Returns: PreTrainedTokenizerFast: The tokenizer object. """ # If a tokenizer object is already provided, return it if isinstance(tokenizer_path, PreTrainedTokenizerFast): return tokenizer_path # If no path is provided, load from HuggingFace if not tokenizer_path: warnings.warn( "Tokenizer path not provided. Loading from HuggingFace.", UserWarning ) return AutoTokenizer.from_pretrained("adibvafa/CodonTransformer") # Load from file path return transformers.PreTrainedTokenizerFast( tokenizer_file=tokenizer_path, bos_token="[CLS]", eos_token="[SEP]", unk_token="[UNK]", sep_token="[SEP]", pad_token="[PAD]", cls_token="[CLS]", mask_token="[MASK]", ) def tokenize( batch: List[Dict[str, Any]], tokenizer: Union[PreTrainedTokenizerFast, str] = None, max_len: int = 2048, ) -> BatchEncoding: """ Return the tokenized sequences given a batch of input data. Each data in the batch is expected to be a dictionary with "codons" and "organism" keys. Args: batch (List[Dict[str, Any]]): A list of dictionaries with "codons" and "organism" keys. tokenizer (PreTrainedTokenizerFast, str, optional): The tokenizer object or path to the tokenizer file. max_len (int, optional): Maximum length of the tokenized sequence. Returns: BatchEncoding: The tokenized batch. """ if not isinstance(tokenizer, PreTrainedTokenizerFast): tokenizer = load_tokenizer(tokenizer) tokenized = tokenizer( [data["codons"] for data in batch], return_attention_mask=True, return_token_type_ids=True, truncation=True, padding=True, max_length=max_len, return_tensors="pt", ) # Add token type IDs for species seq_len = tokenized["input_ids"].shape[-1] species_index = torch.tensor([[data["organism"]] for data in batch]) tokenized["token_type_ids"] = species_index.repeat(1, seq_len) return tokenized def validate_and_convert_organism(organism: Union[int, str]) -> Tuple[int, str]: """ Validate and convert the organism input to both ID and name. This function takes either an organism ID or name as input and returns both the ID and name. It performs validation to ensure the input corresponds to a valid organism in the ORGANISM2ID dictionary. Args: organism (Union[int, str]): Either the ID of the organism (int) or its name (str). Returns: Tuple[int, str]: A tuple containing the organism ID (int) and name (str). Raises: ValueError: If the input is neither a string nor an integer, if the organism name is not found in ORGANISM2ID, if the organism ID is not a value in ORGANISM2ID, or if no name is found for a given ID. Note: This function relies on the ORGANISM2ID dictionary imported from CodonTransformer.CodonUtils, which maps organism names to their corresponding IDs. """ if isinstance(organism, str): if organism not in ORGANISM2ID: raise ValueError( f"Invalid organism name: {organism}. " "Please use a valid organism name or ID." ) organism_id = ORGANISM2ID[organism] organism_name = organism elif isinstance(organism, int): if organism not in ORGANISM2ID.values(): raise ValueError( f"Invalid organism ID: {organism}. " "Please use a valid organism name or ID." ) organism_id = organism organism_name = next( (name for name, id in ORGANISM2ID.items() if id == organism), None ) if organism_name is None: raise ValueError(f"No organism name found for ID: {organism}") return organism_id, organism_name def get_high_frequency_choice_sequence( protein: str, codon_frequencies: Dict[str, Tuple[List[str], List[float]]] ) -> str: """ Return the DNA sequence optimized using High Frequency Choice (HFC) approach in which the most frequent codon for a given amino acid is always chosen. Args: protein (str): The protein sequence. codon_frequencies (Dict[str, Tuple[List[str], List[float]]]): Codon frequencies for each amino acid. Returns: str: The optimized DNA sequence. """ # Select the most frequent codon for each amino acid in the protein sequence dna_codons = [ codon_frequencies[aminoacid][0][np.argmax(codon_frequencies[aminoacid][1])] for aminoacid in protein ] return "".join(dna_codons) def precompute_most_frequent_codons( codon_frequencies: Dict[str, Tuple[List[str], List[float]]], ) -> Dict[str, str]: """ Precompute the most frequent codon for each amino acid. Args: codon_frequencies (Dict[str, Tuple[List[str], List[float]]]): Codon frequencies for each amino acid. Returns: Dict[str, str]: The most frequent codon for each amino acid. """ # Create a dictionary mapping each amino acid to its most frequent codon return { aminoacid: codons[np.argmax(frequencies)] for aminoacid, (codons, frequencies) in codon_frequencies.items() } def get_high_frequency_choice_sequence_optimized( protein: str, codon_frequencies: Dict[str, Tuple[List[str], List[float]]] ) -> str: """ Efficient implementation of get_high_frequency_choice_sequence that uses vectorized operations and helper functions, achieving up to x10 faster speed. Args: protein (str): The protein sequence. codon_frequencies (Dict[str, Tuple[List[str], List[float]]]): Codon frequencies for each amino acid. Returns: str: The optimized DNA sequence. """ # Precompute the most frequent codons for each amino acid most_frequent_codons = precompute_most_frequent_codons(codon_frequencies) return "".join(most_frequent_codons[aminoacid] for aminoacid in protein) def get_background_frequency_choice_sequence( protein: str, codon_frequencies: Dict[str, Tuple[List[str], List[float]]] ) -> str: """ Return the DNA sequence optimized using Background Frequency Choice (BFC) approach in which a random codon for a given amino acid is chosen using the codon frequencies probability distribution. Args: protein (str): The protein sequence. codon_frequencies (Dict[str, Tuple[List[str], List[float]]]): Codon frequencies for each amino acid. Returns: str: The optimized DNA sequence. """ # Select a random codon for each amino acid based on the codon frequencies # probability distribution dna_codons = [ np.random.choice( codon_frequencies[aminoacid][0], p=codon_frequencies[aminoacid][1] ) for aminoacid in protein ] return "".join(dna_codons) def precompute_cdf( codon_frequencies: Dict[str, Tuple[List[str], List[float]]], ) -> Dict[str, Tuple[List[str], Any]]: """ Precompute the cumulative distribution function (CDF) for each amino acid. Args: codon_frequencies (Dict[str, Tuple[List[str], List[float]]]): Codon frequencies for each amino acid. Returns: Dict[str, Tuple[List[str], Any]]: CDFs for each amino acid. """ cdf = {} # Calculate the cumulative distribution function for each amino acid for aminoacid, (codons, frequencies) in codon_frequencies.items(): cdf[aminoacid] = (codons, np.cumsum(frequencies)) return cdf def get_background_frequency_choice_sequence_optimized( protein: str, codon_frequencies: Dict[str, Tuple[List[str], List[float]]] ) -> str: """ Efficient implementation of get_background_frequency_choice_sequence that uses vectorized operations and helper functions, achieving up to x8 faster speed. Args: protein (str): The protein sequence. codon_frequencies (Dict[str, Tuple[List[str], List[float]]]): Codon frequencies for each amino acid. Returns: str: The optimized DNA sequence. """ dna_codons = [] cdf = precompute_cdf(codon_frequencies) # Select a random codon for each amino acid using the precomputed CDFs for aminoacid in protein: codons, cumulative_prob = cdf[aminoacid] selected_codon_index = np.searchsorted(cumulative_prob, np.random.rand()) dna_codons.append(codons[selected_codon_index]) return "".join(dna_codons) def get_uniform_random_choice_sequence( protein: str, codon_frequencies: Dict[str, Tuple[List[str], List[float]]] ) -> str: """ Return the DNA sequence optimized using Uniform Random Choice (URC) approach in which a random codon for a given amino acid is chosen using a uniform prior. Args: protein (str): The protein sequence. codon_frequencies (Dict[str, Tuple[List[str], List[float]]]): Codon frequencies for each amino acid. Returns: str: The optimized DNA sequence. """ # Select a random codon for each amino acid using a uniform prior distribution dna_codons = [] for aminoacid in protein: codons = codon_frequencies[aminoacid][0] random_index = np.random.randint(0, len(codons)) dna_codons.append(codons[random_index]) return "".join(dna_codons) def get_icor_prediction(input_seq: str, model_path: str, stop_symbol: str) -> str: """ Return the optimized codon sequence for the given protein sequence using ICOR. Credit: ICOR: improving codon optimization with recurrent neural networks Rishab Jain, Aditya Jain, Elizabeth Mauro, Kevin LeShane, Douglas Densmore Args: input_seq (str): The input protein sequence. model_path (str): The path to the ICOR model. stop_symbol (str): The symbol representing stop codons in the sequence. Returns: str: The optimized DNA sequence. """ input_seq = input_seq.strip().upper() input_seq = input_seq.replace(stop_symbol, "*") # Define categorical labels from when model was trained. labels = [ "AAA", "AAC", "AAG", "AAT", "ACA", "ACG", "ACT", "AGC", "ATA", "ATC", "ATG", "ATT", "CAA", "CAC", "CAG", "CCG", "CCT", "CTA", "CTC", "CTG", "CTT", "GAA", "GAT", "GCA", "GCC", "GCG", "GCT", "GGA", "GGC", "GTC", "GTG", "GTT", "TAA", "TAT", "TCA", "TCG", "TCT", "TGG", "TGT", "TTA", "TTC", "TTG", "TTT", "ACC", "CAT", "CCA", "CGG", "CGT", "GAC", "GAG", "GGT", "AGT", "GGG", "GTA", "TGC", "CCC", "CGA", "CGC", "TAC", "TAG", "TCC", "AGA", "AGG", "TGA", ] # Define aa to integer table def aa2int(seq: str) -> List[int]: _aa2int = { "A": 1, "R": 2, "N": 3, "D": 4, "C": 5, "Q": 6, "E": 7, "G": 8, "H": 9, "I": 10, "L": 11, "K": 12, "M": 13, "F": 14, "P": 15, "S": 16, "T": 17, "W": 18, "Y": 19, "V": 20, "B": 21, "Z": 22, "X": 23, "*": 24, "-": 25, "?": 26, } return [_aa2int[i] for i in seq] # Create empty array to fill oh_array = np.zeros(shape=(26, len(input_seq))) # Load placements from aa2int aa_placement = aa2int(input_seq) # One-hot encode the amino acid sequence: for i in range(0, len(aa_placement)): oh_array[aa_placement[i], i] = 1 i += 1 oh_array = [oh_array] x = np.array(np.transpose(oh_array)) y = x.astype(np.float32) y = np.reshape(y, (y.shape[0], 1, 26)) # Start ICOR session using model. sess = rt.InferenceSession(model_path) input_name = sess.get_inputs()[0].name # Get prediction: pred_onx = sess.run(None, {input_name: y}) # Get the index of the highest probability from softmax output: pred_indices = [] for pred in pred_onx[0]: pred_indices.append(np.argmax(pred)) out_str = "" for index in pred_indices: out_str += labels[index] return out_str