MHSFGYRANALLTFAVTILAFICAIASFSDNFSNQNPSAQIQILNINWFQKQPHGNDEVSLTLNITADLQSLFTWNTKQVFAFVAAEYETSKNALNQVSLWDAIIPEKEHAKFWIQISNKYRFIDQGHNLRGKDFNLTLHWHVMPKTGKMFADKIVMSGYRLPNAYR	This protein is part of the following components: integral component of membrane, endoplasmic reticulum membrane, organelle membrane, cell wall, membrane, signal peptidase complex, endoplasmic reticulum, and intracellular membrane-bounded organelle. This protein is involved in the following processs: proteolysis, protein targeting to ER, and signal peptide processing. This protein is located in the following components: intracellular membrane-bounded organelle, endoplasmic reticulum, membrane, endoplasmic reticulum membrane, integral component of membrane, and cell wall. This protein enables hydrolase activity: hydrolase activity, and peptidase activity. This protein is part of membrane: endoplasmic reticulum membrane, organelle membrane, and membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is involved in proteolysis: signal peptide processing, and proteolysis. This protein is involved in protein transport: protein targeting to ER. This protein enables the following functions: serine-type endopeptidase activity, hydrolase activity, and peptidase activity.
MNKIFSSHVMPFRALIDACWKEKYTAARFTRDLIAGITVGIIAIPLAMALAIGSGVAPQYGLYTAAVAGIVIALTGGSRFSVSGPTAAFVVILYPVSQQFGLAGLLVATLLSGIFLILMGLARFGRLIEYIPVSVTLGFTSGIGITIGTMQIKDFLGLQMAHVPEHYLQKVGALFMALPTINVGDAAIGIVTLGILVFWPRLGIRLPGHLPALLAGCAVMGIVNLLGGHVATIGSQFHYVLADGSQGNGIPQLLPQLVLPWDLPNSEFTLTWDSIRTLLPAAFSMAMLGAIESLLCAVVLDGMTGTKHKANSELVGQGLGNIIAPFFGGITATAAIARSAANVRAGATSPISAVIHSILVILALLVLAPLLSWLPLSAMAALLLMVAWNMSEAHKVVDLLRHAPKDDIIVMLLCMSLTVLFDMVIAISVGIVLASLLFMRRIARMTRLAPVVVDVPDDVLVLRVIGPLFFAAAEGLFTDLESRLEGKRIVILKWDAVPVLDAGGLDAFQRFVKRLPEGCELRVCNVEFQPLRTMARAGIQPIPGRLAFFPNRRAAMADL	This protein is part of the following components: plasma membrane, integral component of membrane, and membrane. This protein is involved in the following processs: sulfate transmembrane transport, transmembrane transport, and sulfate transport. This protein is located in the following components: plasma membrane, membrane, and integral component of membrane. This protein is part of membrane: membrane, and plasma membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is involved in transmembrane transport: transmembrane transport. This protein is involved in cation transport: sulfate transport, and sulfate transmembrane transport. This protein enables the following functions: sulfate transmembrane transporter activity, and secondary active sulfate transmembrane transporter activity.
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAGMGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVVWGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVCTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAPLANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV	This protein is part of the following components: integral component of membrane, integral component of plasma membrane, early endosome, membrane, Schaffer collateral - CA1 synapse, plasma membrane, and endosome. This protein is involved in the following processs: brown fat cell differentiation, heat generation, positive regulation of heart contraction, negative regulation of inflammatory response to antigenic stimulus, norepinephrine-epinephrine-mediated vasodilation involved in regulation of systemic arterial blood pressure, positive regulation of heart rate by epinephrine-norepinephrine, activation of adenylate cyclase activity, positive regulation of cold-induced thermogenesis, fear response, cell-cell signaling, response to cold, diet induced thermogenesis, signal transduction, temperature homeostasis, positive regulation of the force of heart contraction by epinephrine-norepinephrine, G protein-coupled receptor signaling pathway, regulation of circadian sleep/wake cycle, sleep, regulation of postsynaptic membrane potential, negative regulation of multicellular organism growth, positive regulation of GTPase activity, adenylate cyclase-activating G protein-coupled receptor signaling pathway, and adenylate cyclase-activating adrenergic receptor signaling pathway. This protein is active in the following component: integral component of plasma membrane. This protein is located in the following components: integral component of plasma membrane, Schaffer collateral - CA1 synapse, plasma membrane, membrane, endosome, early endosome, and integral component of membrane. This protein is involved in signal transduction: adenylate cyclase-modulating G protein-coupled receptor signaling pathway, adenylate cyclase-activating G protein-coupled receptor signaling pathway, G protein-coupled receptor signaling pathway, adenylate cyclase-activating adrenergic receptor signaling pathway, and signal transduction. This protein is involved in metabolic process: diet induced thermogenesis. This protein is part of membrane: membrane, and plasma membrane. This protein is part of integral component of membrane: integral component of plasma membrane, and integral component of membrane. This protein enables the following functions: norepinephrine binding, PDZ domain binding, protein binding, beta1-adrenergic receptor activity, guanyl-nucleotide exchange factor activity, guanyl-nucleotide exchange factor activity, adrenergic receptor activity, G protein-coupled neurotransmitter receptor activity involved in regulation of postsynaptic membrane potential, G protein-coupled receptor activity, beta-adrenergic receptor activity, protein heterodimerization activity, epinephrine binding, and alpha-2A adrenergic receptor binding.
MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGNMPASVAHVPAAMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC	This protein is part of the following components: chromatin, protein-containing complex, nucleus, and nucleoplasm. This protein is involved in the following processs: negative regulation of cardiac muscle cell proliferation, negative regulation of transcription, DNA-templated, skeletal muscle cell differentiation, decidualization, determination of heart left/right asymmetry, spleen development, positive regulation of transforming growth factor beta receptor signaling pathway, cranial nerve morphogenesis, embryonic heart tube left/right pattern formation, ventricular septum morphogenesis, neural tube closure, embryonic placenta development, cell aging, determination of left/right symmetry, positive regulation of male gonad development, transforming growth factor beta receptor signaling pathway, vasculogenesis, erythrocyte development, peripheral nervous system development, response to hypoxia, leukocyte differentiation, vasculature development, positive regulation of cell-cell adhesion, pulmonary artery morphogenesis, negative regulation of transcription by RNA polymerase II, hematopoietic progenitor cell differentiation, positive regulation of transcription by RNA polymerase II, positive regulation of peroxisome proliferator activated receptor signaling pathway, liver development, central nervous system development, cardiac neural crest cell development involved in heart development, regulation of transcription by RNA polymerase II, left/right pattern formation, embryonic camera-type eye morphogenesis, male gonad development, response to mechanical stimulus, regulation of transcription, DNA-templated, blood vessel development, granulocyte differentiation, multicellular organism development, lens morphogenesis in camera-type eye, positive regulation of cell cycle, regulation of animal organ formation, positive regulation of gene expression, left/right axis specification, cellular response to growth factor stimulus, embryonic process involved in female pregnancy, cell differentiation, response to estrogen, ventricular septum development, positive regulation of transcription, DNA-templated, negative regulation of apoptotic process, neural tube formation, response to fluid shear stress, thymus development, outflow tract morphogenesis, cell population proliferation, sex determination, adrenal gland development, cardiac septum morphogenesis, nodal signaling pathway involved in determination of lateral mesoderm left/right asymmetry, adrenal cortex formation, heart looping, trophectodermal cell differentiation, negative regulation of transcription from RNA polymerase II promoter in response to hypoxia, endocardial cushion development, heart development, in utero embryonic development, bone morphogenesis, negative regulation of cell migration, and negative regulation of gene expression. This protein is active in the following component: nucleus. This protein is located in the following components: chromatin, nucleoplasm, and nucleus. This protein is part of nucleus: nucleus. This protein is involved in regulation of transcription, DNA-templated: negative regulation of transcription, DNA-templated, positive regulation of transcription, DNA-templated, regulation of transcription, DNA-templated, positive regulation of transcription by RNA polymerase II, nodal signaling pathway involved in determination of lateral mesoderm left/right asymmetry, negative regulation of transcription from RNA polymerase II promoter in response to hypoxia, and negative regulation of transcription by RNA polymerase II. This protein enables the following functions: protein domain specific binding, chromatin binding, transcription corepressor activity, LBD domain binding, RNA polymerase II-specific DNA-binding transcription factor binding, transcription coactivator activity, protein binding, histone acetyltransferase binding, and SMAD binding.
MGVPSEGAVGNVNGNEVGTTASFAGYMETRGVREARVLASELCRHMYTLGWFSGTGGSITIKVHDDSIPKPRQLVVISPSGVQKERMVPEDMYVLSSDGFILSTPPLKPYPHKPPKCTDCTPLFMKVYEMRDAGAVIHSHGMESCIVTMILPFSKEFRITHMEMIKGIKGHGYHDELVVPIIENTAHEAELVESLTEAITAYPKTTAVLVRNHGVYVWGDSWISAKTQAECYHYLFDAAIKLHQLGLDWSTPTHGPIRSINGIWGCNGTMSRGLKVGGLSLDDMIEPSQRCILLDIEGTTTPISFVTDVLFPYAHANVGKHLAATFDSEETQDDINLLRSQIQHDLEHGVVGAVPIPPDYVGKELVIASFVANVEAMIRADRNITALKQLQGHIWKTGFQSNELVGVVFDDVPEALERWHASGIKVYIYSSGSREAQQLIFSNSNYGDLRKYFCGFFDTTMGNKKETHSYFEILRTVGIDRPSDMLFVTDVFQEAVAARAAGLEVVISIRPGNGPLPENHGFRTIETFLEI	This protein is part of the following component: cytoplasm. This protein is involved in the following processs: metabolic process, L-methionine salvage from methylthioadenosine, cellular amino acid biosynthetic process, dephosphorylation, L-methionine salvage from S-adenosylmethionine, and methionine biosynthetic process. This protein is active in the following component: cytoplasm. This protein is located in the following component: cytoplasm. This protein enables hydrolase activity: 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase activity, hydrolase activity, and acireductone synthase activity. This protein is involved in metabolic process: metabolic process, and dephosphorylation. This protein enables metal ion binding: zinc ion binding, magnesium ion binding, and metal ion binding. This protein enables catalytic activity: catalytic activity, methylthioribulose 1-phosphate dehydratase activity, lyase activity, and 2,3-diketo-5-methylthiopentyl-1-phosphate enolase activity. This protein is part of cytoplasm: cytoplasm. This protein is involved in cellular amino acid biosynthetic process: cellular amino acid biosynthetic process, methionine biosynthetic process, L-methionine salvage from S-adenosylmethionine, and L-methionine salvage from methylthioadenosine. This protein enables the following functions: lyase activity, metal ion binding, zinc ion binding, magnesium ion binding, acireductone synthase activity, 2,3-diketo-5-methylthiopentyl-1-phosphate enolase activity, 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase activity, catalytic activity, methylthioribulose 1-phosphate dehydratase activity, and hydrolase activity.
MALKSLVVLPLLVLVLLLVRVQPSLGKESAAAKFERQHMDSGNSPSSSSNYCNLMMCCRKMTQGKCKPVNTFVHESLADVKAVCSQKKVTCKNGQTNCYQSKSTMRITDCRETGSSKYPNCAYKTTQVEKHIIVACGGKPSVPVHFDASV	This protein is part of the following component: extracellular region. This protein is involved in the following processs: RNA phosphodiester bond hydrolysis, RNA phosphodiester bond hydrolysis, endonucleolytic, and metabolic process. This protein is not involved in the following process: defense response to virus. This protein is located in the following component: extracellular region. This protein enables hydrolase activity: ribonuclease activity, endonuclease activity, hydrolase activity, nuclease activity, and ribonuclease A activity. This protein is involved in metabolic process: RNA phosphodiester bond hydrolysis, RNA phosphodiester bond hydrolysis, endonucleolytic, and metabolic process. This protein enables catalytic activity: lyase activity, and catalytic activity. This protein is part of extracellular region: extracellular region. This protein enables the following functions: identical protein binding, nuclease activity, lyase activity, ribonuclease A activity, catalytic activity, nucleic acid binding, hydrolase activity, endonuclease activity, and ribonuclease activity.
MSWKDTAEPLLVRMPAVQRPEGHVPFKRKLTWTGGVLLLYFFLTNVKLFGLDIDASQQVFGRFSSILASGQGSIMQLGIGPIVTASIVLQLLGGADLLGLNTQDDPRDQILYQGLQKLLVLVMICLTGLPMVFAGGFLPADTAVANSLGIGTAGVQWLIFAQMFVGGVLILFMDEVISKWGVGSGIGLFIVAGVSQRLVGGLLTAPFLGNSEGIIYTWYLFITGERGTGPVLAADGLQTVLLQGELLGLFTTVLIFAVVVYAESVRVEIPLSNARVKGARGRFPVKLIYASVLPMILVRALQANIQFLGRILNAQLGSMPAFLGTYANGQPTGGLFYFLAPIQSRGDWMWWLEGTAQPVWQILTRVGIDLFVMLVGGAVFAVFWVETTDMGPEATAKQIHNSGMQIPGFRQNVGVIEKVLERYIPQVTVIGGALVGLLAVMANMLGTIGGVSGTGLLLTVSITYKLYEEIAEEQLMEMHPMMRQMFG	This protein is part of the following components: membrane, plasma membrane, and integral component of membrane. This protein is involved in the following processs: intracellular protein transmembrane transport, protein targeting, and protein transport. This protein is located in the following components: membrane, plasma membrane, and integral component of membrane. This protein is part of membrane: plasma membrane, and membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is involved in transmembrane transport: intracellular protein transmembrane transport. This protein is involved in protein transport: protein targeting, and protein transport.
MWGIKGSFAVLLLLFLAYIFASSVNADSLSAPLNVTIKALEGNSAIVTWDILEGDPVIGFAITQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQSISMSGTSPPSEPVLFRTPKESEKLASKSPDEVTMEEVGQAAQLRAGELIIIVVVLVMWAGVIALFCRQYDIIKDNEPNNNKDKAKNSSECSTPEHPTGGLLRSKV	This protein is part of the following components: integral component of membrane, plasma membrane, extracellular region, peroxisome, peroxisomal membrane, and membrane. This protein is involved in the following process: signal transduction. This protein is active in the following components: plasma membrane, and extracellular region. This protein is located in the following components: plasma membrane, integral component of membrane, extracellular region, peroxisome, peroxisomal membrane, and membrane. This protein is involved in signal transduction: signal transduction. This protein is part of membrane: plasma membrane, membrane, and peroxisomal membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is part of extracellular region: extracellular region. This protein enables the following function: hormone activity.
MSLSPKHTTPFSVSDILSPIEETYKKFSGAMDGAPPGLGAPLGAAAAYRAPPPGPSSQAATVAGMQPSHAMAGHNAAAAAAAAAAAAAAAATYHMPPGVSQFPHGAMGSYCNGGLGNMGELPAYTDGMRGGAATGWYGANPDPRYSSISRFMGPSAGVNVAGMGSLTGIADAAKSLGPLHAAAAAAAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQLQQEGGLGPPPPPPPSPRRVAVPVLVKDGKPCQNGASTPTPGQAGPQPPAPTPAPELEELSPSPPALHGPGGGLAALDAAAGEYSGGVLGANLLYGRTW	This protein is part of the following components: chromatin, chromatin, cellular_component, and nucleus. This protein is involved in the following processs: regulation of transcription, DNA-templated, regulation of transcription by RNA polymerase II, biological_process, multicellular organism development, and cell differentiation. This protein is active in the following components: cellular_component, and nucleus. This protein is located in the following component: nucleus. This protein enables DNA binding: sequence-specific DNA binding, RNA polymerase II cis-regulatory region sequence-specific DNA binding, and DNA binding. This protein is part of nucleus: nucleus. This protein is involved in regulation of transcription, DNA-templated: positive regulation of transcription by RNA polymerase II, and regulation of transcription, DNA-templated. This protein enables the following functions: DNA binding, protein binding, RNA polymerase II cis-regulatory region sequence-specific DNA binding, DNA-binding transcription factor activity, DNA-binding transcription factor activity, RNA polymerase II-specific, and molecular_function.
MPNLENLDWKNLGFSYIKTDFRFIATYKNGSWSQGELVSENALQLSEGSPVLHYGQACFEGLKAYRSQKGKALLFRPLENAKRLQTSCERLLMPKVSEELFLKACAEVIKANQKWLAPYKSGASLYLRPFVIGVGDNLGVKPASEYLFIVFCAPVGAYFKGGIEKGGARFITTAFDRAAPKGTGGVKVGGNYAASLLAHKIATEQGYDDCIYLDPTTHTKIEEVGAANFFGITHDDAFITPHSPSILPSVTRKSLMVLAKEHLKLKVEEREILIDELGAFKEAGACGTAAIITPIKEIAHNNKSYSFEAPGNITKQLYDLLLSIQQGEQEAPKDWIFEVG	This protein is involved in the following processs: branched-chain amino acid metabolic process, branched-chain amino acid biosynthetic process, valine biosynthetic process, isoleucine biosynthetic process, leucine biosynthetic process, and cellular amino acid biosynthetic process. This protein is involved in metabolic process: branched-chain amino acid metabolic process, and branched-chain amino acid biosynthetic process. This protein enables catalytic activity: catalytic activity. This protein enables transferase activity: L-isoleucine transaminase activity, L-valine transaminase activity, branched-chain-amino-acid transaminase activity, transferase activity, L-leucine transaminase activity, and transaminase activity. This protein is involved in cellular amino acid biosynthetic process: valine biosynthetic process, leucine biosynthetic process, isoleucine biosynthetic process, and cellular amino acid biosynthetic process. This protein enables the following functions: transaminase activity, catalytic activity, transferase activity, L-isoleucine transaminase activity, L-leucine transaminase activity, branched-chain-amino-acid transaminase activity, L-leucine, and L-valine transaminase activity.
MGRVSWIIALYLTINVVIVVNGDRVTRNVEVTAEEEKIRDKLGYEAIRDIHRDMDDDHSGSIDRNESTGFMKEDMQMRGSERTRRENKFHGDDDAITVDDLWEAWFESIERTWTNERLVEWLINDVNLPSIVEAVKAKKIDGKILPRFASPNSDFLNKELGIKSSVYRQKLRLNSLDVVLFGYKDNNNRTKDILLAFLALLLTSLIFLYVRQKQKAQQKVNELSNKLTELKCMETEFEDVQKMLNDERSKRSISDGVVNHTEMENLRVQLEEAERRLEANSNGSQAPLALQPLLRRTCENEMAFLEKQRQDCFKEMKEAIEMVDRLQKKQGSVLSSLKLATGAASTSDQVDSKIFALKSRMEKIHTLTRETQERWLQIESLCGFPLLYLNETEHINRSIASSHFYNKSHEGSSSSGSISNAHSNPNAVNSNFVKKVSPPIPPSQQTANLRFVPTEQSDSIHSEDTSPIVEDVAISRSLTQDLAEADMQSIVSGSTNGSGSVAALKKRKGIFPKLFRRNTSKSSSLGGTSN	This protein is part of the following components: intracellular organelle, dendrite, neuronal cell body, membrane, plasma membrane, endoplasmic reticulum, cytoplasm, and integral component of membrane. This protein is involved in the following processs: ion transport, calcium ion transport, activation of store-operated calcium channel activity, reproduction, positive regulation of store-operated calcium channel activity, calcium ion transmembrane transport, positive regulation of smooth muscle contraction, cellular calcium ion homeostasis, positive regulation of engulfment of apoptotic cell, ovulation, and store-operated calcium entry. This protein is active in the following components: plasma membrane, and endoplasmic reticulum. This protein is located in the following components: cytoplasm, membrane, intracellular organelle, neuronal cell body, plasma membrane, dendrite, and integral component of membrane. This protein enables metal ion binding: metal ion binding, and calcium ion binding. This protein is part of membrane: membrane, and plasma membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is part of cytoplasm: cytoplasm. This protein is involved in cation transport: calcium ion transport, calcium ion transmembrane transport, ion transport, and store-operated calcium entry. This protein enables the following functions: calcium channel regulator activity, calcium ion binding, metal ion binding, calcium channel activity, and identical protein binding.
MEIKYLLTVFLVLLIVSDHCQAFLFSLIPNAISGLLSAFKGRRKRNLDGQIDRFRNFRKRDAELEELLSKLPIY	This protein is part of the following components: other organism cell membrane, membrane, and extracellular region. This protein is involved in the following processs: defense response to fungus, killing of cells of other organism, and defense response to bacterium. This protein is located in the following components: membrane, and extracellular region. This protein is part of membrane: membrane. This protein is part of extracellular region: extracellular region.
MYRTHYSSEITEELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKKKVDPELFKLIPKLRSEDVVAVEGVVNFTPKAKLGFEILPEKIVVLNRAETPLPLDPTGKVKAELDTRLDNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYFEEDAFLAQSPQLYKQIMMASGLDRVYEIAPIFRAEEHNTTRHLNEAWSIDSEMAFIEDEEEVMSFLERLVAHAINYVREHNAKELDILNFELEEPKLPFPRVSYDKALEILGDLGKEIPWGEDIDTEGERLLGKYMMENENAPLYFLYQYPSEAKPFYIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPESFEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRRLTP	This protein is part of the following components: cytoplasm, aminoacyl-tRNA synthetase multienzyme complex, and cytosol. This protein is involved in the following processs: aspartyl-tRNA aminoacylation, tRNA aminoacylation for protein translation, and translation. This protein is active in the following component: cytosol. This protein is located in the following component: cytoplasm. This protein is involved in metabolic process: tRNA aminoacylation for protein translation, and aspartyl-tRNA aminoacylation. This protein enables metal ion binding: magnesium ion binding, and metal ion binding. This protein enables catalytic activity: ligase activity, aspartate-tRNA ligase activity, and aminoacyl-tRNA ligase activity. This protein enables nucleotide binding: nucleotide binding, and ATP binding. This protein enables RNA binding: RNA binding. This protein is part of cytoplasm: cytoplasm. This protein is part of cytosol: cytosol. This protein is involved in translation: translation. This protein enables the following functions: RNA binding, nucleotide binding, aminoacyl-tRNA ligase activity, ligase activity, ATP binding, aspartate-tRNA ligase activity, metal ion binding, magnesium ion binding, and nucleic acid binding.
MEKRPYSVAWLSESSQRKPLCTNVDLLGYKSGNPDLPPNREYNVSLPSRVILPTPDYREKENYCGRNVHNGERSPPVRDQLHFHPAPQELTTSRRTSIEVSAESSTDQRVIGMTDTNKKTISVCDEDAASRARTKFTAEQLEELEKSFKENRYIGSSEKRRLSKVLKLSENQIKTWFQNRRMKFKRQTQDARVEAFFSGLYLPYYGYPDLPTPGYSVQSEFPVLAPQTMAASSIPFGPLHSTVMSPGLHPAIPSANLGSYPCSSMLVRPILNEPTRQRYSPY	This protein is part of the following components: nucleus, and chromatin. This protein is involved in the following processs: regulation of transcription by RNA polymerase II, negative regulation of transcription, DNA-templated, multicellular organism development, negative regulation of transcription by RNA polymerase II, determination of ventral identity, BMP signaling pathway, and regulation of transcription, DNA-templated. This protein is located in the following component: nucleus. This protein is involved in signal transduction: BMP signaling pathway. This protein enables DNA binding: RNA polymerase II cis-regulatory region sequence-specific DNA binding, DNA binding, and sequence-specific DNA binding. This protein is part of nucleus: nucleus. This protein is involved in regulation of transcription, DNA-templated: regulation of transcription by RNA polymerase II, negative regulation of transcription by RNA polymerase II, regulation of transcription, DNA-templated, and negative regulation of transcription, DNA-templated. This protein enables the following functions: DNA binding, RNA polymerase II cis-regulatory region sequence-specific DNA binding, DNA-binding transcription factor activity, RNA polymerase II-specific, and DNA-binding transcription factor activity.
MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN	This protein is part of the following component: cytoplasm. This protein is involved in the following processs: response to biotic stimulus, abscisic acid-activated signaling pathway, defense response, and negative regulation of phosphoprotein phosphatase activity. This protein is located in the following component: cytoplasm. This protein is involved in signal transduction: abscisic acid-activated signaling pathway. This protein is part of cytoplasm: cytoplasm. This protein enables the following functions: signaling receptor activity, protein phosphatase inhibitor activity, and abscisic acid binding.
MVKRNQRKKSAPKKRLTKAEVEKQRAIKRMILSVLMALLLIFAMLRLGVFGVTTYNMIRFLVGSLAYPFMFAWLIYLFCFKWLRQKDGMIAGVVIAFLGLLVEWHAFLFAMPRMLDQDIFLGTARLITRDLLALRVTEFVGGGMLGALLYKPIAFLFSNIGSYFIGFLFILLGLFLMTPWDIYDVSHFVKEAVDKLAVAYQENKEKRFIKREEHRLQAEKEALEKQAQEEEKRLAELTVDPETGEIVEDSQSQVSYDLAEDMTKEPEILAYDSHLKDDEASLFDQEDLAYAHEEIGAYDSLSALASSEDEMDMDEPVEVDFTPKTHLLYKLPTIDLFAPDKPKNQSKEKNLVRKNIKVLEDTFQSFGIDVKVERAEIGPSVTKYEIKPAVGVRVNRISNLADDLALALAAKDVRIEAPIPGKSLIGIEVPNSEIATVSFRELWEQSDANPENLLEVPLGKAVNGNARSFNLARMPHLLVAGSTGSGKSVAVNGIISSILMKARPDQVKFMMIDPKMVELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFSKIGVRNIAGYNTKVEEFNASSEQKQIPLTLIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVDVISGLIKANVPSRMAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQGSFISDDDVERIVNFIKDQAEADYDDAFDPGEVSDNDPGFSGNGGAAEGDPLFEEAKALVLETQKASASMIQRRLSVGFNRATRLMDELEEAGVIGPAEGTKPRKVLQTN	This protein is part of the following components: membrane, integral component of membrane, and plasma membrane. This protein is involved in the following processs: chromosome segregation, cell division, and cell cycle. This protein is located in the following components: integral component of membrane, plasma membrane, and membrane. This protein enables nucleotide binding: nucleotide binding, and ATP binding. This protein is part of membrane: plasma membrane, and membrane. This protein is part of integral component of membrane: integral component of membrane. This protein enables DNA binding: DNA binding. This protein is involved in cell cycle: cell cycle. This protein is involved in cell division: cell division. This protein enables the following functions: nucleotide binding, DNA binding, and ATP binding.
MESGFTSKDTYLSHFNPRDYLEKYYSFGSRHCAENEILRHLLKNLFKIFCLGAVKGELLIDIGSGPTIYQLLSACESFTEIIVSDYTDQNLWELQKWLKKEPGAFDWSPVVTYVCDLEGNRMKGPEKEEKLRRAIKQVLKCDVTQSQPLGGVSLPPADCLLSTLCLDAACPDLPAYRTALRNLGSLLKPGGFLVMVDALKSSYYMIGEQKFSSLPLGWETVRDAVEEAGYTIEQFEVISQNYSSTTSNNEGLFSLVGRKPGRSE	This protein is part of the following components: cytosol, and cytoplasm. This protein is involved in the following processs: response to organonitrogen compound, animal organ regeneration, methylation, and response to drug. This protein acts upstream of or within the following process: methylation. This protein is active in the following component: cytosol. This protein is located in the following components: cytosol, and cytoplasm. This protein is part of cytoplasm: cytoplasm. This protein enables transferase activity: nicotinamide N-methyltransferase activity, transferase activity, N-methyltransferase activity, and methyltransferase activity. This protein is involved in methylation: methylation. This protein is part of cytosol: cytosol. This protein enables the following functions: N-methyltransferase activity, nicotinamide N-methyltransferase activity, methyltransferase activity, and transferase activity.
MRCSAISPGSGTIINAISTGKGSAFGIDLKIKANVELKNDGKSKINGILLDNPSLKPNLVERCVKNVLEHFEVDYSAKISTSSELPLKSGLSSSSAASNAAVLATFGALGEKIDSELILDLAIKSSFEEQLTITGAYDDATASYFGGITVCNNLERKILKKDVFKEELDVIILMPNFKKNLNVKRMKLISDYVELAFEKCMNADYYKALFLNGILYSSALNFPSYISVDALEAGAVTAGLSGTGPSYIALSYQENTEKVKNAFKKYGTVIISKPDNFGSKIIY	This protein is part of the following component: cytoplasm. This protein is involved in the following processs: chorismate biosynthetic process, cellular amino acid biosynthetic process, phosphorylation, and aromatic amino acid family biosynthetic process. This protein is located in the following component: cytoplasm. This protein is involved in metabolic process: chorismate biosynthetic process, and aromatic amino acid family biosynthetic process. This protein enables nucleotide binding: nucleotide binding, and ATP binding. This protein is part of cytoplasm: cytoplasm. This protein enables transferase activity: shikimate kinase activity, kinase activity, and transferase activity. This protein is involved in cellular amino acid biosynthetic process: cellular amino acid biosynthetic process. This protein is involved in phosphorylation: phosphorylation. This protein enables the following functions: kinase activity, ATP binding, shikimate kinase activity, nucleotide binding, and transferase activity.
MALKDYVLEKDKVKKFLQEFYQDDESGKKQFKYGNQLVQLAHREQVAMYVDLDDIAEDDPELVDSICENTKRYARLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGAARSPQNQYPPELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPRMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQMVQGLLSETYLEAHRIVKMSKSEEDESGAGELTREELRQITEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPAQFEPLDMKLMRRYIAMCREKQPAVPESLADYITAAYVEMRREAWASKDATYTSARTLLAILRLSTALARLRMVDTVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSEGQSVRFSEAEQRCISRGFTPAQFQAALDEYEELNVWQVNTARTRITFV	This protein is part of the following components: cytosol, MCM complex, nucleoplasm, CMG complex, and nucleus. This protein is involved in the following processs: cellular response to xenobiotic stimulus, DNA duplex unwinding, pre-replicative complex assembly involved in nuclear cell cycle DNA replication, cellular response to DNA damage stimulus, regulation of phosphorylation, DNA replication, DNA unwinding involved in DNA replication, DNA replication initiation, cell cycle, DNA strand elongation involved in DNA replication, cell population proliferation, and double-strand break repair via break-induced replication. This protein contributes to the following function: single-stranded 3'-5' DNA helicase activity. This protein is active in the following component: nucleus. This protein is located in the following components: cytosol, nucleoplasm, chromosome, and nucleus. This protein enables hydrolase activity: hydrolase activity. This protein is involved in metabolic process: DNA replication initiation, DNA strand elongation involved in DNA replication, and DNA replication. This protein enables catalytic activity: single-stranded 3'-5' DNA helicase activity, DNA helicase activity, and helicase activity. This protein enables nucleotide binding: ATP binding, and nucleotide binding. This protein is involved in cellular response to DNA damage stimulus: double-strand break repair via break-induced replication, and cellular response to DNA damage stimulus. This protein enables DNA binding: DNA replication origin binding, DNA binding, and single-stranded DNA binding. This protein is part of nucleus: nucleus. This protein is part of cytosol: cytosol. This protein is involved in cell cycle: cell cycle. This protein enables the following functions: DNA replication origin binding, hydrolase activity, ATP binding, DNA helicase activity, single-stranded DNA binding, helicase activity, DNA binding, and nucleotide binding.
MASSGSVQQLPLVLLMLLLASAARARLYFRSGQTCYHPIRGDQLALLGRRTYPRPHEYLSPADLPKNWDWRNVNGVNYASVTRNQHIPQYCGSCWAHGSTSAMADRINIKRKGAWPSILLSVQNVIDCGNAGSCEGGNDLPVWEYAHKHGIPDETCNNYQAKDQDCDKFNQCGTCTEFKECHTIQNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATEMMSNYTGGIYAEHQDQAVINHIISVAGWGVSNDGIEYWIVRNSWGEPWGEKGWMRIVTSTYKGGTGDSYNLAIESACTFGDPIV	This protein is part of the following components: cell surface, endoplasmic reticulum, collagen-containing extracellular matrix, growth cone, cytoplasmic vesicle, intracellular membrane-bounded organelle, lysosome, cell cortex region, and extracellular space. This protein is involved in the following processs: positive regulation of neuron apoptotic process, positive regulation of neural precursor cell proliferation, regulation of neuron death, negative regulation of plasminogen activation, epithelial tube branching involved in lung morphogenesis, negative regulation of neuron projection development, proteolysis, negative regulation of protein binding, and proteolysis involved in cellular protein catabolic process. This protein acts upstream of or within the following processs: negative regulation of protein binding, positive regulation of neuron apoptotic process, negative regulation of plasminogen activation, negative regulation of neuron projection development, proteolysis, positive regulation of neural precursor cell proliferation, and regulation of neuron death. This protein is active in the following components: extracellular space, and lysosome. This protein is located in the following components: lysosome, cytoplasmic vesicle, collagen-containing extracellular matrix, cell cortex region, growth cone, extracellular space, cell surface, and endoplasmic reticulum. This protein enables hydrolase activity: hydrolase activity, cysteine-type endopeptidase activity, carboxypeptidase activity, peptidase activity, and cysteine-type peptidase activity. This protein is part of cytoplasm: cell cortex region. This protein is involved in proteolysis: proteolysis involved in cellular protein catabolic process, and proteolysis. This protein enables the following functions: hydrolase activity, peptidase activity, carboxypeptidase activity, cysteine-type endopeptidase activity, and cysteine-type peptidase activity.
DQGAGVTYLEPSASQIGHKESIKDTARVLGRMYDGIEYRGFGQDVVEELAKYAGVPVFNGLTNEFHPTQMLADALTMREHSGKPLSQTAFAYVGDARYNMANSLLVLGAKLGMDVRIGAPKTLWPSEHIVARARAVAKETGGRILLTENAEEAVKGVDFIHTDVWVSMGEPKEAWQERIDLLKDYRVTPELMAASGNPQVKFMHCLPAFHNRETKVGEWIYETFGLNGVEVT	This protein is part of the following component: cytoplasm. This protein is involved in the following processs: cellular amino acid metabolic process, ornithine metabolic process, arginine biosynthetic process, and cellular amino acid biosynthetic process. This protein is located in the following component: cytoplasm. This protein is involved in metabolic process: ornithine metabolic process, and cellular amino acid metabolic process. This protein is part of cytoplasm: cytoplasm. This protein enables transferase activity: carboxyl- or carbamoyltransferase activity, ornithine carbamoyltransferase activity, and transferase activity. This protein is involved in cellular amino acid biosynthetic process: cellular amino acid biosynthetic process, and arginine biosynthetic process. This protein enables the following functions: transferase activity, ornithine carbamoyltransferase activity, amino acid binding, and carboxyl- or carbamoyltransferase activity.
MAIKGPRKHLKRLAAPANWQLPRKERTFTVRPSPGPHSMDKSLPLLLIVRDTLKCADNAREAKKIIQMGKILIDGVKRKEYKHPVGLMDVLSIPELNENYLVLFDENGRISLKKTEKTGVKLCKIVNKTVIKGGHIQLNLHDGRNQIVKVANALKAEEDIYKTGDSVLVSLPEQAVVGHVEFNEGKLAYITGGKHVGEFAKVVEVEKRTLYSDIVTLENKDGEKFKTIKPYVFIVGQDEPVISM	This protein is part of the following component: ribosome. This protein is involved in the following process: translation. This protein is located in the following component: ribosome. This protein enables RNA binding: rRNA binding, and RNA binding. This protein is involved in translation: translation. This protein enables structural constituent of ribosome: structural constituent of ribosome. This protein is part of ribosome: ribosome. This protein enables the following functions: rRNA binding, structural constituent of ribosome, and RNA binding.
MGPQRRLSPAGAALLWGFLLQLTAAQEAILHASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLEKARIAQKGGAEAMLVVNNSVLFPPSGNRSEFPDVKILIAFISYKDFRDMNQTLGDNITVKMYSPSWPNFDYTMVVIFVIAVFTVALGGYWSGLVELENLKAVTTEDREMRKKKEEYLTFSPLTVVIFVVICCVMMVLLYFFYKWLVYVMIAIFCIASAMSLYNCLAALIHKIPYGQCTIACRGKNMEVRLIFLSGLCIAVAVVWAVFRNEDRWAWILQDILGIAFCLNLIKTLKLPNFKSCVILLGLLLLYDVFFVFITPFITKNGESIMVELAAGPFGNNEKLPVVIRVPKLIYFSVMSVCLMPVSILGFGDIIVPGLLIAYCRRFDVQTGSSYIYYVSSTVAYAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ	This protein is part of the following components: lysosomal membrane, integral component of cytoplasmic side of endoplasmic reticulum membrane, integral component of lumenal side of endoplasmic reticulum membrane, endosome, extracellular exosome, integral component of membrane, Golgi-associated vesicle membrane, membrane, lysosome, intracellular membrane-bounded organelle, late endosome membrane, plasma membrane, and late endosome. This protein is involved in the following processs: proteolysis, regulation of immune response, membrane protein proteolysis, regulation of tumor necrosis factor-mediated signaling pathway, membrane protein intracellular domain proteolysis, and membrane protein ectodomain proteolysis. This protein is active in the following components: integral component of cytoplasmic side of endoplasmic reticulum membrane, integral component of lumenal side of endoplasmic reticulum membrane, lysosomal membrane, and Golgi-associated vesicle membrane. This protein is located in the following components: lysosomal membrane, plasma membrane, membrane, late endosome, integral component of lumenal side of endoplasmic reticulum membrane, Golgi-associated vesicle membrane, integral component of membrane, integral component of cytoplasmic side of endoplasmic reticulum membrane, late endosome membrane, lysosome, endosome, intracellular membrane-bounded organelle, and extracellular exosome. This protein enables hydrolase activity: aspartic endopeptidase activity, intramembrane cleaving, hydrolase activity, peptidase activity, and aspartic-type endopeptidase activity. This protein is part of membrane: plasma membrane, late endosome membrane, lysosomal membrane, Golgi-associated vesicle membrane, and membrane. This protein is part of integral component of membrane: integral component of membrane, integral component of cytoplasmic side of endoplasmic reticulum membrane, and integral component of lumenal side of endoplasmic reticulum membrane. This protein is involved in proteolysis: membrane protein ectodomain proteolysis, membrane protein proteolysis, membrane protein intracellular domain proteolysis, and proteolysis. This protein enables the following functions: aspartic-type endopeptidase activity, peptidase activity, protein homodimerization activity, protein binding, aspartic endopeptidase activity, intramembrane cleaving, and hydrolase activity.
MAVSATGFEGFEKRLEISFFETTDFLDPQGKSLRSLTKSQLDEILTPAECTIVSSLTNSFVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPHILRLADSLCLTVKSVRYTRGSFIFPGAQSYPHRSFSEEVALLDDYFGKLNAGSKAFVMGGSDNNPQRWHVYSASSTEESAVCDKPVYTLEMCMTGLDNIKASVFFKTNSVSASEMTISSGIRNILPGSEICDFNFEPCGYSMNSIEGDAVSTIHVTPEDGFSYASFETVGYDLKALNFKELVDRVLVCFGPEEFSVAVHANLGTEVLASDCVADVNGYFSQERELEELGLGGSVLYQRFVKTVECCSPKSTLGFC	This protein is part of the following component: cytosol. This protein is involved in the following processs: S-adenosylmethioninamine biosynthetic process, spermine biosynthetic process, polyamine biosynthetic process, and spermidine biosynthetic process. This protein is active in the following component: cytosol. This protein is involved in metabolic process: spermidine biosynthetic process, S-adenosylmethioninamine biosynthetic process, polyamine biosynthetic process, and spermine biosynthetic process. This protein enables catalytic activity: carboxy-lyase activity, lyase activity, and adenosylmethionine decarboxylase activity. This protein is part of cytosol: cytosol. This protein enables the following functions: carboxy-lyase activity, lyase activity, and adenosylmethionine decarboxylase activity.
MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS	This protein is part of the following components: mitochondrial matrix, mitochondrion, and nucleus. This protein is involved in the following processs: 2-oxoglutarate metabolic process, isocitrate metabolic process, electron transport chain, tricarboxylic acid cycle, and NADH metabolic process. This protein is active in the following component: mitochondrion. This protein is located in the following components: mitochondrion, nucleus, and mitochondrial matrix. This protein is involved in metabolic process: isocitrate metabolic process, electron transport chain, and tricarboxylic acid cycle. This protein enables metal ion binding: magnesium ion binding. This protein enables catalytic activity: oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor, electron transfer activity, and isocitrate dehydrogenase (NAD+) activity. This protein enables nucleotide binding: NAD binding. This protein is part of mitochondrion: mitochondrion. This protein is part of nucleus: nucleus. This protein enables the following functions: magnesium ion binding, oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor, NAD binding, electron transfer activity, and isocitrate dehydrogenase (NAD+) activity.
MADRINESHQRFLQALMSHGIMEGSAVRALHRHCCELHKVHYMHDKLDDFVGVLNRHLQPLFMTIEKGVGEEDGLTYYALVNRVENDITKMASDYAENELELFRKTMELIILSDNGFATSISILNLADELQSKKMKKKEVEQLLQSFVQEKWLIGRNGEYTLHTRCIMELEHYIRNTYQDVAKICNVCRKVAIQSQLCENCGIPLHLQCAGKYFHGKANPTCPNCNESWPHEIPDLNQVSSQGPSHSQTETVRGRNQRSKNTSTASRTSR	This protein is part of the following components: chromosome, telomeric region, Smc5-Smc6 complex, nucleus, and chromosome. This protein is involved in the following processs: DNA repair, positive regulation of response to DNA damage stimulus, cellular response to DNA damage stimulus, protein ubiquitination, and DNA recombination. This protein is located in the following components: chromosome, nucleus, and chromosome, telomeric region. This protein is involved in metabolic process: protein ubiquitination, and DNA recombination. This protein enables metal ion binding: metal ion binding. This protein is involved in cellular response to DNA damage stimulus: cellular response to DNA damage stimulus, and DNA repair. This protein is part of nucleus: nucleus. This protein enables transferase activity: ubiquitin protein ligase activity, and transferase activity. This protein enables the following functions: protein dimerization activity, metal ion binding, ubiquitin protein ligase activity, and transferase activity.
MSDINDPNSISLPVGSSCTSRGASTETFTTSRSTTLFSSQQESKDEGNVELRESITLPTINHRVLLSLKESAKVIGTKGSTIQNVREINHVKIGLSEKQLGCSDRVLSCAGRIINVAHSLGQIVSVLKEGSTVSSAEKYAFHFLNPILPPPTRDEFQDLTLDEINKIGTSRLMVTNSQLSSIIGKGGARIKSLKERHRVKIVASRDFLPDSDERILEIQGLPNAITNVLLQISKILLNELDITFASERRYYPHLRSSSPSNAVSLAASTSGVQTGASNYLNNEFKATLKIPESYVGAIAGRRGNRIANLRKFTKTKIIVEKKIDKTVIDVDPDNRTFIILGDHFKNVKLAESMLLKNLDVEIEKRKSRLAKK	This protein is part of the following components: chromosome, cytoplasm, chromosome, telomeric region, P-body, nucleus, and chromosome, telomeric region. This protein is involved in the following processs: telomere maintenance, mRNA stabilization, telomere maintenance via telomerase, chromatin organization, regulation of translation, mRNA transport, and intracellular mRNA localization. This protein is located in the following components: cytoplasm, nucleus, chromosome, telomeric region, P-body, and chromosome. This protein is involved in metabolic process: telomere maintenance, and telomere maintenance via telomerase. This protein enables RNA binding: RNA binding, and mRNA binding. This protein is part of cytoplasm: cytoplasm. This protein is part of nucleus: nucleus. This protein enables the following functions: mRNA binding, RNA binding, and nucleic acid binding.
MLGLRRSATTLFDISQSLLRNVTFHGLRVQGIRVGNAEVPNNKPLKTGLQEVYGIGRRKSHQVLCHLGITNKLARDLTGKELIDLREEVGQHQHGDELRRRVGSEIQRLVEVDCYRGSRHRHGLPCRGQRTSTNARTKKGKAVAIAGKKKAPRK	This protein is part of the following components: mitochondrial small ribosomal subunit, small ribosomal subunit, ribosome, and mitochondrion. This protein is involved in the following process: translation. This protein is not part of the following component: chloroplast. This protein is active in the following component: mitochondrion. This protein is located in the following components: ribosome, and mitochondrion. This protein is not located in the following component: chloroplast. This protein is part of mitochondrion: mitochondrion. This protein enables RNA binding: rRNA binding, and RNA binding. This protein is part of plastid: chloroplast. This protein is involved in translation: translation. This protein enables structural constituent of ribosome: structural constituent of ribosome. This protein is part of ribosome: ribosome. This protein enables the following functions: rRNA binding, structural constituent of ribosome, RNA binding, and nucleic acid binding.
MSSAAPAKKPYRKAPPEHRELRLEIPVSRLEQEESLTDAERMKLLQQENEELRKRLASATRRTEALERELEIGQDCLELELGQSREELDKFKDKFRRLQNSYTASQRTNQELEDKLHALASLSHSWIFAIKKAEMDRKTLDWEIVELTNKLLDARNTINKLEELNERYRLDCNLAVQLLKCNKSHFRNHKLADLPCELQDMVRKHLRSGQEVASPSPSPSSSLSPGAVVPTSVIARVLEKPESLLLNSAQSGSAGRPLAEDVFVHVDMSGGDPASPPAPGSPNGECCSVSTAGGSPEEELPLPAFDKLSPYPTPSPPHPLYPGRKVIEFSEDKIRIPRNSPLPNCTYATRQAISLSLVEDGSERAHRSSVPSSPASAQGSPHHQPSPAPSALSAPASSASSEEDLLASWQRAFVDRTPPPAAVVQRTAFGRDSLPELQLHFSPGHSTAPPPSPHRERGLVLPAEPDSGFPQDEEEEMLNLPVSPEEERQSLLPDKEGTEEASGPSHVDGRAWPLPSPSRPQRSPKRMGVHHLHRKDSLTQAQEQGTVLS	This protein is part of the following components: endosome, trans-Golgi network, cell junction, bicellular tight junction, plasma membrane, cytoplasm, and Golgi apparatus. This protein is involved in the following process: Golgi organization. This protein acts upstream of or within the following process: Golgi organization. This protein is active in the following component: trans-Golgi network. This protein is located in the following components: trans-Golgi network, plasma membrane, cytoplasm, endosome, Golgi apparatus, membrane, bicellular tight junction, and cell junction. This protein is part of membrane: plasma membrane. This protein is part of cytoplasm: cytoplasm. This protein enables the following function: protein binding.
MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQENDFGDFGMDDREIMREGSAFEDDDMLVSTTTSNLLLESEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGGIFDDPPALSEAGVMLPEQPAHDDMDEDDNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFENPEVPREDQQQQHQQRDVIDEPIIEEPSRLQESVMEASRTNIDESAMPPPPPQGVKRKAGQIDPEPVMPPQQVEQMEIPPVELPPEEPPNICQLIPELELLPEKEKEKEKEKEDDEEEEDEDASGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIATPGPRFHII	This protein is part of the following components: cohesin complex, nucleus, synaptonemal complex, nuclear cohesin complex, nucleoplasm, spindle pole, membrane, chromosome, cytoskeleton, nuclear meiotic cohesin complex, chromosome, centromeric region, nuclear matrix, meiotic cohesin complex, condensed nuclear chromosome, cytosol, cytoplasm, nuclear mitotic cohesin complex, condensed chromosome, centromeric region, chromatin, and chromatin. This protein is involved in the following processs: cell division, sister chromatid cohesion, meiotic sister chromatid cohesion, apoptotic process, chromosome segregation, DNA recombination, reciprocal meiotic recombination, multicellular organism development, DNA repair, mitotic sister chromatid cohesion, synaptonemal complex assembly, double-strand break repair, positive regulation of sister chromatid cohesion, replication-born double-strand break repair via sister chromatid exchange, regulation of transcription by RNA polymerase II, protein localization to chromatin, negative regulation of G2/M transition of mitotic cell cycle, cell cycle, cellular response to DNA damage stimulus, and negative regulation of mitotic metaphase/anaphase transition. This protein is active in the following component: synaptonemal complex. This protein is located in the following components: membrane, chromatin, nucleus, chromosome, nuclear matrix, cytoplasm, cytosol, condensed nuclear chromosome, chromosome, centromeric region, nucleoplasm, cytoskeleton, and spindle pole. This protein is involved in metabolic process: DNA recombination, and reciprocal meiotic recombination. This protein is part of membrane: membrane. This protein is involved in cellular response to DNA damage stimulus: cellular response to DNA damage stimulus, double-strand break repair, and DNA repair. This protein is part of cytoplasm: cytoplasm. This protein is part of nucleus: nucleus. This protein is part of cytosol: cytosol. This protein is involved in regulation of transcription, DNA-templated: regulation of transcription by RNA polymerase II. This protein is involved in cell cycle: cell cycle, and meiotic cell cycle. This protein is involved in cell division: cell division. This protein enables the following functions: protein binding, and chromatin binding.
MSILTYLEFHLYYTLPVLAALCWLLKPFHSQQDNLKYKFLMLMAASTASIWDNYIVYHRAWWYCPTCVVAVIGYVPLEEYMFFIIMTLMTVAFSNFVMRWHLHTFFIRPNTSWKQTLLVRLVPVSALLAITYHAWHLTLPNKPSFYGSCILWYACPVLAILWLGAGEYILRRPVAVLLSIVIPSVYLCWADIVAISAGTWHISLRTSTGKMVVPDLPVEECLFFTLINTVLVFATCAIDRAQAILHLYKSSVQNQNPKQAISLFQHVKELAWAFCLPDQMLNNELFDDLTISWDILRKASKSFYTASAVFPSYVRQDLGVLYAFCRATDDLCDDESKSVQERRDQLDLTRQFVRDLFSQKTSAPIVIDWELYQNQLPASCISAFRAFTRLRHVLEVDPVEELLDGYKWDLERRPILDEQDLEAYSACVASSVGEMCTRVILAQDQKENDAWIIDRAREMGLVLQYVNIARDIVTDSETLGRCYLPQQWLRKEETEQIQQGNARSLGDQRLLGLSLKLVGKADAIMVRAKKGIDKLPANCQGGVRAACQVYAAIGSVLKQQKTTYPTRAHLKGSERAKIALLSVYNLYQSEDKPVALRQARKIKSFFVD	This protein is part of the following components: integral component of membrane, and membrane. This protein is involved in the following processs: carotenoid biosynthetic process, carotene biosynthetic process, biosynthetic process, and metabolic process. This protein is located in the following components: integral component of membrane, and membrane. This protein enables hydrolase activity: 15-cis-phytoene synthase activity. This protein is involved in metabolic process: biosynthetic process, and metabolic process. This protein enables catalytic activity: isomerase activity, lycopene beta cyclase activity, catalytic activity, and intramolecular lyase activity. This protein is part of membrane: membrane. This protein is part of integral component of membrane: integral component of membrane. This protein enables transferase activity: squalene synthase activity, transferase activity, transferring alkyl or aryl (other than methyl) groups, transferase activity, farnesyl-diphosphate farnesyltransferase activity, and geranylgeranyl-diphosphate geranylgeranyltransferase activity. This protein is involved in lipid metabolic process: carotenoid biosynthetic process, and carotene biosynthetic process. This protein enables the following functions: 15-cis-phytoene synthase activity, intramolecular lyase activity, transferase activity, transferase activity, transferring alkyl or aryl (other than methyl) groups, catalytic activity, isomerase activity, farnesyl-diphosphate farnesyltransferase activity, lycopene beta cyclase activity, squalene synthase activity, and geranylgeranyl-diphosphate geranylgeranyltransferase activity.
MRPLMLQGHERSITQIKYNREGDLLFSSSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVDWESRKLITGAGDMTTKLWDVEYGTVIASIATKSSVRTSNFSFSGNQAAYSTDKAMGQNCELFIIDVRNADSTLSEQEPTLRIPMVESKITSMQWGPLDETIITGHDNGNIAIWDVRKGQKVVDSGVDHAAGINDMQLSKDGTMFVTASKDNTAKLFDAESLMCLKTYKTERPVNSAAISPIFDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQSFDSTYFENIFE	This protein is part of the following components: eukaryotic 48S preinitiation complex, eukaryotic 43S preinitiation complex, eukaryotic translation initiation factor 3 complex, and cytoplasm. This protein is involved in the following processs: cytoplasmic translational initiation, translation, formation of cytoplasmic translation initiation complex, and translational initiation. This protein is located in the following component: cytoplasm. This protein is involved in metabolic process: translational initiation, and cytoplasmic translational initiation. This protein enables RNA binding: translation initiation factor activity. This protein is part of cytoplasm: cytoplasm. This protein is involved in translation: translation. This protein enables the following function: translation initiation factor activity.
MKVLEERNAFLSDYEVLKFLTDLEKKHLWDQKSLAALKKSRSKGKQNRPYNHPELQGITRNVVNYLSINKNFINQEDEGEERESSGAKDAEKSGISKMSDESFAELMTKLNSFKLFKAEKLQIVNQLPANMVHLYSIVEECDARFDEKTIEEMLEIISGYA	This protein is part of the following components: cytosol, nucleoplasm, RNA polymerase complex, nucleus, and RNA polymerase III complex. This protein is involved in the following processs: termination of RNA polymerase III transcription, DNA-templated transcription, initiation, cellular metabolic process, transcription initiation from RNA polymerase III promoter, and tRNA transcription by RNA polymerase III. This protein contributes to the following function: RNA polymerase III activity. This protein is located in the following components: cytosol, nucleoplasm, and nucleus. This protein is involved in metabolic process: DNA-templated transcription, initiation, termination of RNA polymerase III transcription, tRNA transcription by RNA polymerase III, cellular metabolic process, and transcription initiation from RNA polymerase III promoter. This protein enables catalytic activity: catalytic activity. This protein enables nucleotide binding: nucleotide binding. This protein is part of nucleus: nucleus. This protein enables transferase activity: RNA polymerase III activity, and DNA-directed 5'-3' RNA polymerase activity. This protein is part of cytosol: cytosol. This protein enables the following functions: protein binding, nucleotide binding, DNA-directed 5'-3' RNA polymerase activity, and catalytic activity.
MVLANKLDRNLRAAEESSDGEDYYEVTDRSSSASVIEADEGGNVISSDDDMSDASDHDDDKIKAQMSKVSFGALAKAQDALSSKQSVDRKRKRGDDTSKSQEDKLEALRERLRQIKAEKLANGTQPSKKAKKSKTKTKTTQDDNVEEKEDSDSDAAPHARSSKHAPAVQSSKRMVSRKRNVVEVKKPVFRDPRFDNVSGPRPEDYVVEKRYSFLKDYRASEIAELRNTIKKTKNEGEKEQLKKKLLSMESQQKARENKERLQDVTREHKKKEKELVKEGKKPFFLKKSEQKKIALVDRFQNMKAKQRDKVIERRRKKVTAKERKNMPDERRTA	This protein is part of the following components: nucleolus, and nucleus. This protein is involved in the following processs: rRNA processing, ribosome biogenesis, and cleavage involved in rRNA processing. This protein is located in the following components: nucleolus, and nucleus. This protein is involved in metabolic process: rRNA processing, and cleavage involved in rRNA processing. This protein is part of nucleus: nucleus.
MEFSSPSREECPKPSGRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGTIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ	This protein is part of the following components: membrane, lysosome, lysosomal membrane, trans-Golgi network, endoplasmic reticulum, and Golgi apparatus. This protein is involved in the following processs: negative regulation of neuron death, steroid metabolic process, positive regulation of protein metabolic process, positive regulation of protein lipidation, lysosome organization, positive regulation of protein-containing complex disassembly, negative regulation of interleukin-6 production, positive regulation of protein dephosphorylation, negative regulation of protein-containing complex assembly, lipid glycosylation, cholesterol metabolic process, negative regulation of MAP kinase activity, lipid metabolic process, positive regulation of neuronal action potential, autophagy, regulation of cellular protein metabolic process, cellular response to tumor necrosis factor, sphingosine biosynthetic process, metabolic process, ceramide biosynthetic process, termination of signal transduction, glucosylceramide catabolic process, positive regulation of proteolysis involved in cellular protein catabolic process, regulation of TOR signaling, and sphingolipid metabolic process. This protein is located in the following components: Golgi apparatus, trans-Golgi network, membrane, lysosome, lysosomal membrane, and endoplasmic reticulum. This protein enables hydrolase activity: glucosylceramidase activity, steryl-beta-glucosidase activity, hydrolase activity, and hydrolase activity, acting on glycosyl bonds. This protein is involved in metabolic process: metabolic process, and autophagy. This protein is part of membrane: membrane, and lysosomal membrane. This protein enables transferase activity: transferase activity, glycosyltransferase activity, and glucosyltransferase activity. This protein is involved in lipid metabolic process: lipid glycosylation, glucosylceramide catabolic process, sphingolipid metabolic process, steroid metabolic process, ceramide biosynthetic process, sphingosine biosynthetic process, cholesterol metabolic process, and lipid metabolic process. This protein enables the following functions: scavenger receptor binding, transferase activity, glucosyltransferase activity, hydrolase activity, glycosyltransferase activity, hydrolase activity, acting on glycosyl bonds, steryl-beta-glucosidase activity, and glucosylceramidase activity.
QDLPGNDNSTATLCLGHHAVPNGTLVKTITNDQIEVTNATELVQSSSTGKICNNPHRILDGINCTLIDALLGDPHCDVFQDETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPDSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQT	This protein is part of the following components: membrane, virion component, host cell membrane, integral component of membrane, virion membrane, host cell plasma membrane, and viral envelope. This protein is involved in the following processs: receptor-mediated endocytosis of virus by host cell, viral process, membrane fusion involved in viral entry into host cell, fusion of virus membrane with host plasma membrane, clathrin-dependent endocytosis of virus by host cell, endocytosis involved in viral entry into host cell, viral entry into host cell, fusion of virus membrane with host endosome membrane, and virion attachment to host cell. This protein is located in the following components: host cell plasma membrane, viral envelope, membrane, virion membrane, integral component of membrane, and host cell membrane. This protein is part of membrane: membrane. This protein is part of integral component of membrane: integral component of membrane. This protein enables the following function: host cell surface receptor binding.
MKLFKNLTVQVITAVIIGVIVGLVWPDVGKEMKPLGDTFINAVKMVIAPIIFFTIVLGIAKMGDMKKVGKVGGKAFIYFEVVTTLALIIGLFVVNIMKPGAGLDYSKLEKGDVSQYTQNGGQGIDWIEFITHIVPSNMVDAFAKGDILQVLFFSILFGVGLAALGEKGKSVIDFFDKVSHVFFKIIGYIMRAAPIGAFGAMAYTIGHFGLDSIKPLASLMMSVYITMFLFVFVALNIICKLYGFSLWNYLRFIKDELLIVLGTSSSESVLPRMMDKMERYGCSKSVVGLVIPTGYSFNLDGTSIYLSMATVFLAQVFGVDLSIGQQITIILVLMLTSKGAAGVTGSGFIVLASTLSALQVIPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIIVAKSENEFDEAKSIEAVEGMKKMKTAV	This protein is part of the following components: integral component of membrane, plasma membrane, and membrane. This protein is involved in the following processs: dicarboxylic acid transport, succinate transmembrane transport, malate transmembrane transport, L-aspartate transmembrane transport, and fumarate transport. This protein is active in the following components: plasma membrane, and membrane. This protein is located in the following components: plasma membrane, integral component of membrane, and membrane. This protein is part of membrane: plasma membrane, and membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is involved in transmembrane transport: transmembrane transport. This protein is involved in cation transport: malate transmembrane transport, fumarate transport, succinate transmembrane transport, and dicarboxylic acid transport. This protein enables the following functions: succinate transmembrane transporter activity, symporter activity, fumarate transmembrane transporter activity, transmembrane transporter activity, and malate.
MAGGAFIDESGHGGDYEGRVTAFVMITCIVAAMGGLLFGYDIGISGGVISMEDFLTKFFPDVLRQMQNKRGRETEYCKYDNELLTLFTSSLYLAALFASFLASTITRLFGRKVSMVIGSLAFLSGALLNGLAINLEMLIIGRLFLGVGVGFANQSVPLYLSEMAPAKIRGALNIGFQLAITIGILAANIVNYVTPKLQNGIGWRLSLGLAGVPAVMMLVGCFFLPDTPNSILERGNKEKAKEMLQKIRGTMEVEHEFNELCNACEAAKKVKHPWTNIMQARYRPQLTFCTFIPFFQQLTGINVIMFYAPVLFKTIGFGNDASLISAVITGLVNVLSTIVSIYSVDKFGRRALFLQGGFQMIVTQIAVGSMIGWKFGFNGEGNLSGVDADIILALICLYVAGFAWSWGPLGWLVPSEICPLEIRSAGQSLNVSVNMFFTFFIGQFFLTMLCHMKFGLFYFFAGMVLIMTIFIYFLLPETKGVPIEEMGKVWKEHRYWGKYSNNDDGDDVDDDAYF	This protein is part of the following components: pollen tube, membrane, plasma membrane, and integral component of membrane. This protein is involved in the following processs: transmembrane transport, and carbohydrate transport. This protein is located in the following components: plasma membrane, integral component of membrane, membrane, and pollen tube. This protein is part of membrane: plasma membrane, and membrane. This protein is part of integral component of membrane: integral component of plasma membrane, and integral component of membrane. This protein is involved in transmembrane transport: glucose import, and transmembrane transport. This protein is involved in cation transport: proton transmembrane transport. This protein enables the following functions: carbohydrate, symporter activity, and transmembrane transporter activity.
MKISTLLCLLLIATTISPQVLAGPDAVSTPVTCCYNVVKQKIHVRKLKSYRRITSSQCPREAVIFRTILDKEICADPKEKWVKNSINHLDKTSQTFILEPSCLG	This protein is part of the following components: extracellular region, and extracellular space. This protein is involved in the following processs: angiogenesis, cellular response to interleukin-1, eosinophil chemotaxis, cytoskeleton organization, lipopolysaccharide-mediated signaling pathway, monocyte chemotaxis, positive regulation of GTPase activity, positive regulation of ERK1 and ERK2 cascade, astrocyte cell migration, negative regulation of vascular endothelial cell proliferation, negative regulation of neuron apoptotic process, protein kinase B signaling, inflammatory response, negative regulation of G1/S transition of mitotic cell cycle, chemokine-mediated signaling pathway, cellular response to tumor necrosis factor, regulation of cell shape, cellular response to organic cyclic compound, neutrophil chemotaxis, cellular response to interferon-gamma, macrophage chemotaxis, immune response, positive regulation of endothelial cell apoptotic process, lymphocyte chemotaxis, G protein-coupled receptor signaling pathway, chemotaxis, negative regulation of glial cell apoptotic process, positive regulation of calcium ion import, MAPK cascade, negative regulation of natural killer cell chemotaxis, and cytokine-mediated signaling pathway. This protein acts upstream of or within the following processs: monocyte chemotaxis, negative regulation of G1/S transition of mitotic cell cycle, cytoskeleton organization, negative regulation of vascular endothelial cell proliferation, positive regulation of endothelial cell apoptotic process, negative regulation of glial cell apoptotic process, cytokine-mediated signaling pathway, positive regulation of leukocyte migration, cellular response to organic cyclic compound, negative regulation of natural killer cell chemotaxis, lipopolysaccharide-mediated signaling pathway, MAPK cascade, negative regulation of leukocyte proliferation, inflammatory response, protein kinase B signaling, positive regulation of calcium ion import, regulation of cell shape, negative regulation of neuron apoptotic process, macrophage chemotaxis, and astrocyte cell migration. This protein is active in the following component: extracellular space. This protein is located in the following components: extracellular region, and extracellular space. This protein is involved in signal transduction: lipopolysaccharide-mediated signaling pathway, chemokine-mediated signaling pathway, cytokine-mediated signaling pathway, MAPK cascade, protein kinase B signaling, and G protein-coupled receptor signaling pathway. This protein is part of extracellular region: extracellular region. This protein enables the following functions: CCR2 chemokine receptor binding, cytokine activity, chemokine activity, and CCR chemokine receptor binding.
MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTDKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLESKDSIKLQDCSALCDEEDEEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKADAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM	This protein is part of the following components: cytoplasm, cytoplasmic ubiquitin ligase complex, and cytosol. This protein is involved in the following processs: autophagy of nucleus, autophagosome assembly, autophagy, protein ubiquitination, cellular protein modification process, mitochondrial fragmentation involved in apoptotic process, protein transport, autophagy of mitochondrion, and regulation of cilium assembly. This protein acts upstream of or within the following processs: negative regulation of phagocytosis, protein ubiquitination, autophagosome assembly, cellular protein modification process, and macroautophagy. This protein is active in the following component: cytosol. This protein is located in the following components: cytosol, and cytoplasm. This protein is involved in metabolic process: autophagy of mitochondrion, autophagy of nucleus, cellular protein modification process, autophagy, macroautophagy, and protein ubiquitination. This protein is part of cytoplasm: cytoplasm. This protein enables transferase activity: Atg8 ligase activity, ubiquitin-like protein transferase activity, transferase activity, and Atg12 transferase activity. This protein is part of cytosol: cytosol. This protein is involved in protein transport: protein transport. This protein enables the following functions: transferase activity, Atg8 ligase activity, protein binding, ubiquitin-like protein transferase activity, Atg12 transferase activity, and enzyme binding.
MLPTAIVLTILLGIIAYIWGYPHWLDWREKQLFQRPLPPHWQAILGDRLPFYAQLSPQQRQKLEAKIQLFLQQKQFIGCNDFVLTDEVRLVIAAQACYLALELGSNPYPRLDTILVYPDAFQVRQITSPDGYVVEEEDTVRAGESWDRAGQLILAWGTIAWDLERWQDGHNVIFHEFAHQLDMGDGAMNGVPKLGRRNDYQRWQSIFASEYQQLLSQLENNLPTVIDPYGATNPCEFFAVVTETFFEKGQELQHNHGQLYQVLRKYYCLEPLINC	This protein is part of the following component: cytosol. This protein is involved in the following processs: proteolysis, and regulation of DNA-binding transcription factor activity. This protein is active in the following component: cytosol. This protein enables hydrolase activity: aminopeptidase activity, and metallopeptidase activity. This protein is involved in proteolysis: proteolysis. This protein is part of cytosol: cytosol. This protein is involved in regulation of transcription, DNA-templated: regulation of DNA-binding transcription factor activity. This protein enables the following functions: transcription factor binding, metallopeptidase activity, and aminopeptidase activity.
MSTSHGYRASWWTYILHQVPHTNFQFEVVDNQFAPQEWSYQQALLFLASIAGLCLAISLVLICVYLIKFCCCASQEDDDSKSHRVCCVTWSCVAAVIICCAGIGIGFYGNSETNDGVYQVTYSLMNANHTLTSINLLVSDTVELLSSVVKSDLTQLEEIFSTRTEFVVMIRNTRRQVESVAQQLTEISSFFWKGAELNPSALAEQVNFIEDYRWLAYILLLLLDLIICLFTLLSLAKQIKWLVIVMTVVSFFVLLLSWGSMGLEMATAVGLSDFCSDPDAYVMNQTQMITNINPDILQYYISCNQDVTNPFRQRLTMSQRALSNIHSQLHGLEREAVPQFPTAERNVLVVQGMLNTTEGNFHHLVALLNCRGLHKDYVDALKGLCYDGMEGILFLLLFSFLSALSFTAAVCSLPRAWKRFRNRDLDYDDMDEDDPFNPQESKRFVQWQSSI	This protein is part of the following components: plasma membrane, integral component of membrane, membrane, and chloride channel complex. This protein is involved in the following processs: chloride transport, chloride transmembrane transport, and ion transport. This protein is located in the following components: membrane, integral component of membrane, and plasma membrane. This protein is part of membrane: membrane, and plasma membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is involved in cation transport: chloride transport, chloride transmembrane transport, and ion transport. This protein enables the following function: chloride channel activity.
MLLFWWWELGDPCAWTGKGRGTLKMSPATTGTFLLTVYTLFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEVSNDPITFNTNLMGYPDRPGWLRYIQRTPYSDGVLYGSPTAENVGKPTIIEITAYNRRTFETARHNLIINIMSAEEFPLPYQAEFFIKNMNVEEMLASEVLGDFLGAVKNVWQPERLNAINITSALDRGGRVPLPIKDMKEGVYVMVGADVAFSSCLREVENPQNQLRCSQEMEPVITCDKKFRTQFYIDWCKISLVDKTKQVSTYQEVVRGEGILPDGGEYKPPSDSLKSRDYYTDFLVTLAVPSAVALVLFLILAYIMCCRREGVEKRNMQTPDIQLVHHSSIQKSTKELRDMSKNREIAWPLSTLPVFHPVTGEIIPPMHTDNYDSTNMPLMQTQPNLPHQTQIPQQQTTGKWYP	This protein is part of the following components: integral component of membrane, sarcoglycan complex, sarcolemma, cytoskeleton, plasma membrane, membrane, dystrophin-associated glycoprotein complex, dendrite, Golgi apparatus, dendrite membrane, cytoplasm, and cell projection. This protein is involved in the following processs: kidney development, brain development, and skeletal muscle tissue development. This protein is located in the following components: Golgi apparatus, cell projection, dendrite membrane, cytoplasm, membrane, integral component of membrane, plasma membrane, sarcolemma, dendrite, and cytoskeleton. This protein is part of membrane: sarcolemma, dendrite membrane, membrane, and plasma membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is part of cytoplasm: cytoplasm.
MHSAILATFFLLSWTPCWSLPLPYGDDDDDDLSEEDLVFAEHYLKSYYHPATLAGILKKSTVTSTVDRLREMQSFFGLEVTGKLDDPTLDIMRKPRCGVPDVGEYNVFPRTLKWSQTNLTYRIVNYTPDMSHSEVEKAFRKAFKVWSDVTPLNFTRIYDGTADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFIVAAHELGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQFLYGPGDEDPNPKHPKTPEKCDPALSLDAITSLRGETMIFKDRFFWRLHPQQVEAELFLTKSFWPELPNHVDAAYEHPSRDLMFIFRGRKFWALNGYDILEGYPRKISDLGFPKEVKRLSAAVHFENTGKTLFFSENHVWSYDDVNQTMDKDYPRLIEEEFPGIGNKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPTNSILWC	This protein is part of the following components: lysosome, extracellular region, intercellular canaliculus, extracellular matrix, extracellular space, and Golgi apparatus. This protein is involved in the following processs: extracellular matrix disassembly, extracellular matrix organization, bone mineralization, collagen catabolic process, bone morphogenesis, proteolysis, and endochondral ossification. This protein acts upstream of or within the following processs: response to hormone, collagen catabolic process, peptide catabolic process, growth plate cartilage development, bone morphogenesis, positive regulation of pancreatic trypsinogen secretion, heart development, bone mineralization, cellular protein metabolic process, extracellular matrix disassembly, proteolysis, and cartilage development. This protein is located in the following components: extracellular region, intercellular canaliculus, lysosome, extracellular matrix, extracellular space, and Golgi apparatus. This protein enables hydrolase activity: metallopeptidase activity, hydrolase activity, endopeptidase activity, metalloendopeptidase activity, and peptidase activity. This protein is involved in metabolic process: collagen catabolic process, cellular protein metabolic process, and peptide catabolic process. This protein enables metal ion binding: metal ion binding, calcium ion binding, and zinc ion binding. This protein is part of extracellular region: extracellular region. This protein is involved in proteolysis: proteolysis. This protein enables the following functions: metallopeptidase activity, hydrolase activity, endopeptidase activity, fibronectin binding, peptidase activity, metalloendopeptidase activity, zinc ion binding, low-density lipoprotein particle receptor binding, metal ion binding, collagen binding, calcium ion binding, and calcium-dependent protein binding.
MATPSMMPQWAYMHIAGQDASEYLSPGLVQFARATDTYFSLGNKFRNPTVAPTHDVTTDRSQRLTLRFVPVDREDTTYSYKARFTLAVGDNRVLDMASTYFDIRGVLDRGPSFKPYSGTAYNSLAPKGAPNSSQWLAKDTNAGDQALKTHTHGVAAMGGTDITAKGLQIGVDTTENKNEPIYANEIYQPEPQVGEENLQDVENFYGGRALKKETKMKPCYGSFARPTNEKGGQAKFLTDGDGQLTKNHDITMNFFDTPGGTVGQDTELEADIVMYAENVHLETPDTHVVYKPGTSDESSEANLVQQSMPNRPNYIGFRDNFVGLMYYNSTGNMGVLAGQASQLNAVVDLQDRNTELSYQLLLDSLGDRTRYFSMWNSAVDSYDPDVRIIENHGVEDELPNYCFPLDGAGTNATYQGVKVKNGQDGDVNADWEKDPNLASRNQICKGNIFAMEINLQANLWKSFLYSNVALYLPDSYKYTPANVTLPANTNTYEYMNGRVVAPSLVDAYINIGARWSLDPMDNVNPFNHHRNAGLRYRSMLLGNGRYVPFHIQVPQKFFAIKNLLLLPGSYTYEWNFRKDVNMILQSSLGNDLRVDGASVRFDSVNLYATFFPMAHNTASTLEAMLRNDTNDQSFNDYLSAANMLYPIPAKATNVPISIPSRNWAAFRGWSFTRLKTKETPSLGSGFDPYFVYSGSIPYLDGTFYLNHTFKKVSIMFDSSVSWPGNDRLLTPNEFEIKRSVDGEGYNVAQCNMTKDWFLVQMLSHYNIGYQGFHVPEGYKDRMYSFFRNFQPMSRQVVDEINYKDYKAVTLPFQHNNSGFTGYLAPTMRQGQPYPANFPYPLIGQTAVPSVTQKKFLCDRVMWRIPFSSNFMSMGALTDLGQNMLYANSAHALDMTFEVDPMDEPTLLYLLFEVFDVVRVHQPHRGVIEAVYLRTPFSAGNATT	This protein is part of the following components: viral capsid, virion component, T=25 icosahedral viral capsid, and host cell nucleus. This protein is involved in the following processs: transport of viral material towards nucleus, microtubule-dependent intracellular transport of viral material towards nucleus, viral process, and viral entry into host cell. This protein is located in the following components: viral capsid, host cell nucleus, and T=25 icosahedral viral capsid. This protein enables the following function: structural molecule activity.
MAKVPDLFEDLKNCYSENEEYGSEIDHLSLNQKSFYDASHEPLHEDCMDKLMSLSTSETSKTSKLTFKESVVMVASNGKILKKRRLSLNQFITDDDLEAIANDTEEEIIKPRSVPYNLQSNVKYNYMRIVNHQCILNDALNRSIIRDPSGQYLMAAVLNNLDNAVKFDMGAYTSEEDSQLPVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPKLFIATKQEKLVHMASGPPSITDFQILEK	This protein is part of the following components: extracellular region, cytosol, and extracellular space. This protein is involved in the following processs: cellular response to heat, positive regulation of cell division, immune response, signal transduction, fever generation, inflammatory response, and response to copper ion. This protein is located in the following components: extracellular space, cytosol, cytoplasm, and extracellular region. This protein is involved in signal transduction: signal transduction. This protein enables metal ion binding: copper ion binding. This protein is part of extracellular region: extracellular region. This protein is part of cytosol: cytosol. This protein enables the following functions: cytokine activity, interleukin-1 receptor binding, and copper ion binding.
MVTIRADEISNIIRERIEQYNREVTIVNTGTVLQVGDGIARIYGLDEVMAGELVEFEEGTIGIALNLESNNVGVVLMGDGLMIQEGSSVKATGKIAQIPVSEAYLGRVINALANPIDGRGKISASESRLIESPAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELIIGDRQTGKTAVATDTILNQQGQNVICVYVAIGQKASSVAQVVTSLQERGAMEYTIVVAETADSPATLQYLAPYTGAALAEYFMYREQHTLIIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSSQLGEGSMTALPIVETQSGDVSAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFSQFSSDLDKATQNQLARGQRLRELLKQSQSAPLTVEEQIMTIYTGTNGYLDGLEIGQVRKFLVQLRTYLKTNKPQFQEIIASTKTLTAEAESFLKEGIQEQLERFLLQEKV	This protein is part of the following components: chloroplast thylakoid membrane, membrane, thylakoid lumen, stromule, plastoglobule, thylakoid, mitochondrion, chloroplast thylakoid, plastid, plasma membrane, proton-transporting ATP synthase complex, catalytic core F(1), cytosol, and chloroplast. This protein is involved in the following processs: ATP metabolic process, response to cold, ATP biosynthetic process, ATP synthesis coupled proton transport, ion transport, defense response to bacterium, and proton transmembrane transport. This protein contributes to the following function: ATP hydrolysis activity. This protein is located in the following components: thylakoid lumen, mitochondrion, thylakoid, membrane, plastid, plastoglobule, stromule, chloroplast thylakoid membrane, chloroplast thylakoid, chloroplast, and cytosol. This protein is involved in metabolic process: ATP metabolic process, and ATP biosynthetic process. This protein enables metal ion binding: zinc ion binding. This protein enables catalytic activity: proton-transporting ATP synthase activity, rotational mechanism. This protein enables nucleotide binding: nucleotide binding, ATP binding, and adenyl ribonucleotide binding. This protein is part of membrane: membrane, and chloroplast thylakoid membrane. This protein is part of mitochondrion: mitochondrion. This protein is part of cytosol: cytosol. This protein is involved in cation transport: ATP synthesis coupled proton transport, proton transmembrane transport, and ion transport. This protein is part of plastid: chloroplast, and plastid. This protein enables the following functions: proton-transporting ATP synthase activity, rotational mechanism, ATP binding, mRNA binding, adenyl ribonucleotide binding, ADP binding, nucleotide binding, zinc ion binding, and proton-transporting ATPase activity, rotational mechanism.
MLYLPCLLLWAFPQFWGQSEVQQNYTFGCLQISSFANRSWSRTDSVVWLGDLQTHRWSNDSDTISFTKPWSQGKFSNQQWEKLQHMFQVYRTSFTRDIKEIVKMMSPKEDYPIEVQLSAGCEMYPGNASESFLHVAFQGEYVVRFHGTSWQKVPEAPSWLDLPIKMLNADEGTRETVQILLNDTCPQFVRGLLEAGKPDLEKQEKPVAWLSRGPNPAHGHLQLVCHVSGFHPKPVWVMWMRGDQEQGGTHRGDILPNADETWYLQATLDVEAGDEAGLACRVKHSSLEGQDIILYWGGRQVSPVLIFLIVGVLVLVVCAVAYYIIRKRRRSYQDIM	This protein is part of the following components: basolateral plasma membrane, membrane, extracellular space, endoplasmic reticulum, endosome membrane, integral component of membrane, cytoplasm, early endosome, lysosomal membrane, late endosome, lysosome, endosome, endoplasmic reticulum membrane, cell surface, external side of plasma membrane, and plasma membrane. This protein is involved in the following processs: positive regulation of interferon-gamma production, positive regulation of interleukin-4 production, innate immune response, positive regulation of T cell mediated cytotoxicity, positive regulation of interleukin-4 production, positive thymic T cell selection, regulation of immature T cell proliferation in thymus, positive regulation of interleukin-2 production, immune system process, positive regulation of NK T cell differentiation, positive regulation of T cell proliferation, positive regulation of interferon-gamma production, regulation of immune response, antigen processing and presentation, endogenous lipid antigen via MHC class Ib, positive regulation of macrophage activation, antigen processing and presentation, exogenous lipid antigen via MHC class Ib, positive regulation of interleukin-2 production, positive regulation of NK T cell activation, antigen processing and presentation, and NK T cell differentiation. This protein is active in the following components: extracellular space, and external side of plasma membrane. This protein is located in the following components: endosome, endoplasmic reticulum membrane, external side of plasma membrane, endosome membrane, integral component of membrane, cytoplasm, early endosome, lysosome, cell surface, endoplasmic reticulum, late endosome, basolateral plasma membrane, membrane, plasma membrane, and lysosomal membrane. This protein is part of membrane: basolateral plasma membrane, endoplasmic reticulum membrane, membrane, endosome membrane, plasma membrane, and lysosomal membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is part of cytoplasm: cytoplasm. This protein enables the following functions: histone binding, endogenous lipid antigen binding, lipopeptide binding, lipid antigen binding, exogenous lipid antigen binding, cell adhesion molecule binding, and T cell receptor binding.
MAAAVDTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNLVMVFGEITTKANVDYEKIVRQTCRDIGFVSADVGLDADNCKVLVYIEQQSPDIAQGVHGHLSRRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIARQAAKSIVAAGLARRCIVQISYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKETFDFRPGMIAINLDLLKGGSRYLKTAAYGHFGRDDADFTWETVKPLKWEKPQA	This protein is part of the following component: cytoplasm. This protein is involved in the following processs: one-carbon metabolic process, and S-adenosylmethionine biosynthetic process. This protein is located in the following component: cytoplasm. This protein is involved in metabolic process: S-adenosylmethionine biosynthetic process, and one-carbon metabolic process. This protein enables metal ion binding: metal ion binding. This protein enables nucleotide binding: ATP binding, and nucleotide binding. This protein is part of cytoplasm: cytoplasm. This protein enables transferase activity: transferase activity, and methionine adenosyltransferase activity. This protein enables the following functions: nucleotide binding, metal ion binding, ATP binding, transferase activity, and methionine adenosyltransferase activity.
MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKSRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAMLGGSFLCCTCPEPERANSIPQPYRSGPSTAAREPVVKLPASVKGPLGV	This protein is part of the following components: basolateral plasma membrane, perinuclear region of cytoplasm, integral component of membrane, cytoplasm, apical junction complex, bicellular tight junction, cell junction, membrane, plasma membrane, and nucleus. This protein is involved in the following processs: positive regulation of cell junction assembly, actin cytoskeleton reorganization, positive regulation of protein phosphorylation, negative regulation of cell population proliferation, negative regulation of gene expression, calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules, negative regulation of wound healing, bicellular tight junction assembly, cell adhesion, positive regulation of gene expression, negative regulation of cell migration, and regulation of transepithelial transport. This protein acts upstream of or within the following processs: positive regulation of cell junction assembly, negative regulation of wound healing, positive regulation of gene expression, apical junction assembly, actin cytoskeleton reorganization, positive regulation of protein phosphorylation, tight junction organization, negative regulation of cell migration, negative regulation of gene expression, negative regulation of cell population proliferation, regulation of transepithelial transport, and neuronal action potential propagation. This protein is active in the following components: plasma membrane, and bicellular tight junction. This protein is located in the following components: apical junction complex, membrane, plasma membrane, nucleus, cytoplasm, bicellular tight junction, basolateral plasma membrane, perinuclear region of cytoplasm, cell junction, and integral component of membrane. This protein is part of membrane: plasma membrane, membrane, and basolateral plasma membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is part of cytoplasm: cytoplasm. This protein is part of nucleus: nucleus. This protein enables the following functions: protein binding, structural molecule activity, and identical protein binding.
MFTKSVEVLDTTLRDGAQTANISFTLNDKIRIALLLDELGVDYIEGGWPSSNPKDEEFFKEIKKYKLTKARIAAFGSTRKKESTAKEDQSLNSIIKADVDVGVLFGKSWSLHVTDVLKISLEENLDIIYDSVNYLKSHGLRVVYDAEHFYQGYKENREYALKAVKTAEEAGADVIVLCDTNGGTLPHEVYNITKDVVNHVKVKIGLHMHNDSGGAVANTVMGVVAGARHVQGTINGIGERTGNADLIQVIPNIMLKLGLNSLKGNESLKKLKEVSRVVYEIIGVHPNPYQPYVGDFAFTHKAGVHADAVMKVTRAYEHIDPTLVGNNRRFVISEVAGSSNVIYYLEKLGIKVDKKDPRVRNAVQRIKELENRGYSFDLAPASAVLVALRDLGMYRDLIKVEYWKVMNEKELAIAIVKVNGQLEVAEGVGPVHSVDIALRKALQKVYPQINKVKLTDYRVILPGEIKNTESVVRVTIEFTDGEKNWRTEGVSTSVIEASVIALIDGLDYYLQTEKLIKSEVINN	This protein is involved in the following processs: cellular amino acid biosynthetic process, branched-chain amino acid biosynthetic process, leucine biosynthetic process, isoleucine biosynthetic process, and carboxylic acid metabolic process. This protein is involved in metabolic process: carboxylic acid metabolic process, and branched-chain amino acid biosynthetic process. This protein enables catalytic activity: catalytic activity. This protein enables transferase activity: acyltransferase, acyl groups converted into alkyl on transfer, acyltransferase activity, (R)-citramalate synthase activity, 2-isopropylmalate synthase activity, and transferase activity. This protein is involved in cellular amino acid biosynthetic process: cellular amino acid biosynthetic process, isoleucine biosynthetic process, and leucine biosynthetic process. This protein enables the following functions: acyltransferase, acyl groups converted into alkyl on transfer, transferase activity, 2-isopropylmalate synthase activity, acyltransferase activity, (R)-citramalate synthase activity, and catalytic activity.
MVPSRRTWNLGATPSLRGLWRVGRAPEPEPGMARPAPAPASPAARPFPHTGPGRLRTGRGKDTPVCGDEDSSARSAARPALAQCRALSVDWAGPGSPHGLYLTLQVEHLKEKLISQAQEVSRLRSELGGTDLEKHRDLLMVENERLRQEMRRCEAELQELRTKPAGPCPGCEHSQESAQLRDKLSQLQLEMAESKGMLSELNLEVQQKTDRLAEVELRLKDCLAEKAQEEERLSRRLRDSHETIASLRAQSPPVKYVIKTVEVESSKTKQALSESQARNQHLQEQVAMQRQVLKEMEQQLQSSHQLTARLRAQIAMYESELERAHGQMLEEMQSLEEDKNRAIEEAFARAQVEMKAVHENLAGVRTNLLTLQPALRTLTNDYNGLKRQVRGFPLLLQEALRSVKAEIGQAIEEVNSNNQELLRKYRRELQLRKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENPGINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRLREAQHINKSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVELGPGLRRAELGSWSSQEHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV	This protein is part of the following components: cytoplasmic vesicle membrane, zonula adherens, cytoskeleton, membrane, centrosome, cytoplasm, cytoplasmic vesicle, kinesin complex, Golgi apparatus, cell junction, microtubule organizing center, adherens junction, extracellular exosome, and microtubule. This protein is involved in the following processs: visual perception, epithelial cell-cell adhesion, microtubule-based movement, Golgi organization, zonula adherens maintenance, and microtubule-based process. This protein is located in the following components: cytoplasmic vesicle, extracellular exosome, cell junction, microtubule, Golgi apparatus, cytoplasmic vesicle membrane, cytoskeleton, microtubule organizing center, cytoplasm, membrane, centrosome, adherens junction, and zonula adherens. This protein enables hydrolase activity: ATP hydrolysis activity. This protein enables nucleotide binding: ATP binding, and nucleotide binding. This protein is part of membrane: membrane, and cytoplasmic vesicle membrane. This protein is part of cytoplasm: cytoplasm. This protein enables the following functions: microtubule binding, minus-end-directed microtubule motor activity, protein binding, microtubule motor activity, nucleotide binding, microtubule motor activity, and ATP binding.
MRSVQAPVVCPAIRPRQVGACASLVNYTGLKPRSQFWGNRTKGVKSQGTTTTITLRLCNKSIKCVFSSHSDGNGSTAENFNENDEEYVNSSVVEAVEVKSGADGFMVKMRDGRQLRCVHNNPQGGHLPDYAPHPAIVLKMEDGTGLLLPIIVLEMPSVLLMAAMTNVQIARPTMYQVVKEMVDKMGYEVRLVRVTKRVHEAYFAQLFLSKVGNASECVSFDLRPSDAINIAVRCKIPIQVNKYLAYSDGMRVIESGKISTPAPASDGLLFTEQDRPNGQACLDTKEFNILSKMMQAVDEERYDEAAEWRDKLGQFRAKRNLRKYT	This protein is part of the following components: nucleus, and VCB complex. This protein is involved in the following processs: regulation of histone deacetylation, defense response to fungus, protein ubiquitination, negative regulation of transcription, DNA-templated, and nucleic acid phosphodiester bond hydrolysis. This protein is active in the following component: nucleus. This protein is located in the following component: nucleus. This protein enables hydrolase activity: hydrolase activity, and nuclease activity. This protein is involved in metabolic process: nucleic acid phosphodiester bond hydrolysis, and protein ubiquitination. This protein enables DNA binding: sequence-specific DNA binding. This protein is part of nucleus: nucleus. This protein is involved in regulation of transcription, DNA-templated: negative regulation of transcription, DNA-templated. This protein enables the following functions: hydrolase activity, sequence-specific DNA binding, and nuclease activity.
MDSVEGLALGPVIWTASQEELLRQPYNHLVTQPGKNFRNTLIRVFNGFYGLSERQVAAVTELVEMLHVASLLIDDIEDNSAWRRGVAAAHVVYGSPMTINTANYMYFVSMSLLGQLAAQRPAGPLQDLLKVFNEEMMNLHRGQGLDIYWRDTFTVPSEHDYLRMVMHKTGGLFRLTVRIMEALREGPDGPGSTLVPLSNLLGVLYQVRDDYLNLTDSRMSENKGFADDITEGKFSYPIIHGLQYARVHDPAGYDFLVSVLRQRTTDITTKRRVVRYLADVSGSLAYTKQRIIELATLIKTKYIPASGTELCNVIDSLTSF	This protein is part of the following component: cytoplasm. This protein is involved in the following processs: terpenoid biosynthetic process, protein transport, geranyl diphosphate biosynthetic process, geranylgeranyl diphosphate biosynthetic process, isoprenoid biosynthetic process, farnesyl diphosphate biosynthetic process, and carotenoid biosynthetic process. This protein is located in the following component: cytoplasm. This protein enables metal ion binding: metal ion binding. This protein is part of mitochondrion: mitochondrion. This protein is part of cytoplasm: cytoplasm. This protein enables transferase activity: prenyltransferase activity, transferase activity, farnesyltranstransferase activity, geranyltranstransferase activity, and dimethylallyltranstransferase activity. This protein is involved in lipid metabolic process: geranylgeranyl diphosphate biosynthetic process, isoprenoid biosynthetic process, carotenoid biosynthetic process, farnesyl diphosphate biosynthetic process, geranyl diphosphate biosynthetic process, and terpenoid biosynthetic process. This protein is involved in protein transport: protein transport. This protein enables the following functions: metal ion binding, geranyltranstransferase activity, prenyltransferase activity, farnesyltranstransferase activity, transferase activity, and dimethylallyltranstransferase activity.
MPLLRRPPAAPHRTPIHHDKRLHLFSTHNTRHRATVSSLPVTCLRIRYSSSNPVRHLCGIPSSRCHAAADPAPSKIPGGGSGALEAGVVGWRDLLLQVGEVLSLGFPVWVASACAVALWRPPAFLWVSPMAQIVGISFTMLGMGMTLTLDDLKTALLMPKELASGFLLQYSVMPLSGFLISKLLNLPSYYAAGLILVSCCPGGTASNIVTYLARGNVALSVLMTAASTFAAAFLTPLLTSKLAGQYVAVDPMGLFVSTSQVVLAPVLLGALLNQYCNGLVQLVSPLMPFIAVATVAVLCGNAIAQNASAILSSGLQVVMSVCWLHASGFFFGYVLSRTIGIDISSSRTISIEVGMQNSVLGVVLASKHFGNPLTAVPCAVSSVCHSVYGSLLAGIWRSLPPNDKGQ	This protein is part of the following components: chloroplast envelope, chloroplast, integral component of membrane, membrane, and plastid. This protein is involved in the following process: pantothenate import across plasma membrane. This protein is located in the following components: plastid, chloroplast, integral component of membrane, membrane, and chloroplast envelope. This protein is part of membrane: membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is involved in cation transport: pantothenate import across plasma membrane. This protein is part of plastid: chloroplast, and plastid.
MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYTFAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHNRYDASKSYFYTQTSSSSHE	This protein is part of the following components: host cell nucleolus, host cell nucleus, and host cell mitochondrion. This protein is involved in the following processs: modulation by virus of host cell cycle, modulation by virus of host apoptotic process, viral process, and modulation by virus of host G0/G1 transition checkpoint. This protein is located in the following components: host cell nucleus, host cell mitochondrion, and host cell nucleolus. This protein enables RNA binding: RNA binding. This protein enables the following function: RNA binding.
MKKPVDFFAMKENGEKITMITAYDYPSAKNVEQAEADMILVGDSLGMVVLGYDSTVPVTMNDMIHHTKAVKRGAPNTFVVTDMPFMTYHGSVDETIQNARKIIQESGAHAVKLEGAGEVVNKIARLTEAGAPVVAHLGLTPQSVGLTGSYKVRAKSVQEAQELIDNALAVEAAGAIAIVLEAIPRQLAEKVTKALTIPTIGIGAGLETDGQVLVYHDIIGYGINRRAKFVKAYADIDETIEPALKNYVNDVKELAFPEVKHSFTMAEEDLKGLYGRE	This protein is part of the following component: cytoplasm. This protein is involved in the following process: pantothenate biosynthetic process. This protein is located in the following component: cytoplasm. This protein is involved in metabolic process: pantothenate biosynthetic process. This protein enables metal ion binding: metal ion binding. This protein enables catalytic activity: catalytic activity. This protein is part of cytoplasm: cytoplasm. This protein enables transferase activity: transferase activity, and 3-methyl-2-oxobutanoate hydroxymethyltransferase activity. This protein enables the following functions: 3-methyl-2-oxobutanoate hydroxymethyltransferase activity, transferase activity, catalytic activity, and metal ion binding.
MNSTPDLISPQKSSENSNADLPSNSSQVMNMPEEKGVQDDFQAEADQVLTNPNTGKGAYVTVSICCVMVAFGGFVFGWDTGTISGFVAQTDFLRRFGMKHKDGSYYLSKVRTGLIVSIFNIGCAIGGIILAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLISEVAPKEMRGTLVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLVEAGQIDEARASLSKVNKVAPDHPFIQQELEVIEASVEEARAAGSASWGELFTGKPAMFKRTMMGIMIQSLQQLTGDNYFFYYGTTVFNAVGMSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLLYGAIGMVCCYVVYASVGVTRLWPNGEGNGSSKGAGNCMIVFACFYIFCFATTWAPIAYVVISETFPLRVKSKAMSIATAANWLWGFLIGFFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNDMYAEGVLPWKSASWVPTSQRGANYDADALMHDDQPFYKKMFGKK	This protein is part of the following components: integral component of membrane, membrane, cell periphery, and plasma membrane. This protein is involved in the following processs: glucose transmembrane transport, transmembrane transport, hexose transmembrane transport, carbohydrate import across plasma membrane, glucose import, fructose transmembrane transport, mannose transmembrane transport, proton transmembrane transport, and carbohydrate transport. This protein is active in the following components: membrane, and plasma membrane. This protein is located in the following components: cell periphery, membrane, plasma membrane, and integral component of membrane. This protein is part of membrane: membrane, and plasma membrane. This protein is part of integral component of membrane: integral component of plasma membrane, and integral component of membrane. This protein is involved in transmembrane transport: mannose transmembrane transport, glucose transmembrane transport, glucose import, hexose transmembrane transport, transmembrane transport, carbohydrate import across plasma membrane, and fructose transmembrane transport. This protein is involved in cation transport: proton transmembrane transport. This protein enables the following functions: glucose transmembrane transporter activity, carbohydrate, transmembrane transporter activity, hexose transmembrane transporter activity, mannose transmembrane transporter activity, and fructose transmembrane transporter activity.
MKIYYIGILRIGGEKALELTSARDLSQFSFFERNGVSQFMTFFSETVSQRTQAGQRQSIEEGNYIGHTYTRSEGLACVIITDKEYPVRPAYTLINKILEEYLSLHPQKDWANISATNASFNYDNLEHYIKKYQDPSQADSIMKVQQELDETKIVLHKTIESVLQRGEKLDSLVDKSEALSSSSRMFYKQAKKTNSCCIIM	This protein is part of the following components: endosome, fungal-type vacuole, membrane, Golgi apparatus, SNARE complex, plasma membrane, and integral component of membrane. This protein is involved in the following processs: endoplasmic reticulum to Golgi vesicle-mediated transport, intra-Golgi vesicle-mediated transport, vacuole fusion, non-autophagic, vesicle fusion, and vesicle-mediated transport. This protein is located in the following components: Golgi apparatus, integral component of membrane, fungal-type vacuole, membrane, plasma membrane, and endosome. This protein is part of membrane: plasma membrane, and membrane. This protein is part of integral component of membrane: integral component of membrane. This protein enables transferase activity: palmitoyltransferase activity. This protein enables the following functions: SNAP receptor activity, and palmitoyltransferase activity.
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL	This protein is part of the following components: small ribosomal subunit, microtubule organizing center, large ribosomal subunit, nucleolus, centrosome, ribonucleoprotein complex, cytoskeleton, spindle pole centrosome, cytosol, nucleoplasm, protein-DNA complex, granular component, protein-containing complex, nuclear matrix, nucleus, nuclear speck, and cytoplasm. This protein is involved in the following processs: regulation of centriole replication, negative regulation of protein kinase activity by regulation of protein phosphorylation, regulation of eIF2 alpha phosphorylation by dsRNA, regulation of endodeoxyribonuclease activity, cellular response to UV, cellular response to hypoxia, regulation of endoribonuclease activity, nucleocytoplasmic transport, cellular response to testosterone stimulus, protein stabilization, rRNA transcription, regulation of neuron apoptotic process, positive regulation of cell cycle G2/M phase transition, positive regulation of NF-kappaB transcription factor activity, positive regulation of DNA replication, DNA repair, regulation of centrosome duplication, rRNA export from nucleus, ribosomal small subunit biogenesis, positive regulation of transcription by RNA polymerase II, negative regulation of neuron apoptotic process, negative regulation of epithelial cell proliferation, ribosomal large subunit biogenesis, negative regulation of cell population proliferation, positive regulation of DNA-directed DNA polymerase activity, positive regulation of cell population proliferation, positive regulation of translation, ribosomal large subunit export from nucleus, negative regulation of centrosome duplication, regulation of mRNA stability involved in cellular response to UV, positive regulation of transcription, DNA-templated, cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA), negative regulation of cardiac muscle cell apoptotic process, chromatin remodeling, nucleosome assembly, negative regulation of apoptotic process, cardiac muscle hypertrophy, positive regulation of DNA metabolic process, positive regulation of catalytic activity, cell aging, liver regeneration, ribosomal small subunit export from nucleus, protein localization, and centrosome cycle. This protein acts upstream of or within the following processs: positive regulation of DNA-directed DNA polymerase activity, ribosomal large subunit export from nucleus, positive regulation of translation, regulation of mRNA stability involved in cellular response to UV, negative regulation of neuron apoptotic process, protein localization, negative regulation of cardiac muscle cell apoptotic process, negative regulation of apoptotic process, cell aging, positive regulation of protein localization to nucleolus, positive regulation of transcription by RNA polymerase II, regulation of cell growth, posttranscriptional regulation of gene expression, DNA repair, positive regulation of protein kinase activity, regulation of neuron apoptotic process, negative regulation of cell population proliferation, regulation of endoribonuclease activity, regulation of DNA damage response, signal transduction by p53 class mediator, regulation of centriole replication, positive regulation of cell population proliferation, regulation of centrosome duplication, positive regulation of NF-kappaB transcription factor activity, regulation of cell cycle, negative regulation of gene expression, positive regulation of cellular biosynthetic process, rRNA transcription, regulation of protein stability, cell volume homeostasis, nucleocytoplasmic transport, positive regulation of transcription, DNA-templated, negative regulation of protein kinase activity by regulation of protein phosphorylation, rRNA export from nucleus, negative regulation of centrosome duplication, positive regulation of DNA metabolic process, nucleosome assembly, ribosomal small subunit biogenesis, cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA), regulation of eIF2 alpha phosphorylation by dsRNA, cellular response to UV, ribosomal large subunit biogenesis, negative regulation of epithelial cell proliferation, positive regulation of catalytic activity, centrosome cycle, ribosomal small subunit export from nucleus, regulation of endodeoxyribonuclease activity, negative regulation of mRNA splicing, via spliceosome, positive regulation of centrosome duplication, positive regulation of cell cycle G2/M phase transition, positive regulation of DNA replication, protein stabilization, and positive regulation of protein ubiquitination. This protein is active in the following components: nucleolus, nucleoplasm, cytoplasm, and centrosome. This protein is located in the following components: cytoskeleton, nuclear matrix, cytosol, nucleus, granular component, nuclear speck, nucleoplasm, spindle pole centrosome, nucleolus, cytoplasm, microtubule organizing center, and centrosome. This protein is involved in metabolic process: rRNA transcription, and cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA). This protein enables nucleotide binding: ATP binding. This protein is involved in cellular response to DNA damage stimulus: DNA repair. This protein enables RNA binding: RNA binding, and rRNA binding. This protein is part of cytoplasm: cytoplasm. This protein enables DNA binding: DNA binding. This protein is part of nucleus: nucleus. This protein is part of cytosol: cytosol. This protein is involved in regulation of transcription, DNA-templated: positive regulation of transcription by RNA polymerase II, positive regulation of NF-kappaB transcription factor activity, and positive regulation of transcription, DNA-templated. This protein enables the following functions: ribosomal large subunit binding, protein N-terminus binding, identical protein binding, protein kinase inhibitor activity, NF-kappaB binding, DNA-binding transcription factor binding, nucleic acid binding, unfolded protein binding, histone binding, core promoter sequence-specific DNA binding, protein binding, ATP binding, DNA binding, protein homodimerization activity, ribosomal small subunit binding, phosphatidylinositol-3,4,5-trisphosphate binding, enzyme binding, RNA binding, chromatin binding, Tat protein binding, transcription factor binding, core promoter sequence-specific DNA binding, transcription coactivator activity, DNA-binding transcription factor binding, rRNA binding, protein kinase binding, p53 binding, and protein kinase B binding.
MVPGKFIFTATFVLLCTIIAVVLEYQSKKDKPVLDKEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQVLGLPIGQHISVQANINGKDILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPDQFKVYYLLDKAPEAWTGGVGYITVDTMKERLPAPAEGVQLLVCGPPPMVSSIKRNAVTLGYEKAKPISKMGDQIFVF	This protein is part of the following components: integral component of membrane, membrane, mitochondrion, mitochondrial outer membrane, endoplasmic reticulum, and endoplasmic reticulum membrane. This protein is located in the following components: endoplasmic reticulum, mitochondrion, membrane, endoplasmic reticulum membrane, mitochondrial outer membrane, and integral component of membrane. This protein enables catalytic activity: cytochrome-b5 reductase activity, acting on NAD(P)H, NADH dehydrogenase activity, and oxidoreductase activity. This protein is part of membrane: endoplasmic reticulum membrane, membrane, and mitochondrial outer membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is part of mitochondrion: mitochondrion. This protein enables the following functions: cytochrome-b5 reductase activity, acting on NAD(P)H, NADH dehydrogenase activity, and oxidoreductase activity.
SQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL	This protein is part of the following components: immunoglobulin complex, circulating, membrane, external side of plasma membrane, T cell receptor complex, plasma membrane, and integral component of membrane. This protein is involved in the following processs: immune system process, positive regulation of B cell activation, defense response to bacterium, phagocytosis, recognition, innate immune response, B cell receptor signaling pathway, adaptive immune response, phagocytosis, engulfment, and complement activation, classical pathway. This protein is active in the following component: external side of plasma membrane. This protein is located in the following components: membrane, plasma membrane, and integral component of membrane. This protein is involved in signal transduction: B cell receptor signaling pathway. This protein is part of membrane: membrane, and plasma membrane. This protein is part of integral component of membrane: integral component of membrane. This protein enables the following functions: immunoglobulin receptor binding, and antigen binding.
MPSLMVGGTTSSAGKSLLAAAFCRILARRGYDVAPFKAQNMSLNSFVTSKGKEIAIAQAYQAFAAGIEPDERMNPVLLKPKGNFVSQLVVMGEAVGDVDSRKYYGVKVEWLKRVVEEAYLSLAEEYDFVVIEGAGGMAEINLYERDLPNIHIARFARPDILIVGDIDRGGVFASLYGTYALLPDDVKPLVKGFVINRLRGREDVLESGIRELERLTGIRVLGVLPYLDYNFPSEDSLNIEEWGAEGTVGIVRLPRVSNFTDFEPLREHARFLSLNSSLNGCEVVIIPGSKDTIADLKALKSSKLGEEIVRKAGEIPVIGICGGYQIMCRELVDMGVEHGRIRAKGLGLLDAVTEFREYRKRTVQVEKRVNGNAVILDRIRGEKVWGYEIHKGITRASNPIFEDDGCASEDGMCWGTYLHGLFWNENVLRALGGYLGIKFRQKEDWADLIADEVEGRLDLGVLGL	This protein is involved in the following processs: cobalamin biosynthetic process, glutamine metabolic process, and cobalamin transport. This protein is involved in metabolic process: glutamine metabolic process, and cobalamin biosynthetic process. This protein enables catalytic activity: catalytic activity. This protein enables the following functions: catalytic activity, and ABC-type vitamin B12 transporter activity.
MSNGSVPVSGIGGRGDGEGSSQVHMESTGGMDRAKVFAVYGKGGIGKSTTSSNLAVAFSQLGKRVLQIGCDPKHDSTFTLTKRLVPTVIDSLEEVDFHMEELRPEDYVYEGYNGVLCVEAGGPPAGTGCGGYVVGQTVKLLKQHHLLEETDVVIFDVLGDVVCGGFAAPLQHADQALIVTANDFDSIFAMNRIAGAIQAKAKNYKVRLGGVIANRSERTDQIDRINERIGLRTLAHVPNYDVVRRSRLHKSTLFELEEQSEELERVRDEYLSLAAALWNGVDPLSPSPLKDREVFDLLGFD	This protein is involved in the following processs: light-independent bacteriochlorophyll biosynthetic process, photosynthesis, dark reaction, chlorophyll biosynthetic process, photosynthesis, and bacteriochlorophyll biosynthetic process. This protein is involved in metabolic process: chlorophyll biosynthetic process, light-independent bacteriochlorophyll biosynthetic process, bacteriochlorophyll biosynthetic process, and photosynthesis. This protein enables metal ion binding: metal ion binding. This protein enables catalytic activity: oxidoreductase activity, oxidoreductase activity, acting on the CH-CH group of donors, iron-sulfur protein as acceptor, and oxidoreductase activity, acting on iron-sulfur proteins as donors. This protein enables nucleotide binding: ATP binding, and nucleotide binding. This protein is involved in carbohydrate metabolic process: photosynthesis, dark reaction. This protein enables the following functions: oxidoreductase activity, acting on the CH-CH group of donors, iron-sulfur protein as acceptor, ATP binding, iron-sulfur cluster binding, oxidoreductase activity, metal ion binding, 4 iron, 4 sulfur cluster binding, nucleotide binding, and oxidoreductase activity, acting on iron-sulfur proteins as donors.
MKIKVTFQERIIEHNFETEITNLQQVTQKLCSLFLITNYYSYSLFLSSGQLVDNINLIDEGSEIIIKHLNRLGTISIGSGYSNSVVGTTNNNAPSSPSSSININGQQIQQQIQQQIQQQQQQQQQQQQQVQLSPDTLINNLLNNLKDNTFKKKAFFDLKDLKEEILIKKFVEKNGIEVIVCQLKELTGNTLSYALSALQTIMSYEFTITSMTSTDTASLITQLLPLTENTSNPSISKTSLSLLCLFLNQSNNLNFKQFSSTLVLEYNEKTKRNYNHTLVQLLSSSNTVDVQLNALTLINIIIGKTMSTTIPGLENGSVTGGENGFNKLLKELDEYEINQKLKKLVESIIVAPELKRQLYIYQRHRFQVITNRKNVTFNKESSEHDALLMKLWSLTYPGVKLESRVSEQWKQMGFQGTDPCTDFRAMGIWGLDNLIYFAQNYNEKFRKIVNSQIDRKEREYPTATAGIVLTFELYNSIFKMGTPNLNPYNSTTSNTTSNTTSTTNIDDLPFFPLFFSHPHAFEEVYCTTFQILDSTWDDMNGTYMHFQKIMSSVKNLIITALESKPTTLEAFDWKCQKNTKNSNGGTNSNQNNSSSNLLLSNFANGSSLLSLLNDLSSSSRDDMKKLLTGVNYQVLDLIKSQKISYFQEGFQFKLHKQLKTKQSLPLNWIFIRLFNNNNNNNNNNENCSYEIQYCFLSTELNQPPLPNQSIPTNYNTIKISDLFFNGESTNSNNKKKDKSLSYFNISIKDEQIQSLIQNQLPLSNLNNSSNSLQLDSSTSMNSIKDSIINISSSNNNIKDNLTNNNTNTNTNNTNNNTSNGNGNSNSVSMSSININNSGQLSPNTTSPILIPQQQQQQPQSSSLSVQHQQSSTPTPSSPVLLSSPSLQSSSSSSSSSSNPNLFTIDLISSNRDDVSNFWDSIKLLSGQEIKSQEGLDDYHSLLSINTSVKLLDLDGIDIPKETPQIPILPDNFDFRTV	This protein is part of the following components: plasma membrane, and cytoplasm. This protein is involved in the following processs: actin filament organization, positive regulation of GTPase activity, and cell motility. This protein acts upstream of or within the following processs: regulation of phagocytosis, cell motility, sorocarp development, and negative regulation of actin filament polymerization. This protein is not part of the following component: cortical actin cytoskeleton. This protein is active in the following component: plasma membrane. This protein is located in the following component: cytoplasm. This protein is not located in the following component: cortical actin cytoskeleton. This protein is part of cytoplasm: cytoplasm. This protein enables the following functions: small GTPase binding, myosin II binding, GTPase activator activity, and protein binding.
MLGVSLGARLLRGVGGRRGQFGARGVSEGSAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTVTLQQAEYEFLSFVRQQTPPGLCPLAGNSVHADKKFLDKHMPQFMKHLHYRIIDVSTVKELCRRWYPEDYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKTDEKKRKIIENGENEKPVS	This protein is part of the following components: mitochondrion, mitochondrial matrix, and mitochondrial intermembrane space. This protein is involved in the following processs: nucleobase-containing compound metabolic process, RNA phosphodiester bond hydrolysis, exonucleolytic, and nucleic acid phosphodiester bond hydrolysis. This protein is active in the following component: mitochondrion. This protein is located in the following components: mitochondrion, mitochondrial matrix, and mitochondrial intermembrane space. This protein enables hydrolase activity: exonuclease activity, nuclease activity, 3'-5' exonuclease activity, hydrolase activity, and 3'-5'-exoribonuclease activity. This protein is involved in metabolic process: nucleobase-containing compound metabolic process, RNA phosphodiester bond hydrolysis, exonucleolytic, and nucleic acid phosphodiester bond hydrolysis. This protein is part of mitochondrion: mitochondrion. This protein enables the following functions: nucleic acid binding, exonuclease activity, nuclease activity, hydrolase activity, 3'-5'-exoribonuclease activity, and 3'-5' exonuclease activity.
MSLSSPTSACSSSRCYSSGLSFPIGFGSNPINVGLVCYPKRYSIAARKFVVACSSSSSDPLLVKAAKGQAISRPPAWMMRQAGRYMAVYQKLAKKHPSFRERSENTDLIVEISLQPWQAFRPDGVIIFSDILTPLPAFGVPFDIEEVKGPVIQSPIRTEEDMKRLHPIDFEKLQFVGDSLKILRREVGEHAAVLGFVGAPWTIATYIVEGGTTRTYTVIKNMCHTAPDVLRALLSHLTKAITEYVVYQVEHGAHCIQIFDSWGGQLTPEMWERWSKPYIEEIIHAVKKRCPDTPIVFYINGNGGLLERMKGTGADVIGLDWTVDMADGRRRLGSEVSVQGNVDPAYLFSPLPALTEEIERVVKCAGPKGHILNLGHGVLVGTPEEAVAHFFETARNLDYQTLFQNHVPAEKAEPELVV	This protein is part of the following components: chloroplast stroma, chloroplast, and plastid. This protein is involved in the following processs: response to cadmium ion, porphyrin-containing compound biosynthetic process, protoporphyrinogen IX biosynthetic process, and chlorophyll biosynthetic process. This protein is located in the following components: plastid, chloroplast stroma, and chloroplast. This protein is involved in metabolic process: porphyrin-containing compound biosynthetic process, chlorophyll biosynthetic process, and protoporphyrinogen IX biosynthetic process. This protein enables catalytic activity: uroporphyrinogen decarboxylase activity, lyase activity, and carboxy-lyase activity. This protein is part of plastid: plastid, and chloroplast. This protein enables the following functions: carboxy-lyase activity, uroporphyrinogen decarboxylase activity, and lyase activity.
MSVRPFESPPPYRPDEFKPNHYAPSNDMYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTGLFGGSLNYPYSGFGYGGGYGGGYGGYGYGYGGYTDPRAAKGFLLAMAAFCFIASLVIFVTSVIRSGMSRTRRYYLIVIIVSAILGIMVFIATIVYIMGVNPTAQASGSMYGSQIYMICNQFYTPGGTGLYVDQYLYHYCVVDPQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKNVSAGTQDMPPPPSDYAERVDSPMAYSSNGKVNGKRSYPESFYKSTPLVPEVAQEIPLTLSVDDFRQPRYSSNGNLETPSKRAPTKGKAGKGKRTDPDHYETDYTTGGESCEELEEDWVREYPPITSDQQRQLYKRNFDAGLQEYKSLQAELDDVNKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKRNYCKQLKSKLSHIKRMVGDYDRRKP	This protein is part of the following components: lysosomal membrane, cytoplasmic vesicle, cell-cell junction, apical plasma membrane, integral component of membrane, plasma membrane, protein-containing complex, bicellular tight junction, cell surface, endocytic vesicle, apicolateral plasma membrane, tight junction, lateral plasma membrane, membrane, and cell junction. This protein is involved in the following processs: response to interleukin-18, positive regulation of glucose import, bicellular tight junction assembly, regulation of glucose transmembrane transport, tight junction organization, cell-cell junction organization, positive regulation of gene expression, negative regulation of protein phosphorylation, cellular response to tumor necrosis factor, positive regulation of blood-brain barrier permeability, and negative regulation of gene expression. This protein acts upstream of or within the following processs: negative regulation of protein phosphorylation, positive regulation of gene expression, bicellular tight junction assembly, response to interleukin-18, positive regulation of glucose import, regulation of glucose transmembrane transport, positive regulation of blood-brain barrier permeability, negative regulation of gene expression, and cell-cell junction organization. This protein is located in the following components: cell surface, membrane, lysosomal membrane, apical plasma membrane, lateral plasma membrane, apicolateral plasma membrane, bicellular tight junction, tight junction, cytoplasmic vesicle, cell junction, endocytic vesicle, integral component of membrane, plasma membrane, and cell-cell junction. This protein is part of membrane: plasma membrane, apical plasma membrane, apicolateral plasma membrane, lysosomal membrane, and membrane. This protein is part of integral component of membrane: integral component of membrane. This protein enables the following functions: protein domain specific binding, and protein binding.
MKLCVTVLSLLVLVAAFCSPALSAPMGSDPPTSCCFTYTVRKLPRNFVTDYYETSSLCSQPAVVFQTKKGRQVCANPSDDWVQEYMDDLELN	This protein is part of the following components: extracellular space, and extracellular region. This protein is involved in the following processs: positive regulation of GTPase activity, neutrophil chemotaxis, cellular response to tumor necrosis factor, chemotaxis, monocyte chemotaxis, lymphocyte chemotaxis, chemokine-mediated signaling pathway, positive regulation of ERK1 and ERK2 cascade, cellular response to interferon-gamma, cellular response to interleukin-1, immune response, eosinophil chemotaxis, G protein-coupled receptor signaling pathway, and inflammatory response. This protein is active in the following component: extracellular space. This protein is located in the following components: extracellular region, and extracellular space. This protein is involved in signal transduction: G protein-coupled receptor signaling pathway, and chemokine-mediated signaling pathway. This protein is part of extracellular region: extracellular region. This protein enables the following functions: chemokine activity, cytokine activity, and CCR chemokine receptor binding.
MAVYRLCVTTGSYLKAGTLDNIYATLVGTCGESPKQKLDRVGRDFATGSVQKYKVRCASELGEILLLRLHKERFAFFCKDPWYCSRICVTTPDGSVVHFPCYQWIDGYCTVELRPGTARTICQDALPLLLDHRKRELQARQECYRWKIYAPGFPRMVDVSSFEEMESDKKFALTKTAPCADQDDNSGNRYLPGFPMKVDIPSLLHMEPNIRYSATKTASLIFNALPASLGMKIRGLLDRKGSWKRLDDIRNIFWCHKTFTSEYVTEHWCEDSFFGYQYLNGVNPIMLHCLSSLPSKLPVTNDMVAPLLGPGTCLQTELERGHIFLADYWILAEAPVHCLNGRQQYVTAPLCLLWLNPQGVLLPLAIQLSQIPGPESPIFLPTDCELDWLLAKTWVRNSEFLVHENNTHFLCTHLLCEAFSMATLRQLPLCHPVYKLLLPHTRYTLQVNTIARATLLNPDGLVDKVTSIGRRGLIYLMSTGLAHFTYTDFCLPDSLRARGVLTIPNYHYRDDGLKIWAAIERFVSEIVSYYYPNDACVQQDSELQAWVGEIFAQAFLGRESSGFPSRLCTPGELVKYLTAIIFNCSAQHAAVNSGQHDFGAWMPNAPSSMRQPPPQTKGNTTMESYLETLPEVNTTCSNLLLFWLVSQEPKDQRPLGTYPDEHFTEEAPRQSIAAFQKCLAQISKDIRARNESLALPYAYLDPPLIENSVSI	This protein is part of the following components: cytoplasm, and cellular_component. This protein is involved in the following processs: linoleic acid metabolic process, arachidonic acid metabolic process, establishment of skin barrier, fat cell differentiation, sphingolipid metabolic process, biological_process, lipoxygenase pathway, sensory perception of pain, hepoxilin biosynthetic process, fatty acid metabolic process, peroxisome proliferator activated receptor signaling pathway, ceramide biosynthetic process, and lipid metabolic process. This protein does not enable the following function: oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen. This protein is not involved in the following processs: epidermis development, and bicellular tight junction assembly. This protein is active in the following component: cellular_component. This protein is located in the following component: cytoplasm. This protein is involved in signal transduction: peroxisome proliferator activated receptor signaling pathway. This protein enables metal ion binding: iron ion binding, and metal ion binding. This protein enables catalytic activity: dioxygenase activity, oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen, intramolecular transferase activity, transferring hydroxy groups, hydroperoxy icosatetraenoate isomerase activity, oxidoreductase activity, hepoxilin A3 synthase activity, lyase activity, hydroperoxy icosatetraenoate dehydratase activity, and isomerase activity. This protein is part of cytoplasm: cytoplasm. This protein is involved in lipid metabolic process: sphingolipid metabolic process, linoleic acid metabolic process, hepoxilin biosynthetic process, lipoxygenase pathway, lipid metabolic process, arachidonic acid metabolic process, fatty acid metabolic process, and ceramide biosynthetic process. This protein enables the following functions: intramolecular transferase activity, transferring hydroxy groups, hydroperoxy icosatetraenoate isomerase activity, metal ion binding, dioxygenase activity, iron ion binding, oxidoreductase activity, hepoxilin A3 synthase activity, molecular_function, oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen, lyase activity, hydroperoxy icosatetraenoate dehydratase activity, and isomerase activity.
MSRQSRSRFPSPTLITKSEDLAALCTTLRREPYVTIDTEFMRERTYWPELCVVQLGGADCVAVIDTLAPELDLAPVGELLADPAVIKVFHACRQDIEIFLLRFGSIPQPMFDTQVAAMVAGFGDQVGYDTLVSSLTGGHIDKAHRFSDWSRRPLSQAQIDYAAADVTHLRGVYETLRDRLEKEGRLAWVSEEMAVLNDPATYRTDPVTMWERLRPRTNNRRYLGLLRAICAWREVEAQRLNIPRQRLIKDESLLEIAATSPADAESLAQARGVGRGFAEGRSGATLLAAIAEARGLPDADLPAIPRSRESGARPSPALVSLLKVLLAAKSEQHNVAPKLLASSEDLDRLATEAEPDVPALTGWRRDVFGQDALALKNGEICLGVDGKQIKLITTG	This protein is part of the following component: cytoplasm. This protein is involved in the following processs: tRNA 3'-end processing, nucleic acid phosphodiester bond hydrolysis, tRNA processing, cellular metabolic process, RNA phosphodiester bond hydrolysis, exonucleolytic, and nucleobase-containing compound metabolic process. This protein is located in the following component: cytoplasm. This protein enables hydrolase activity: exonuclease activity, nuclease activity, hydrolase activity, 3'-5' exonuclease activity, and ribonuclease D activity. This protein is involved in metabolic process: RNA phosphodiester bond hydrolysis, exonucleolytic, nucleobase-containing compound metabolic process, nucleic acid phosphodiester bond hydrolysis, and cellular metabolic process. This protein enables catalytic activity: catalytic activity. This protein enables nucleotide binding: nucleotide binding. This protein is part of cytoplasm: cytoplasm. This protein is not involved in tRNA processing: tRNA processing, and tRNA 3'-end processing. This protein enables the following functions: nucleotide binding, hydrolase activity, nuclease activity, nucleic acid binding, ribonuclease D activity, 3'-5' exonuclease activity, catalytic activity, and exonuclease activity.
MDGVTVIDHPLVQHKLTIMRRKETSTGSFRRLLREISTLLCYEVTRDLELTMETIETPLQTMESPILEGKKLVFASILRAGNGLLEGMLDLVPSARVSHIGVYRDHETLQPVEYYFKAPEDVAERLIIVVDPMLATGNSSIAAIDKLKERGAHNIRFLCLLAAPEGIQNFRAAHPDVPVFTASIDSHLNEKGYIVPGLGDAGDRMYGTK	This protein is involved in the following processs: uracil salvage, metabolic process, pyrimidine-containing compound salvage, nucleoside metabolic process, and UMP salvage. This protein is involved in metabolic process: nucleoside metabolic process, UMP salvage, uracil salvage, metabolic process, and pyrimidine-containing compound salvage. This protein enables metal ion binding: magnesium ion binding. This protein enables catalytic activity: catalytic activity. This protein enables nucleotide binding: GTP binding, and nucleotide binding. This protein enables transferase activity: transferase activity, glycosyltransferase activity, and uracil phosphoribosyltransferase activity. This protein enables the following functions: GTP binding, glycosyltransferase activity, uracil phosphoribosyltransferase activity, catalytic activity, transferase activity, nucleotide binding, and magnesium ion binding.
MIGKLTGTLLEKNPPEVLVDCHGVGYEVLVSMSTFYNLPAVGERVSLLTQFIVREDAQLLYGFGTAQERQAFRELIKISGVGPRTALSILSGMGVADLAQAVSLQEAGRLVKVPGIGKKTAERLLLELKGKLGADVGVRAHAANDNQADILQALLALGYNDKEAAAALKALPADVGVSEGIKLALKSLSK	This protein is part of the following component: Holliday junction helicase complex. This protein is involved in the following processs: DNA recombination, DNA repair, DNA duplex unwinding, cellular response to DNA damage stimulus, and SOS response. This protein enables hydrolase activity: hydrolase activity. This protein is involved in metabolic process: DNA recombination. This protein enables catalytic activity: four-way junction helicase activity, DNA helicase activity, and helicase activity. This protein enables nucleotide binding: nucleotide binding, and ATP binding. This protein is involved in cellular response to DNA damage stimulus: cellular response to DNA damage stimulus, SOS response, and DNA repair. This protein enables DNA binding: DNA binding. This protein enables the following functions: DNA helicase activity, nucleotide binding, helicase activity, four-way junction helicase activity, hydrolase activity, DNA binding, and ATP binding.
MFGETGTGDALRPIFMDVVSVQSQVVYGHVGNNVALPTLRAHGLNVAAVPTVMFSNTPHYPTLHGGALPIDWFGGYLSDLSARGALQRLKAILVGYLGNPEQVAVLSRWINQVLAEHPDVQVIVDPVIGDHDTGIYVADGMVEAVRELLLPLAHGLTPNDFELGHLSGRSADSVEQVVAAARSLLTDRVQWMVVTSAAPGTWGHDDMKLLIVTRDDAQVLSHPRIPVSPKGTGDLFSAKLTARLLEGMPLAEAAASASDHVVTALEATRRAQSLELQLPSNPCITHRE	This protein is involved in the following processs: pyridoxal 5'-phosphate salvage, and phosphorylation. This protein is involved in metabolic process: pyridoxal 5'-phosphate salvage. This protein enables metal ion binding: metal ion binding, zinc ion binding, and magnesium ion binding. This protein enables nucleotide binding: ATP binding, and nucleotide binding. This protein enables transferase activity: transferase activity, kinase activity, and pyridoxal kinase activity. This protein is involved in phosphorylation: phosphorylation. This protein enables the following functions: kinase activity, nucleotide binding, ATP binding, pyridoxal kinase activity, metal ion binding, zinc ion binding, transferase activity, and magnesium ion binding.
MEEPPVREEEDGEEDEGALAKSPLQLTTEDVYDISYVVGRELMALGSDPRVTRLQFKIVRVMEMLEALVNEGSLAVEELRMERDNLKQEVEGLRRAGVSGSEVNLGPDKMVVDLTDPNRPRFTLQELRDVLQERNKLKSQLLLVQEELQCYRSGLLPPRETPGGRREKDAMVTMGNGEKEERTIMKKLFSFRSGKHT	This protein is part of the following components: cell projection, cilium, cytoplasm, cytoskeleton, ciliary basal body, cytosol, microtubule organizing center, centrosome, and membrane. This protein is involved in the following processs: cilium assembly, protein transport, protein transport from ciliary membrane to plasma membrane, and epithelial cell morphogenesis. This protein is active in the following components: cytoplasm, and ciliary basal body. This protein is located in the following components: cilium, cytoplasm, cytosol, centrosome, membrane, microtubule organizing center, cytoskeleton, and cell projection. This protein is part of membrane: membrane. This protein is part of cytoplasm: cytoplasm. This protein is part of cytosol: cytosol. This protein is involved in protein transport: protein transport from ciliary membrane to plasma membrane, and protein transport. This protein enables the following functions: dynein light intermediate chain binding, protein dimerization activity, small GTPase binding, and identical protein binding.
MAKIKKKGTSGQAKNYITRTQAVRKLQISLPDFRRLCIFKGIYPREPRNKKKASKTSTPNTTFYYTKDIQYLLHEPLLRKFRDQKAVAKKIARSLGRGEVGDASRLEKNHAPKLTLDHIIKERYPTFIDALRDLDDALSLLFLFANLPSTSHVPPKTIALCQRLCHEFQHYLITTNSLRKSFLSIKGIYYQATIQGQDIMWLVPYRFVQRVNGDVDYRIMATFVEFYTTLLGFVNFRLYSSIGLRYPPKFDTRSDENGAELAAFTLEGRAVANAAKTIEGSNKQSNNSSNQEVSRDVQAKVDKVIKTAGLDKTKDEQTVEATDENTDAIDRFEPAAPEADTLPQPDISGEEAGALFAPFTFYISREAPKAPLEFILRAFGCKRIGWDAVMGDGAFTHNEADTRITHQIVDRPSLPEGALPAVPAAKEGAVPAVRPGTRIPGRTYIQPQWVWDCINEGKLLRPDLYAPGETLPPHLSPWVKPSKGAYDPRATLAEQEEEGEAEMAGEEEEEESDEEMEEAPETKKADAKADESESEDEDESVDGGMDVADSDDDESESGQEEEDFGGFDDNEAASESEDEEEAARTQHQKELEAEAAGLPFSSNGATDDAKKKKSSQAKKIAAKKRKEEEELERQKMMMSRKKRKLLEKMMYSNKKQSEEAAKLRSKRRKLEKTGEK	This protein is part of the following components: nucleolus, nucleoplasm, nucleus, and preribosome, large subunit precursor. This protein is involved in the following processs: maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA), rRNA processing, ribosomal large subunit biogenesis, maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA), and ribosome biogenesis. This protein is located in the following components: nucleoplasm, nucleolus, and nucleus. This protein is involved in metabolic process: maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA), rRNA processing, and maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA). This protein is part of nucleus: nucleus. This protein enables the following function: ribonucleoprotein complex binding.
MAHTSDGWGAPYDNQTYVEAYEQLEIALLEPLDRILETANVEEFRPKFKNHQDPNDRKNKKNNDEEWRDSIYNIATDESDTDDHEQRKNFFQPPLQVQRNSFVKNTLMEFKRSSQIDISRLAVMGCGEMSLEKGICEYLGSFGTINVLSVDIDEPSLSIGQQLLGKHLERNAEILAVETGLPVLMRSYVGDILEPDHRFADVDAIVSMEVVEHIPLPNAKKFVENVLGTLMPRIFIFSTPNHEYNAVFGMEPGEFRHGDHKFEMNRKEFSNWLEELSIRFPHYQIDPPHYIGMTRGYENLSGASQAAVCRLQVDLNTTLPQEVTPYEMVGHLPCRLGSRLIAYNLVKEAFLDWLEKIELQEHEPRTDGYSPYWIFNVQNILHHLKAPVSFALTIDEKVAIKYIQGMTSRKVHAEYSHGFNGIVILQMHSKEELIKTVQDNTL	This protein is part of the following components: nucleus, perinuclear region of cytoplasm, nucleoplasm, and cytoplasm. This protein is involved in the following processs: RNA methylation, piRNA metabolic process, gene silencing by RNA, methylation, regulation of production of siRNA involved in RNA interference, and production of siRNA involved in RNA interference. This protein is active in the following components: cytoplasm, and nucleus. This protein is located in the following components: nucleoplasm, nucleus, perinuclear region of cytoplasm, and cytoplasm. This protein is involved in metabolic process: piRNA metabolic process, and production of siRNA involved in RNA interference. This protein enables metal ion binding: metal ion binding. This protein enables RNA binding: RNA binding. This protein is part of cytoplasm: cytoplasm. This protein is part of nucleus: nucleus. This protein enables transferase activity: O-methyltransferase activity, small RNA 2'-O-methyltransferase, transferase activity, methyltransferase activity, and RNA methyltransferase activity. This protein is involved in methylation: RNA methylation, and methylation. This protein enables the following functions: O-methyltransferase activity, small RNA 2'-O-methyltransferase, transferase activity, RNA methyltransferase activity, methyltransferase activity, metal ion binding, and RNA binding.
MTTSFYDLECKDKKGESFKFDQLKGKVVLIVNVASKCGFTPQYKELEELYKKYQDKGFVILGFPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIDVNGSNADSVYNYLKSQKAGLLGFKGIKWNFEKFLVDSNGKVVQRFSSLTKPSSLDQEIQSLLSK	This protein is part of the following components: extrinsic component of mitochondrial outer membrane, nucleus, membrane, mitochondrial inner membrane, cytoplasm, extrinsic component of mitochondrial inner membrane, mitochondrion, and mitochondrial outer membrane. This protein is involved in the following processs: response to oxidative stress, cellular response to oxidative stress, and cellular oxidant detoxification. This protein is located in the following components: extrinsic component of mitochondrial outer membrane, mitochondrial inner membrane, membrane, mitochondrial outer membrane, nucleus, mitochondrion, cytoplasm, and extrinsic component of mitochondrial inner membrane. This protein enables catalytic activity: peroxidase activity, phospholipid-hydroperoxide glutathione peroxidase activity, glutathione peroxidase activity, and oxidoreductase activity. This protein is part of membrane: mitochondrial inner membrane, membrane, and mitochondrial outer membrane. This protein is part of mitochondrion: mitochondrion. This protein is part of cytoplasm: cytoplasm. This protein is part of nucleus: nucleus. This protein enables the following functions: peroxidase activity, oxidoreductase activity, phospholipid-hydroperoxide glutathione peroxidase activity, antioxidant activity, and glutathione peroxidase activity.
MSSTNHFTYLVLGAGSGGIASARRAAKHLNAKGNGDRIGIVEVTRPGGTCVNVGCVPKKVMWNTSFIKEMINAAPSYGFDFGGQQVKFNWPTIKKARDEYIKRLNGIYDSNLAKDNIVRINGYGRFSGPKEIQVNGANGEKYTADHILIAAGGRPTVPDVPGKELGITSDGFFELEDLPKSTLVVGAGYIAVELAGVLHSLGSETTMVIRQKQFLRTFDEMLHTTLLKQMTDDGVKFVTEASIKSLERDVDGKRIIATTNAGVKLPPVECVIWAIGRVPNTDDLGIDKAGIQLTEQSGFIKVDEFQNTNVPGVHAVGDICGNFLLTPVAIAAGRRLSERLFNGKSDLKFEYENVATVVFSHPPIGTVGLTEQEAITKYGTENIKCYNTSFINMFYSVQVHKVRTSMKLVCLGKEEKVIGLHIIGDGCDEIIQGFAVAVKMGCTKWDLDNTCAIHPTSAEELVTMV	This protein is part of the following components: cytoplasm, cytosol, and mitochondrion. This protein is involved in the following processs: cell redox homeostasis, glutathione metabolic process, cellular oxidant detoxification, and cellular response to oxidative stress. This protein acts upstream of or within the following processs: culmination involved in sorocarp development, glutathione metabolic process, and cell redox homeostasis. This protein is active in the following components: cytosol, and mitochondrion. This protein is located in the following component: cytoplasm. This protein is involved in metabolic process: glutathione metabolic process. This protein enables catalytic activity: oxidoreductase activity, glutathione-disulfide reductase (NADPH) activity, and oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor. This protein enables nucleotide binding: NADP binding, and flavin adenine dinucleotide binding. This protein is part of mitochondrion: mitochondrion. This protein is part of cytoplasm: cytoplasm. This protein is part of cytosol: cytosol. This protein enables the following functions: flavin adenine dinucleotide binding, glutathione-disulfide reductase (NADPH) activity, NADP binding, oxidoreductase activity, oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor, and glutathione binding.
MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ	This protein is part of the following components: glutamatergic synapse, endosome, Schaffer collateral - CA1 synapse, podosome, cell junction, cell projection, cytoplasm, early endosome membrane, postsynaptic density, intracellular component, synapse, presynapse, membrane, hippocampal mossy fiber to CA3 synapse, and cytosol. This protein is involved in the following processs: positive regulation of synaptic vesicle endocytosis, endocytosis, modulation of excitatory postsynaptic potential, synaptic vesicle uncoating, regulation of synaptic vesicle endocytosis, central nervous system development, and signal transduction. This protein is located in the following components: cell projection, cell junction, Schaffer collateral - CA1 synapse, early endosome membrane, presynapse, endosome, membrane, postsynaptic density, intracellular component, cytosol, podosome, glutamatergic synapse, hippocampal mossy fiber to CA3 synapse, synapse, and cytoplasm. This protein is involved in signal transduction: signal transduction. This protein is part of membrane: membrane, and early endosome membrane. This protein is part of cytoplasm: cytoplasm. This protein is part of cytosol: cytosol. This protein enables the following functions: cadherin binding, lipid binding, phosphatase binding, protein C-terminus binding, transmembrane transporter binding, SH3 domain binding, beta-1 adrenergic receptor binding, identical protein binding, GTPase binding, and protein binding.
MAAVDLDVQSLPRGGFRCCLCHVTTANRPSLDAHLGGRKHRHLVELRATRKAQGLRSVFVSGFPRDVDSAQLTQYFQAFGPVASVVMDKDKGVFAIVEMGDVGTREAVLSQPQHTLGGHRLRVRPREQKEFQSPASKSPKGAAPDSHQLTKALAEAPDVGAQMVKLVGLRELSEAERQLRNLVVALMQEVFTEFFPGCVVHPFGSSINSFDVHGCDLDLFLDLGDLEESQPAPKAPESPSLDSALASPLDPQALACTPASPPDSQPPSPQDSEALDFETPSSSLAPQTPDSALASETLASPQSLPPASPLQEDRGEGDLGKALELAEALSGEKTEGVAMLELVGSILRGCVPGVYRVQTVPSARRPVVKFCHRPSGLHGDVSLSNRLALHNSRFLSLCSELDGRVRPLVYTLRCWAQGRGLSGSGPLLSNYALTLLVIYFLQTRDPPVLPTVSQLTQKAGEGEQVEVDGWDCSFPRDASGLEPSTNKEPLSSLLAQFFSCVSCWDLRGSLLSLREGQALPVAGDLPSNRWEGLRLGPMNLQDPFDLSHNVAANVTSRVAGRLQNSCQAAANYCRSLQYQRRSSRGRDWGLLPLLQPSSPSSLLSATPIPLPPAPFTQLTAALAQVLREALGCHIEQGTKRLRSDRGGPEESPQGGTSKRLKLDGEEKSCEEGREEQQGYIRDHSEDGVEEMVVEVGEMVQDWVQSPGRPGEPPQMLREQLATGEEGQSGHAALAEQGPKGPEAAREGSQGETGRGVSLSSVSWRCALWHRVWQGRRRARRRLQQQTKERGRGSAGTAEWLAVEAQVTRELRGLSSAAQRPEAEPLLTFVASASQVNQTLTVTPIQDSQGLFPDLHHFLQVFLPQALRNL	This protein is part of the following components: nucleolus, nucleus, and nuclear speck. This protein is involved in the following processs: snRNA processing, pre-mRNA cleavage required for polyadenylation, mRNA processing, mRNA polyadenylation, and U6 snRNA 3'-end processing. This protein colocalizes with the following component: mRNA cleavage and polyadenylation specificity factor complex. This protein is located in the following components: nucleus, nuclear speck, and nucleolus. This protein is involved in metabolic process: U6 snRNA 3'-end processing, snRNA processing, mRNA polyadenylation, mRNA processing, and pre-mRNA cleavage required for polyadenylation. This protein enables metal ion binding: metal ion binding. This protein enables nucleotide binding: ATP binding, and nucleotide binding. This protein enables RNA binding: RNA binding, U6 snRNA binding, and mRNA 3'-UTR binding. This protein is part of nucleus: nucleus. This protein enables transferase activity: transferase activity, nucleotidyltransferase activity, polynucleotide adenylyltransferase activity, and RNA uridylyltransferase activity. This protein enables the following functions: RNA binding, transferase activity, nucleotidyltransferase activity, nucleotide binding, U6 snRNA binding, mRNA 3'-UTR binding, nucleic acid binding, RNA uridylyltransferase activity, ATP binding, polynucleotide adenylyltransferase activity, and metal ion binding.
MTTFVKLRTKAKMPLVGLGTWKSPPGQVKEAVKAAIDAGYRHFDCAYVYQNESEVGEAIQEKIKEKAVRREDLFIVSKLWSTFFEKSLMKEAFQKTLSDLKLDYLDLYLIHWPQGLQAGKEFLPKDSQGKVLMSKSTFLDAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGIAVIAYSPLGSPDRPYAKPEDPVVLEIPKIKEIAAKHKKTIAQVLIRFHVQRNVAVIPKSVTLSHIKENIQVFDFQLSEEDMAAILSLNRNWRACGLFVTSDEEDFPFHEEY	This protein is part of the following components: cytoplasm, mitochondrion, and cytosol. This protein is involved in the following process: prostaglandin metabolic process. This protein is active in the following components: cytosol, and mitochondrion. This protein is located in the following component: cytoplasm. This protein enables catalytic activity: estradiol 17-beta-dehydrogenase activity, aldo-keto reductase (NADP) activity, oxidoreductase activity, alditol, oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor, and alcohol dehydrogenase (NADP+) activity. This protein is part of mitochondrion: mitochondrion. This protein is part of cytoplasm: cytoplasm. This protein is part of cytosol: cytosol. This protein enables the following functions: oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor, alcohol dehydrogenase (NADP+) activity, D-threo-aldose 1-dehydrogenase activity, oxidoreductase activity, alditol, prostaglandin H2 endoperoxidase reductase activity, estradiol 17-beta-dehydrogenase activity, and aldo-keto reductase (NADP) activity.
MSEGAAAASPPGAASAAAASAEEGTAAAAAAAAAGGGPDGGGEGAAEPPRELRCSDCIVWNRQQTWLCVVPLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDSKGMGQDPFFLSKPSSFPKAMETTTTTTSTTSPATPSAGGAASSRTPNRISTRLTTITRAPTRFPGHRVPIRASPRSTTARNTAAPATVPSTTAPFFSSSTLGSRPPVPGTPSTQAMPSWPTAAYATSSYLHDSTPSWTLSPFQDAASSSSSSSSSATTTTPETSTSPKFHTTTYSTERSEHFKPCRDKDLAYCLNDGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEFMESEEVYQRQVLSISCIIFGIVIVGMFCAAFYFKSKKQAKQIQEQLKVPQNGKSYSLKASSTMAKSENLVKSHVQLQNYSKVERHPVTALEKMMESSFVGPQSFPEVPSPDRGSQSVKHHRSLSSCCSPGQRSGMLHRNAFRRTPPSPRSRLGGIVGPAYQQLEESRIPDQDTIPCQGIEVRKTISHLPIQLWCVERPLDLKYSSSGLKTQRNTSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQMPGISEVKSIKWCKNSYSADVVNVSIPVSDCLIAEQQEVKILLETVQEQIRILTDARRSEDYELASVETEDSASENTAFLPLSPTAKSEREAQFVLRNEIQRDSALTK	This protein is part of the following components: integral component of membrane, glutamatergic synapse, membrane, extracellular region, integral component of plasma membrane, extracellular space, and plasma membrane. This protein is involved in the following processs: chemorepulsion involved in interneuron migration from the subpallium to the cortex, animal organ development, intracellular signal transduction, regulation of cell growth, mammary placode formation, modulation of chemical synaptic transmission, negative regulation of neuron migration, nervous system development, mammary gland development, activation of transmembrane receptor protein tyrosine kinase activity, and pattern specification process. This protein is active in the following component: extracellular space. This protein is located in the following components: plasma membrane, integral component of membrane, membrane, glutamatergic synapse, extracellular region, and integral component of plasma membrane. This protein is involved in signal transduction: intracellular signal transduction. This protein is part of membrane: membrane, and plasma membrane. This protein is part of integral component of membrane: integral component of plasma membrane, and integral component of membrane. This protein is part of extracellular region: extracellular region. This protein enables the following functions: growth factor activity, chemorepellent activity, transmembrane receptor protein tyrosine kinase activator activity, signaling receptor binding, and receptor tyrosine kinase binding.
MSSYKVVIVGGGPVGALAGLYAAQRGFQVEIYEMRDEYSQVQTATAFSAKSISLTLSERGIKALRHSQCRGLAERILSTTVPVYGRMVHSRSKKRLTSRRIAYDVHGQALYAISRSEINQSLLEELSAFPNVHIFYKHRLNGLDMKQKCATFHNISRPQEPSHETKFDLLIGADGAHSTTRFFLSRYAKININQKWEDIFWCELTIPAGHALPMDCLHMWPQRDFMLFACPDKEGTLTCNLFAPENVFLELKSSGRIVEFFEKNFPGITPDLIPTDNLQKQFKSNLHHPMIDIRCSPYHYQDSCVLIGDAAHAMVPFYGQGMNTGFEDVRILFEDFLDQRRSFPSWKDNLSLSYAMQQKELPDTPQAIVEDYLEQYTKYRQPDVHIINELALQNYRELRQGVFKMSYHIRKHIEEFLSLHAPQLGWATQYRLVAFETMRYTDVLRQVRKQGLILSAVAWSCLLLFFLLCLLSLRL	This protein is part of the following components: mitochondrion, mitochondrial membrane, membrane, mitochondrial outer membrane, and cellular_component. This protein is involved in the following processs: 'de novo' NAD biosynthetic process from tryptophan, tryptophan catabolic process, pyridine nucleotide biosynthetic process, quinolinate biosynthetic process, anthranilate metabolic process, and NAD biosynthetic process. This protein is active in the following component: cellular_component. This protein is located in the following components: mitochondrial membrane, mitochondrion, mitochondrial outer membrane, and membrane. This protein is involved in metabolic process: NAD biosynthetic process, 'de novo' NAD biosynthetic process from tryptophan, quinolinate biosynthetic process, tryptophan catabolic process, anthranilate metabolic process, and pyridine nucleotide biosynthetic process. This protein enables catalytic activity: kynurenine 3-monooxygenase activity, monooxygenase activity, and oxidoreductase activity. This protein enables nucleotide binding: FAD binding, and flavin adenine dinucleotide binding. This protein is part of membrane: mitochondrial membrane, membrane, and mitochondrial outer membrane. This protein is part of mitochondrion: mitochondrion. This protein enables the following functions: monooxygenase activity, kynurenine 3-monooxygenase activity, flavin adenine dinucleotide binding, FAD binding, and oxidoreductase activity.
MNLLPKTREEFAQTDYWNEFFKKRGEKAFEWYGEYLDLCDHIHKYIKPVDKILMLGCGNSKLSMDMYDSEYRDITNIDISPVAVKKMLEQNARTRPDMKFLQMDATAMTFPDESFSVALDKGTLDALFVDDAPETKAVVENYFKEILRTMRNGGRYFCVSLLQEHILNFLVEFLPRHNCMLRIVHCLGVEQANKEKNADDAMKMPVFVVIATKFKSLPMPILEFGLGNDKMQRFTESSELSNAVRSVQKAALVFNGLARSSIAGHDEVTLDLYRPSENTPRYSIYILDQAAARGLNKYAAFIVPQGREIEWLFGTPSGRKKLQASAKFQRLAVVTLHRDQVYNTLEEVQAELGDTVFSLAPHGHIKQIPYLSLGSDVGKRETLISGFSKISGEFRIEEVEAGGKTLRRLIFLSNQFVVQSEALVKTIKIKGKKERKKIDFGYLACQHHLYMSVGVQLATTLQNPKKDVQKDVLVIGLGGGGLCSFLHAALPQSRITAVEIDPIMLEVAEQYFELKQDKRFHVVIDDGLAFVERCRNEDIHFDAVLFDVDSKDLSLGMSCPPQGFLAHDVLLHIKEIIGPKGLFMLNLVCRDETLKTEAIANLQKVFPAVCSYKLEEDINEVVYCANDEKYKTVEHWQKAMGTAGRGLNTTIKEHKLASEDPLEVAEFLSELKL	This protein is part of the following component: cellular_component. This protein is involved in the following processs: methylation, biological_process, and metabolic process. This protein is active in the following component: cellular_component. This protein is involved in metabolic process: metabolic process. This protein enables catalytic activity: catalytic activity. This protein enables transferase activity: transferase activity, and methyltransferase activity. This protein is involved in methylation: methylation. This protein enables the following functions: catalytic activity, transferase activity, molecular_function, and methyltransferase activity.
MLTKQTTGQAWKQIKGSITDVKGFTTAGAHCGLKRKRLDIGAIFCDVPANAAGVFTLNQIQAAPLKVTKESLAHSNGKLQAVLVNSGNANACTGASGLVDAYEMRALAAAKFAVPEEMVAVTSTGVIGEKMPMEKVRSGIEDLVLSKESTPFAEAILTTDTGTKEVCVEVVIDQKTVRIAGVAKGSGMIHPNMATMLGFITTDANIETAALKRALAKATDETFNRITVDGDTSTNDMVLVLASGLADNQPLDETHPDWANFYGALSACAESLAKKIAKDGEGATKLIEVQVAGAVSDEEAGKVAKAIVGSDLVKTAAYGKDGNWGRIICAIGYSGCTLDPDTIDIAIGPYETLVQSEPVVVDDAAISKYMEAETIVIKADLHQGQGVGKAWGCDLTYDYVRINAGYRT	This protein is part of the following component: cytoplasm. This protein is involved in the following processs: cellular amino acid biosynthetic process, arginine biosynthetic process, and metabolic process. This protein is located in the following component: cytoplasm. This protein is involved in metabolic process: metabolic process. This protein enables catalytic activity: catalytic activity. This protein is part of cytoplasm: cytoplasm. This protein enables transferase activity: acetyl-CoA, methione N-acyltransferase activity, transferase activity, acyltransferase activity, and glutamate N-acetyltransferase activity. This protein is involved in cellular amino acid biosynthetic process: arginine biosynthetic process, and cellular amino acid biosynthetic process. This protein enables the following functions: acetyl-CoA, glutamate N-acetyltransferase activity, acyltransferase activity, catalytic activity, transferase activity, and methione N-acyltransferase activity.
MELQSLIDTVSLQKLLLLGALLRLILIAYAFFHDQWFRVKYTDIDYMIVVDGARHMWNGGSPFDRTTFRYTPLLAALVMPSIWIANPMGKLIFASSDLGAAWYCYGVLKSFAKERSAKWMVSLFILFNPIVLSVSTRGNSDMLVTFMSLMVLSKFARRKCYQAAAVLGFAVHFKIYPIIYALPLTLGVWEQSVAASTNTWRRVVKTAVVVSICALMAAISFAVPTVLCYMKYGQQYLNEAFIYHVYREDHRHNFSPYWLLMYLNMARRHLGQGVDFSPRLVAFAPQAVVLSFVSYKLRRNTAHACCVQTVLFVAFNKVCTVQYFVWFIPFLAFLFCEPKEVEDDESGGSGAFKFFSWVKALGVVLMWAATIPLWVTTAVPLEFHGYSDFAQLWIVSCLFFLAMVVLASMLARIAYRVQCTKCSAKSIKVA	This protein is part of the following components: membrane, endoplasmic reticulum, endoplasmic reticulum membrane, glycosylphosphatidylinositol-mannosyltransferase I complex, nuclear envelope, cytoplasm, and integral component of membrane. This protein is involved in the following processs: mannosylation, and GPI anchor biosynthetic process. This protein is located in the following components: integral component of membrane, endoplasmic reticulum, nuclear envelope, endoplasmic reticulum membrane, cytoplasm, and membrane. This protein is involved in metabolic process: mannosylation. This protein is part of membrane: membrane, and endoplasmic reticulum membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is part of cytoplasm: cytoplasm. This protein enables transferase activity: mannosyltransferase activity, hexosyltransferase activity, transferase activity, and glycosyltransferase activity. This protein is involved in lipid metabolic process: GPI anchor biosynthetic process. This protein enables the following functions: transferase activity, glycosyltransferase activity, alpha-1,4-mannosyltransferase activity, mannosyltransferase activity, and glycolipid mannosyltransferase activity.
MLNKAEQISEKSESAYVERFVNAGGVETRYLEAGKGQPVILIHGGGAGAESEGNWRNVIPILARHYRVIAMDMLGFGKTAKPDIEYTQDRRIRHLHDFIKAMNFDGKVSIVGNSMGGATGLGVSVLHSELVNALVLMGSAGLVVEIHEDLRPIINYDFTREGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYVATMQWIREQGGLFYDPEFIRKVPVPTLVVHGKDDKVVPVETAYKFLDLIDDSWGYIIPHCGHWAMIEHPEDFANATLSFLSRRADITRAAA	This protein is involved in the following processs: aromatic compound catabolic process, and carbazole catabolic process. This protein enables hydrolase activity: 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase activity, hydrolase activity, 2-hydroxy-6-oxo-6-(2'-aminophenyl)-hexa-2,4dienoate hydrolase activity, and hydrolase activity, acting on acid carbon-carbon bonds, in ketonic substances. This protein is involved in metabolic process: aromatic compound catabolic process, and carbazole catabolic process. This protein enables the following functions: 2-hydroxy-6-oxo-6-(2'-aminophenyl)-hexa-2,4dienoate hydrolase activity, 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase activity, hydrolase activity, acting on acid carbon-carbon bonds, in ketonic substances, and hydrolase activity.
MNGIHDTGGAHGYGPVYREPNEPVFRYDWEKTVMSLLPALLANANFNLDEFRHSIERMGPAHYLEGTYYEHWLHVFENLLVEKGVLTATEVATGKAASGKTATRVLTPAIVDDSSAPGLLRPGGGFSFFPVGDKVRVLNKNPVGHTRMPRYTRAKWGQWSSTMVCFVTPDTAAHGKGEQPQHVYTVSFTSVELWGQDASSPKDTIRVDLWDDYLEPA	This protein is involved in the following process: nitrogen compound metabolic process. This protein is involved in metabolic process: nitrogen compound metabolic process. This protein enables metal ion binding: transition metal ion binding. This protein enables catalytic activity: indole-3-acetonitrile nitrile hydratase activity, lyase activity, and nitrile hydratase activity. This protein enables the following functions: transition metal ion binding, nitrile hydratase activity, lyase activity, and indole-3-acetonitrile nitrile hydratase activity.
MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL	This protein is part of the following components: nucleus, RNA polymerase I complex, RNA polymerase III complex, cytoplasm, nucleoplasm, and RNA polymerase II, core complex. This protein is involved in the following processs: transcription, RNA-templated, termination of RNA polymerase III transcription, ribosome biogenesis, tRNA transcription by RNA polymerase III, transcription by RNA polymerase I, transcription by RNA polymerase III, transcription, DNA-templated, and transcription by RNA polymerase II. This protein contributes to the following functions: RNA polymerase III activity, RNA polymerase I activity, RNA polymerase II activity, RNA-directed 5'-3' RNA polymerase activity, and DNA-directed 5'-3' RNA polymerase activity. This protein is located in the following components: nucleoplasm, cytoplasm, and nucleus. This protein is involved in metabolic process: tRNA transcription by RNA polymerase III, transcription, DNA-templated, transcription by RNA polymerase I, transcription, RNA-templated, transcription by RNA polymerase III, termination of RNA polymerase III transcription, and transcription by RNA polymerase II. This protein is part of cytoplasm: cytoplasm. This protein enables DNA binding: DNA binding. This protein is part of nucleus: nucleus. This protein enables transferase activity: RNA polymerase II activity, RNA polymerase I activity, RNA polymerase III activity, RNA-directed 5'-3' RNA polymerase activity, and DNA-directed 5'-3' RNA polymerase activity. This protein enables the following functions: DNA-directed 5'-3' RNA polymerase activity, DNA binding, and RNA polymerase I activity.
MGRRVPALRQLLVLAVLLLKPSQLQSRELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDIMGYAFLRVLIWLINILAIFGNLTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDSQTKGQYYNHAIDWQTGSGCGAAGFFTVFASELSVYTLTVITLERWHTITYAVQLDQKLRLRHAIPIMLGGWLFSTLIATMPLVGISNYMKVSICLPMDVESTLSQVYILSILILNVVAFVVICACYIRIYFAVQNPELTAPNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPLITVTNSKILLVLFYPVNSCANPFLYAIFTKAFQRDFLLLLSRFGCCKRRAELYRRKEFSAYTSNCKNGFPGASKPSQATLKLSTVHCQQPIPPRALTH	This protein is part of the following components: cytoplasm, extracellular region, lysosome, nucleus, endosome, membrane, plasma membrane, integral component of plasma membrane, endoplasmic reticulum, extracellular space, intrinsic component of external side of plasma membrane, receptor complex, and integral component of membrane. This protein is involved in the following processs: adenylate cyclase-modulating G protein-coupled receptor signaling pathway, activation of adenylate cyclase activity, arachidonic acid secretion, luteinizing hormone signaling pathway, G protein-coupled receptor signaling pathway, central nervous system development, positive regulation of calcium-mediated signaling, cellular response to luteinizing hormone stimulus, ovarian follicle development, signal transduction, regulation of steroid hormone biosynthetic process, hormone-mediated signaling pathway, cognition, protein targeting to lysosome, response to drug, adenylate cyclase-activating G protein-coupled receptor signaling pathway, male gonad development, response to luteinizing hormone, positive regulation of calcium ion transport into cytosol, female gonad development, positive regulation of inositol trisphosphate biosynthetic process, positive regulation of release of sequestered calcium ion into cytosol, uterus development, phospholipase C-activating G protein-coupled receptor signaling pathway, spermatogenesis, seminiferous tubule development, development of secondary male sexual characteristics, ovulation cycle process, regulation of steroid biosynthetic process, cellular response to gonadotropin stimulus, and positive regulation of hormone biosynthetic process. This protein is active in the following component: integral component of plasma membrane. This protein is located in the following components: integral component of membrane, endoplasmic reticulum, nucleus, extracellular space, cytoplasm, integral component of plasma membrane, endosome, extracellular region, membrane, plasma membrane, intrinsic component of external side of plasma membrane, and lysosome. This protein is involved in signal transduction: G protein-coupled receptor signaling pathway, hormone-mediated signaling pathway, phospholipase C-activating G protein-coupled receptor signaling pathway, adenylate cyclase-modulating G protein-coupled receptor signaling pathway, luteinizing hormone signaling pathway, signal transduction, and adenylate cyclase-activating G protein-coupled receptor signaling pathway. This protein is part of membrane: plasma membrane, and membrane. This protein is part of integral component of membrane: integral component of membrane, and integral component of plasma membrane. This protein is part of extracellular region: extracellular region. This protein is part of cytoplasm: cytoplasm. This protein is part of nucleus: nucleus. This protein is involved in cation transport: arachidonic acid secretion. This protein is involved in protein transport: protein targeting to lysosome. This protein enables the following functions: G protein-coupled receptor activity, identical protein binding, choriogonadotropin hormone receptor activity, peptide hormone binding, protein-hormone receptor activity, ATPase binding, G protein-coupled peptide receptor activity, choriogonadotropin hormone binding, and luteinizing hormone receptor activity.
MNGGGRRRYSSEQLMFDVPANAGGGAGKWGQRGGVRRGDGEIFVSVEPTTPARLRGGEAAAAAAGESPGQRQQLSPGLLDLHAFDTELISDFQVPGIGMYDGAQKFGYGNGGFDDSDPTFAPNKQMSKSTVFAESNFLKAFPEKEKAAPVAKIKVVVRKRPLNKKEISKKEEDIIDIEQQSNSLTVHETKLKVDLTEYVEKHEFVFDAVLDEDVSNDEVYRETVEPVVPAIFNRTKATCFAYGQTGSGKTYTMRPLPLKASQDILRLMHHTYRNQGYQLFVSFFEIYGGKLFDLLNERSKLCMREDGKQKVCIVGLQEYRVSDVETIKELIEKGNATRSTGTTGANEESSRSHAILQLAIKKRVDGNDSKPPRLAGKLSFIDLAGSERGADTTDNDKQTRIEGAEINKSLLALKECIRALDNDQTHIPFRGSKLTEVLRDSFIGDSRTVMISCISPSSGSCEHTLNTLRYADRVKSLSKGSNTKKDLSLAAAPLRESSPSLLASAVPSFSSAEVMNDITERSNFGWTKQQYVKEHQAPTFVDRMQKVKEDTEFSLSNGGYFKEQRTKGSVPVGIAEVPDTVYQQGRQPTRKARDLTSDNNMRNSIAYPIIRRVVPDEDEHLNELLQEEEDLVSAHRKQVEETLDMIKEEMNLLVEADQPGNQLDDYITRLSGILSQKAAGIVDLQARLAQFQRRLNENNVLLYAQCP	This protein is part of the following components: kinesin complex, and microtubule. This protein is involved in the following process: microtubule-based movement. This protein is located in the following component: microtubule. This protein enables hydrolase activity: ATP hydrolysis activity. This protein enables nucleotide binding: nucleotide binding, and ATP binding. This protein enables the following functions: microtubule motor activity, microtubule binding, ATP binding, microtubule motor activity, and nucleotide binding.
MAGRSGDSDEDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILSTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE	This protein is part of the following components: host cell nucleolus, host cell cytoplasm, and host cell nucleus. This protein is involved in the following processs: regulation of transcription, DNA-templated, mRNA transport, and viral process. This protein is located in the following components: host cell nucleus, host cell cytoplasm, and host cell nucleolus. This protein enables RNA binding: RNA binding. This protein is involved in regulation of transcription, DNA-templated: regulation of transcription, DNA-templated. This protein enables the following functions: protein binding, RNA binding, and DNA-binding transcription factor activity.
MLFHGITGGHIQGIMEEMERRSKSADNRLAKTIQVNGRETRMPPLSPEKPTLCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEIVMRARESVYHLSCFTCTTCNKTLSTGDHFGMKENLVYRRAHFELLVQGDFHSQLNYTELSAKGGGLSALPYFTNGTGAVQKGRPRKRKSPALGVDIINYTSGCNENDTDLDRDQSYPPSQKTKRMRTSFKHHQLRTTKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGGDKVEGPSLSAPASTDSAALTPTGAASTLSDLTSPSLNVGASVTPNMDSHESGSPSQTTLTNLF	This protein is part of the following component: nucleus. This protein is involved in the following processs: regulation of transcription by RNA polymerase II, dorsal spinal cord interneuron anterior axon guidance, regulation of transcription, DNA-templated, and negative regulation of transcription, DNA-templated. This protein is located in the following component: nucleus. This protein enables metal ion binding: metal ion binding. This protein enables DNA binding: DNA binding, and sequence-specific DNA binding. This protein is part of nucleus: nucleus. This protein is involved in regulation of transcription, DNA-templated: negative regulation of transcription, DNA-templated, and regulation of transcription, DNA-templated. This protein enables the following functions: DNA binding, DNA-binding transcription factor activity, RNA polymerase II-specific, transcription corepressor activity, and metal ion binding.
MSRIGRLPIDVPAGVDVAVDGQHVTVKGPKGELSLTIAQPIRAEVQDGQVLVTRPDDERESRSLHGLTRSLIANNIVGVTTGYTKGLEIVGTGYRVAIKDKGVEFALGFSHPVYVEAPAGISFTVEGVNKMTVVGIDKQLVGETAANIRKIRKPEPYKGKGVRYAGENVRRKAGKSGK	This protein is part of the following component: ribosome. This protein is involved in the following process: translation. This protein is located in the following component: ribosome. This protein enables RNA binding: rRNA binding, and RNA binding. This protein is involved in translation: translation. This protein enables structural constituent of ribosome: structural constituent of ribosome. This protein is part of ribosome: ribosome. This protein enables the following functions: rRNA binding, RNA binding, and structural constituent of ribosome.
MSQTPPSFIRLLNNTSLVSQILIGMIVGILLATLIPSAAQSAGLLGTLFVGALKAVAPVLVLLLVTDSIAGHKQGQKTSIRPLLILYLFGTFCAAVVAVVASFAFPSVLHLSAQNADIVPPGGIAEVLNTLLFNVVANPVKALLEGNYIGILAWAIALGLSLRKASDTTKAVIHDLSHAVSGIVKGVIRCAPLGIMGLVASTFAETGFSALLSYAQLLIVLIGCMLFVAFVVNPLIVFWKIKRNPYPLVLMCLKESGVTAFFTRSSAANIPVNMALCEKLRLPEETYAVSIPLGATINMAGAAITITVLSMAAVNTLGISVDLATAVLLSVVATISACGASGVAGGSLLLIPLACSLFGISNDVAMQVVAVGFIIGVLQDSAETALNSSTDVLFTAAACMAEDGSLSEGNLQEDADIV	This protein is part of the following components: integral component of membrane, plasma membrane, and membrane. This protein is involved in the following processs: serine transport, amino acid transport, amino acid transmembrane transport, threonine transport, carboxylic acid transmembrane transport, and transmembrane transport. This protein is located in the following components: integral component of membrane, membrane, and plasma membrane. This protein is part of membrane: membrane, and plasma membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is involved in transmembrane transport: amino acid transmembrane transport, and transmembrane transport. This protein is involved in cation transport: threonine transport, and serine transport. This protein enables the following functions: symporter activity, and amino acid transmembrane transporter activity.
MRHPFKVVVVTGVPGVGKTTVIKELQGLAEKEGVKLHIVNFGSFMLDTAVKLGLVEDRDKIRTLPLRRQLELQREAAKRIVAEASKALGGDGVLIIDTHALVKTVAGYWPGLPKHVLDELKPDMIAVVEASPEEVAARQARDTTRYRVDIGGVEGVKRLMENARAASIASAIQYASTVAIVENREGEAAKAAEELLRLIKNL	This protein is part of the following component: cytoplasm. This protein is involved in the following processs: nucleoside monophosphate phosphorylation, and phosphorylation. This protein is located in the following component: cytoplasm. This protein is involved in metabolic process: nucleoside monophosphate phosphorylation. This protein enables nucleotide binding: nucleotide binding, and ATP binding. This protein is part of cytoplasm: cytoplasm. This protein enables transferase activity: adenylate kinase activity, kinase activity, and transferase activity. This protein is involved in phosphorylation: phosphorylation. This protein enables the following functions: ATP binding, kinase activity, transferase activity, adenylate kinase activity, and nucleotide binding.
PEEICTLVIAESFPEDAGIFTCSARNDYGSVTSTAQLVVTSANTENCSYDSMGEPNSDHFQHFPPPPPILETGSYELASQKPSEIQQVNTPNLGFNMAALQMQFNSAERETNGVHPSHGVNGLINGKAYGNKSPPTPAALLSPTKEPPPLLAKPKLGFPKKASRTARIASDEEIQGTKDAVIQDLERKLRFKEDLLNNGQPRLTYEERMARRLLGADSANVFNIQEPEETAANQEYKVSSCEQRLISEIEYRLERSPVEESGDEVQEAEVPVENAAAPFFEMKLKHYKIFEGMPVTFTCRVAGSPKPKIYWFKDGKQISPKSDHYTIQRDVDGTCSLHTTASTLDDDGNYTIMAANTQGRVSCTGRLMVQAVNQRGRSPRSPPGHPHARRPRSRSRDSGDENEPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPIRPDSAHKMLVRENGVHSLIIEPVTSRDAGIYTCIATNRAGQNSFNLELVVAAKEAHKAPVFIEKLQNTGVADGYPVRLECRVSGVPPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARLDVY	This protein is part of the following components: axonal growth cone, excitatory synapse, cell projection, filopodium, ruffle, actin filament, cell junction, nucleus, stress fiber, Z disc, growth cone, neuronal cell body, axon, lamellipodium, focal adhesion, plasma membrane, cytoskeleton, podosome, and cytoplasm. This protein is involved in the following processs: positive regulation of podosome assembly, keratinocyte development, trophoblast giant cell differentiation, axon guidance, cell adhesion, cellular response to hypoxia, cell migration, neuron projection development, epithelial cell morphogenesis, ruffle organization, wound healing, dendrite self-avoidance, homophilic cell adhesion via plasma membrane adhesion molecules, and actin cytoskeleton organization. This protein is active in the following components: axon, and plasma membrane. This protein is located in the following components: cell projection, axonal growth cone, cytoplasm, stress fiber, filopodium, actin filament, cytoskeleton, nucleus, Z disc, axon, cell junction, lamellipodium, focal adhesion, ruffle, excitatory synapse, podosome, growth cone, and neuronal cell body. This protein is part of membrane: plasma membrane. This protein is part of cytoplasm: cytoplasm. This protein is part of nucleus: nucleus. This protein enables the following functions: actin binding, cell-cell adhesion mediator activity, and cytoskeletal protein binding.
MGEEFKPAIQEKRWDIGEEEKLLSLWDAEDLHKSTLDPDDPREIVVIDTPPPYPSGKWHVGGAAHYTQIDMIARYFRLKGYNVVAPFYADRNGLPVEVQVEKTYGVVAHEMARTTEGRERFLALCSEFLDKVESEIVQLWRRLGCGFDYWREGTDSPRYRSMTQATFIDLWRRGLIYEAERPVRWCPRCKTTLAEAEIEHKEDEDFIYYVKYRLEEDGRDLVVATTRPELLAGCAALAYHPEDERYKGLAGKTAIAPLYGHRVKIVEHPAVKKDFGTGLMMICSYGDEEDVRLFLELDLKPKVLIDENGVMNENAGPIAGLPVKEARRRIAEILEREGLLVKKERIVHSVPVCWRCKTPLQIIHRRELFLRQLDFKDAVKQAAAKMDFKPEMHRKKLYDWIDSIKMDWPISRERFYGTEIPLWTCEKCGAKLVPEPGRYYRPWAEEPPWDSCPRCGAPRRYLKGETRVFDTWFDSSISPLYVTRWMWDKRFYERASRNVLRPQGQDIIRTWLYYSILRVLQLTGKPAFRWVRITGLGLDPKGRPMHKSLGNVIDPEPIIAKYGGDAFRFWAAIAAKLGYDYRFDENKVKTGRNFATKLWNLARFVSSFPRPEGSPLEKATEVDKAFLALADEYLEAADKAYGELDVYEPANLIYELAWDIFASHYVELVKERSYNRSGLFTREEQEAAWATLHELLRRILVALSPIMPFVTDAIHRRLYGSSVHRQRWPDPLFTPEERRELAGKARLIVSVNKAVWNLKRSMGKKLYEPLDTVEVLVPSGIESARRDLEALHKAAIRTYTGAPPEGSEEAIPGSSVYYIAKKS	This protein is part of the following component: cytoplasm. This protein is involved in the following processs: valyl-tRNA aminoacylation, aminoacyl-tRNA metabolism involved in translational fidelity, translation, and tRNA aminoacylation for protein translation. This protein is located in the following component: cytoplasm. This protein enables hydrolase activity: aminoacyl-tRNA editing activity. This protein is involved in metabolic process: aminoacyl-tRNA metabolism involved in translational fidelity, tRNA aminoacylation for protein translation, and valyl-tRNA aminoacylation. This protein enables catalytic activity: valine-tRNA ligase activity, ligase activity, and aminoacyl-tRNA ligase activity. This protein enables nucleotide binding: ATP binding, and nucleotide binding. This protein is part of cytoplasm: cytoplasm. This protein is involved in translation: translation. This protein enables the following functions: ATP binding, nucleotide binding, aminoacyl-tRNA ligase activity, valine-tRNA ligase activity, ligase activity, and aminoacyl-tRNA editing activity.
MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGRMQRERRGKNVVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQVELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS	This protein is part of the following components: perinuclear region of cytoplasm, intracellular membrane-bounded organelle, cytoplasm, endoplasmic reticulum, mitochondrion, nucleus, and membrane. This protein is involved in the following processs: protein localization to mitochondrion, regulation of protein transport, response to heat, protein folding, negative regulation of apoptotic process, positive regulation of apoptotic process, positive regulation of ATPase activity, and negative regulation of JUN kinase activity. This protein is located in the following components: nucleus, membrane, cytoplasm, mitochondrion, perinuclear region of cytoplasm, intracellular membrane-bounded organelle, and endoplasmic reticulum. This protein enables metal ion binding: metal ion binding. This protein enables nucleotide binding: ATP binding. This protein is part of membrane: membrane. This protein is part of mitochondrion: mitochondrion. This protein is part of cytoplasm: cytoplasm. This protein is part of nucleus: nucleus. This protein enables the following functions: metal ion binding, unfolded protein binding, heat shock protein binding, ATP binding, ATPase activator activity, Hsp70 protein binding, and chaperone binding.
METKKYGLGTTAIHAGTLKNLYGTLAMPIYQTSTFIFDSAEQGGRRFALEEAGYIYTRLGNPTTTVLENKIAALEEGEAAVATSSGMGAISSTLWTVLKAGDHVVTDKTLYGCTFALMCHGLTRFGIEVTFVDTSNLDEVKNAMKKNTRVVYLETPANPNLKIVDLEALSKLAHTNPNTLVIVDNTFATPYMQKPLKLGADIVVHSVTKYINGHGDVIAGLVITNKELADQIRFIGLKDMTGAVLGPQDAYYIIRGMKTFEIRMERHCKNAKKVVEFLNKHPKIERVYYPGLETHPGHEIAKKQMKDFGAMISFELKGGFEAGKTLLNNLKLCSLAVSLGDTETLIQHPASMTHSPYTKEEREAAGITDGLVRLSVGLENVEDIIADLEQGLEKI	This protein is involved in the following processs: transsulfuration, and response to antibiotic. This protein is involved in metabolic process: transsulfuration. This protein enables catalytic activity: methionine gamma-lyase activity, homocysteine desulfhydrase activity, catalytic activity, and lyase activity. This protein enables the following functions: methionine gamma-lyase activity, pyridoxal phosphate binding, catalytic activity, lyase activity, and homocysteine desulfhydrase activity.
MADSSESFNIATSPRAGSRRDALTSSPGRDLPPFEDESEGMFGDGVVPEEEEDGEELIGDAMERDYRPISELDRYEVEGLDDEEDVEDLTASQREAAEQSMRMRDREMGRELGRMRRGLLYDSDEEEEDRPARKRRMAERAAEGAPEEDEEMIESIENLEDMKGHTVREWVSMAATRLEIYHRFKNFLRTHVDEHGHNVFKEKISDMCKENKESLPVNYEDLAAREHVLAYFLPEAPAEMLKIFDEAAKEVVLVMYPKYDRIAREIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTCCTGVLPQLSMVKYNCNKCNFILGPFFQSQNQEVRPGSCPECQSFGPFEINMEETVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATVILANHITKKDDKVAVGELTDEDVKAIVALSKDERIGERIFASIAPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAASNPIGGRYDPSLTFSENVDLTEPIVSRFDILCVVRDTVDPVQDEMLARFVVSSHIKHHPSSKDIANGDAAEFALPNTFGVEALPQEVLKKYIMYAKEKIRPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVVEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLAFRRDNNELLLFVLKQLIAEQVTYQRNRYGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSDLFKMNKFTHDVKKKLIIQQF	This protein is part of the following components: CMG complex, MCM complex, chromatin, and nucleus. This protein is involved in the following processs: cell cycle, DNA unwinding involved in DNA replication, regulation of DNA-dependent DNA replication initiation, DNA replication, DNA replication initiation, DNA duplex unwinding, and negative regulation of DNA helicase activity. This protein contributes to the following functions: ATP hydrolysis activity, and chromatin binding. This protein is located in the following components: chromatin, nucleus, and chromosome. This protein enables hydrolase activity: ATP hydrolysis activity, and hydrolase activity. This protein is involved in metabolic process: DNA replication, and DNA replication initiation. This protein enables metal ion binding: metal ion binding. This protein enables catalytic activity: DNA helicase activity, and helicase activity. This protein enables nucleotide binding: ATP binding, and nucleotide binding. This protein enables DNA binding: DNA binding. This protein is part of nucleus: nucleus. This protein is involved in cell cycle: cell cycle. This protein enables the following functions: ATP binding, helicase activity, nucleotide binding, DNA binding, DNA helicase activity, hydrolase activity, metal ion binding, and protein binding.
MTKTKGKVVGINGNMISVSFEGLVTLNEVGYVEVGSKKLKSEVIRIRGEVAQLQVFEITKGIKVGDIVEFTGDLLSVELGPGLLGQVYDGLQNPLPELAEQAGYFLERGIYLNALSRTAKWHFTPSAKEGDTLKRADLLGTVPEGSFTHRIMIPFNMYGTYKLKSIKPEGDYTVDDTIAEVTDERGNVIPLTMSFKWPVKRAIDCYAERLKPTETLVTKMRTMDTFFPVAKGGTYCIPGPFGAGKTVLQHATSRNADVDIVIIAACGERAGEVVETLTEFPELKDPKTGRTLMERTIIICNTSSMPVAAREASVYTGVTLAEYYRQMGLDVLLLADSTSRWAQALREMSGRLEEIPGEEAFPAYLESYIAAFYERAGIVRLSDGSKGSVTIGGTVSPAGGNFEEPVTQATLKVVGAFHGLSRERSDARKYPAIHPLDSWSKYPSVLPLEQVKYGRSFLRRGTEVEQMMKVVGEEGTSIEDFIIYLKGDLLDAVYLQQNSFDKVDDAVSVERQQHIYNILIEILGTSFKFVSKDEARSYFSKLKLMFIDYNYSPWGSDAFKSHEDGIKKHIAEKADSLDERAKKLLKQAV	This protein is involved in the following processs: plasma membrane ATP synthesis coupled proton transport, ATP metabolic process, ion transport, proton transmembrane transport, and ATP biosynthetic process. This protein is involved in metabolic process: ATP biosynthetic process, and ATP metabolic process. This protein enables catalytic activity: proton-transporting ATP synthase activity, rotational mechanism. This protein enables nucleotide binding: nucleotide binding, and ATP binding. This protein is involved in cation transport: plasma membrane ATP synthesis coupled proton transport, ion transport, and proton transmembrane transport. This protein enables the following functions: proton-transporting ATPase activity, rotational mechanism, nucleotide binding, proton-transporting ATP synthase activity, rotational mechanism, and ATP binding.
MLSSRLQFAQQTARKFSISAKDGSGKLSTLAVKVHGGSRYADKEGIAHLLSRFNFHNTGNKSALRLVRESELLGGKFESSVDREYITLKATFLKEDLPYFVNALGNVLYKTSFRPHELPESVLPAAKYDISVSETNPINKAEDLLYNVSFRKDLGNTVLYRGVEKVTLDDIKAYANKVYTKENIEIVGQGVNEADLKRFVNDSLIGSLPTGSKLAAQAQPKFFSGEARLSAPGASVAAIAVPVTKEQFATYEVLAKYLTSALSELSPLIDSAKLDKYANAGLFSLYVKGEDASVVAENIKKVVDTLKKDVDISAAKEYTALQLSLENAPIDVSNVKNVKLDKFSYAAVGNVAKLPFADEL	This protein is part of the following components: membrane, mitochondrion, respirasome, mitochondrial crista, mitochondrial inner membrane, and mitochondrial respiratory chain complex III. This protein is involved in the following processs: mitochondrial electron transport, ubiquinol to cytochrome c, and aerobic respiration. This protein is located in the following components: mitochondrion, respirasome, mitochondrial crista, membrane, and mitochondrial inner membrane. This protein is involved in metabolic process: aerobic respiration, and mitochondrial electron transport, ubiquinol to cytochrome c. This protein enables metal ion binding: metal ion binding. This protein enables catalytic activity: catalytic activity, and ubiquinol-cytochrome-c reductase activity. This protein is part of membrane: membrane, and mitochondrial inner membrane. This protein is part of mitochondrion: mitochondrion. This protein enables the following functions: metal ion binding, ubiquinol-cytochrome-c reductase activity, and catalytic activity.
MTSVNLSRAPAAITRRRLQLQPEFHAECSWLKSSSKHAPLTLSCQIRPKQLSQIAELRVTSLDASQASEKDISLVQTPHKVEVNEKIEESIEYVQNLLMTSGDGRISVSPYDTAVIALIKDLKGRDAPQFPSCLEWIAHHQLADGSWGDEFFCIYDRILNTLACVVALKSWNLHSDIIEKGVTYIKENVHKLKGANVEHRTAGFELVVPTFMQMATDLGIQDLPYDHPLIKEIADTKQQRLKEIPKDLVYQMPTNLLYSLEGLGDLEWERLLKLQSGNGSFLTSPSSTAAVLMHTKDEKCLKYIENALKNCDGGAPHTYPVDIFSRLWAIDRLQRLGISRFFQHEIKYFLDHIESVWEETGVFSGRYTKFSDIDDTSMGVRLLKMHGYDVDPNVLKHFKQQDGKFSCYIGQSVESASPMYNLYRAAQLRFPGEEVLEEATKFAFNFLQEMLVKDRLQERWVISDHLFDEIKLGLKMPWYATLPRVEAAYYLDHYAGSGDVWIGKSFYRMPEISNDTYKELAILDFNRCQTQHQLEWIHMQEWYDRCSLSEFGISKRELLRSYFLAAATIFEPERTQERLLWAKTRILSKMITSFVNISGTTLSLDYNFNGLDEIISSANEDQGLAGTLLATFHQLLDGFDIYTLHQLKHVWSQWFMKVQQGEGSGGEDAVLLANTLNICAGLNEDVLSNNEYTALSTLTNKICNRLAQIQDNKILQVVDGSIKDKELEQDMQALVKLVLQENGGAVDRNIRHTFLSVSKTFYYDAYHDDETTDLHIFKVLFRPVV	This protein is part of the following components: plastid, and chloroplast. This protein is involved in the following processs: diterpenoid biosynthetic process, and terpenoid biosynthetic process. This protein is located in the following components: chloroplast, and plastid. This protein enables metal ion binding: magnesium ion binding, and metal ion binding. This protein enables catalytic activity: lyase activity, terpene synthase activity, and copal-8-ol diphosphate synthase activity. This protein is involved in lipid metabolic process: diterpenoid biosynthetic process, and terpenoid biosynthetic process. This protein is part of plastid: chloroplast, and plastid. This protein enables the following functions: terpene synthase activity, copal-8-ol diphosphate synthase activity, magnesium ion binding, lyase activity, and metal ion binding.
MACMHQAQLYNDLEELLTGPSVPIVAGAAGAAALTAYINAKYHIAHDLKTLGGGLTQSSEAIDFINRRVAQKRVLTHHIFQEQVQKQSNHPFLIFEGKTWSYKEFSEAYTRVANWLIDELDVQVGEMVAIDGGNSAEHLMLWLALDAIGAATSFLNWNLTGAGLIHCIKLCECRFVIADIDIKANIEPCRGELEETGINIHYYDPSFISSLPNNTPIPDSRTENIELDSVRGLIYTSGTTGLPKGVFISTGRELRTDWSISKYLNLKPTDRMYTCMPLYHAAAHSLCTASVIHGGGTVVLSRKFSHKKFWPEVVASEANIIQYVGELGRYLLNGPKSPYDRAHKVQMAWGNGMRPDVWEAFRERFNIPIIHELYAATDGLGSMTNRNAGPFTANCIALRGLIWHWKFRNQEVLVKMDLDTDEIMRDRNGFAIRCAVNEPGQMLFRLTPETLAGAPSYYNNETATQSRRITDVFQKGDLWFKSGDMLRQDAEGRVYFVDRLGDTFRWKSENVSTNEVADVMGTFPQIAETNVYGVLVPGNDGRVRSLNCHGRRRDRVDIRFAALAKHARDRLPGYAVPLFLRVTPALEYTGTLKIQKGRLKQEGIDPDKISGEDKLYWLPPGSDIYLPFGKMEWQGIVDKRIRL	This protein is part of the following components: integral component of membrane, and membrane. This protein is involved in the following processs: fatty acid biosynthetic process, lipid transport, long-chain fatty acid metabolic process, and long-chain fatty acid transport. This protein is located in the following components: peroxisome, lipid droplet, peroxisomal membrane, plasma membrane, integral component of membrane, and membrane. This protein enables catalytic activity: long-chain fatty acid-CoA ligase activity, and catalytic activity. This protein is part of membrane: membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is involved in lipid metabolic process: fatty acid biosynthetic process, and long-chain fatty acid metabolic process. This protein enables the following functions: ATP binding, ligase activity, nucleotide binding, catalytic activity, long-chain fatty acid transporter activity, and long-chain fatty acid-CoA ligase activity.
MLPGLRRLLQGPASACLLLTLLALPSVTPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRSLRPGTFGPNLLTLWLFSNNLSTIHPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFHGLSRLTILYLFNNSLASLPGEALADLPALEFLRLNANPWACDCRARPLWAWFQRARVSSSDVTCATPPERQGRDLRALRDSDFQACPPPTPTRPGSRARGNSSSNHLYGVAEAGAPPADPSTLYRDLPAEDSRGRQGGDAPTEDDYWGGYGGEDQRGEQTCPGAACQAPADSRGPALSAGLRTPLLCLLPLALHHL	This protein is part of the following components: perikaryon, membrane, plasma membrane, anchored component of plasma membrane, anchored component of membrane, membrane raft, external side of plasma membrane, extracellular matrix, cell surface, axon, neuron projection, dendrite, cell projection, and extracellular space. This protein is involved in the following processs: corpus callosum development, axon regeneration, cell surface receptor signaling pathway, and negative regulation of neuron projection development. This protein acts upstream of or within the following processs: cell surface receptor signaling pathway, and negative regulation of neuron projection development. This protein is active in the following components: extracellular matrix, extracellular space, and cell surface. This protein is located in the following components: perikaryon, cell surface, neuron projection, dendrite, plasma membrane, membrane raft, anchored component of membrane, external side of plasma membrane, cell projection, membrane, axon, and anchored component of plasma membrane. This protein is involved in signal transduction: cell surface receptor signaling pathway. This protein is part of membrane: plasma membrane, membrane, and membrane raft. This protein enables the following function: signaling receptor activity.
MRLAVVCFCLFGLASCLPVKVAEFGSSEEKAHYSKHSDAVATWLKPDPSQKQNLLAPQNSVSSEETDDFKQETLPSNSNESHDHMDDDDDDDDDGDHAESEDSVNSDESDESHHSDESDESFTASTQADVLTPIAPTVDVPDGRGDSLAYGLRSKSRSFPVSDEQYPDATDEDLTSRMKSQESDEAIKVIPVAQRLSVPSDQDSNGKTSHESSQLDEPSVETHSLEQSKEYKQRASHESTEQSDAIDSAEKPDAIDSAERSDAIDSQASSKASLEHQSHEFHSHEDKLVLDPKSKEDDRYLKFRISHELESSSSEVN	This protein is part of the following components: apical part of cell, cell projection, Golgi apparatus, cytoplasm, extracellular region, extracellular space, perinuclear region of cytoplasm, and vesicle. This protein is involved in the following processs: cellular chloride ion homeostasis, cellular response to testosterone stimulus, response to steroid hormone, cellular phosphate ion homeostasis, negative regulation of collateral sprouting of intact axon in response to injury, cell adhesion, cellular response to fluid shear stress, androgen catabolic process, osteoblast differentiation, positive regulation of estradiol secretion, cellular response to leukemia inhibitory factor, positive regulation of bone resorption, collecting duct development, neutrophil chemotaxis, positive regulation of cell-substrate adhesion, biomineral tissue development, response to vitamin D, ossification, inflammatory response, positive regulation of transcription, DNA-templated, signal transduction, response to organic substance, urate biosynthetic process, cell differentiation, cellular calcium ion homeostasis, and cellular sodium ion homeostasis. This protein is active in the following component: extracellular space. This protein is located in the following components: cytoplasm, extracellular region, apical part of cell, extracellular space, perinuclear region of cytoplasm, cell projection, Golgi apparatus, and vesicle. This protein is involved in signal transduction: signal transduction. This protein is involved in metabolic process: urate biosynthetic process. This protein is part of extracellular region: extracellular region. This protein is part of cytoplasm: cytoplasm. This protein is involved in lipid metabolic process: androgen catabolic process. This protein is involved in regulation of transcription, DNA-templated: positive regulation of transcription, DNA-templated. This protein enables the following functions: cytokine activity, integrin binding, and extracellular matrix binding.
MGGGNSKEESSSPSSSSWASHQSYPQYGPDSYNYPPPPTYAPAPSPAPAPAPVPAPSPASSYGPQYSQEGYASQPNNPPPPTYAPAPSPASSYGHQYSQEGYASAASQPNYPPPPSQSQVADRKKFDRRYSKISDNYSSLLQVSEALGRAGLESSNLIVGIDFTKSNEWTGAKSFNRKSLHHLSNTPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRFCNGFEEVLARYREIVPQLKLAGPTSFAPIIEMAMTVVEQSSGQYHVLVIIADGQVTRSVDTEHGRLSPQEQKTVDAIVKASTLPLSIVLVGVGDGPWDMMQEFDDNIPARAFDNFQFVNFTEIMSKNKDQSRKETEFALSALMEIPPQYKATIELNLLGVRNGNIPQRIPLPPPVQSGSSFSSSRIPNFEPSVPPYPFESKQMSSADDIQLCPICLSNPKNMAFGCGHQTCCECGPDLKVCPICRAPIQTRIKLY	This protein is part of the following components: nucleus, membrane, and plasma membrane. This protein is involved in the following processs: abscisic acid-activated signaling pathway, positive regulation of abscisic acid-activated signaling pathway, negative regulation of response to water deprivation, and protein K63-linked ubiquitination. This protein is located in the following components: plasma membrane, membrane, and nucleus. This protein is involved in signal transduction: abscisic acid-activated signaling pathway. This protein is involved in metabolic process: protein K63-linked ubiquitination. This protein enables metal ion binding: metal ion binding. This protein is part of membrane: plasma membrane, and membrane. This protein is part of nucleus: nucleus. This protein enables transferase activity: transferase activity, ubiquitin-protein transferase activity, and ubiquitin protein ligase activity. This protein enables the following functions: metal ion binding, ubiquitin-protein transferase activity, transferase activity, protein binding, and ubiquitin protein ligase activity.
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPPPLPPDIPSFDIIADSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDVLHSESSDRGGPSSKHNTIKKLTLQSAKSRVAFFEEL	This protein is part of the following components: adherens junction, plasma membrane, cell body, lamellipodium, cytoplasm, cortical actin cytoskeleton, cell projection, ruffle, membrane, filopodium, cytosol, nucleolus, neuron projection, protein-containing complex, apical part of cell, synapse, nucleus, early endosome, cytoskeleton, perinuclear region of cytoplasm, membrane raft, and cleavage furrow. This protein is involved in the following processs: actin cytoskeleton organization, negative regulation of cell population proliferation, regulation of cell cycle, Schwann cell proliferation, negative regulation of cell-cell adhesion, negative regulation of tyrosine phosphorylation of STAT protein, negative regulation of receptor signaling pathway via JAK-STAT, positive regulation of stress fiber assembly, lens fiber cell differentiation, regulation of apoptotic process, and regulation of hippo signaling. This protein acts upstream of or within the following processs: regulation of apoptotic process, negative regulation of receptor signaling pathway via JAK-STAT, regulation of neural precursor cell proliferation, actin cytoskeleton organization, brain development, negative regulation of tyrosine phosphorylation of STAT protein, positive regulation of stress fiber assembly, negative regulation of cell population proliferation, regulation of gliogenesis, regulation of cell cycle, mesoderm formation, positive regulation of cell differentiation, regulation of neurogenesis, negative regulation of protein kinase activity, regulation of cell population proliferation, regulation of protein localization to nucleus, negative regulation of cell-cell adhesion, regulation of protein stability, Schwann cell proliferation, regulation of hippo signaling, odontogenesis of dentin-containing tooth, hippocampus development, regulation of stem cell proliferation, ectoderm development, cell-cell junction organization, negative regulation of cell growth, and negative regulation of MAPK cascade. This protein is located in the following components: cleavage furrow, cortical actin cytoskeleton, apical part of cell, cell projection, plasma membrane, filopodium, cytoplasm, ruffle, early endosome, nucleolus, lamellipodium, protein-containing complex, perinuclear region of cytoplasm, cell body, neuron projection, nucleus, cytoskeleton, membrane raft, membrane, adherens junction, synapse, and cytosol. This protein is part of membrane: membrane raft, membrane, plasma membrane, and cleavage furrow. This protein is part of cytoplasm: cytoplasm. This protein is part of nucleus: nucleus. This protein is part of cytosol: cytosol. This protein enables the following functions: protein binding, integrin binding, actin binding, cytoskeletal protein binding, beta-catenin binding, and protein domain specific binding.
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF	This protein is part of the following components: intracellular membrane-bounded organelle, autophagosome membrane, synapse, cytoplasm, cytosol, cytoplasmic vesicle, membrane, organelle membrane, autolysosome, autophagosome, cytoskeleton, endomembrane system, late endosome, and microtubule. This protein is involved in the following processs: response to iron(II) ion, cellular response to copper ion, cellular response to starvation, macroautophagy, response to nutrient levels, autophagy of mitochondrion, response to morphine, cellular response to nitrogen starvation, cellular response to hydrogen peroxide, autophagosome assembly, autophagosome maturation, response to lead ion, autophagy, and cellular response to amino acid starvation. This protein is active in the following components: cytosol, autophagosome, and autophagosome membrane. This protein is located in the following components: autophagosome membrane, cytoplasmic vesicle, synapse, intracellular membrane-bounded organelle, late endosome, cytosol, membrane, organelle membrane, cytoskeleton, autophagosome, microtubule, endomembrane system, and cytoplasm. This protein is involved in metabolic process: autophagy, autophagy of mitochondrion, and macroautophagy. This protein is part of membrane: membrane, autophagosome membrane, and organelle membrane. This protein is part of cytoplasm: cytoplasm. This protein is part of cytosol: cytosol. This protein enables the following functions: phospholipid binding, microtubule binding, phosphatidylethanolamine binding, ubiquitin protein ligase binding, and protein binding.
MTESHIDFRRAKFLISAPDIAHLDQYLPGDVGVEIAFAGRSNAGKSSALNALTEQKNLARTSKTPGRTQLINVFELDAQRRLVDLPGYGFAQVPLAMKLKWQQSLGEYLQKRACLSGVVVLMDIRHPLKDLDMQMIEWAVASEIPVLALLTKSDKLAQSAKMKTVNEVRKALVEFGDWVQVEPFSALKGTGKPKVLSILNEWCHPQWLADELENQEDAE	This protein is involved in the following processs: cell cycle, cell division, division septum assembly, and cell septum assembly. This protein enables metal ion binding: metal ion binding. This protein enables nucleotide binding: nucleotide binding, and GTP binding. This protein is involved in cell cycle: cell cycle. This protein is involved in cell division: cell division. This protein enables the following functions: nucleotide binding, GTP binding, and metal ion binding.
MTKFKLKIASRRSKLAMVQTLWVKEQLEKNIPDLEVSIEAMATQGDKILDVALAKIGDKGLFTKELEAQMLVGHADIAVHSLKDLPTNLPDGLTLGCITKREDPSDALVVNKKNKIYQLESLPPGSIVGTSSLRRLAQLRYKFPHLDFKDIRGNVITRIEKLDSGEFDCIILAAAGLKRLGFESRVHQIIPNEISLHAVGQGALGIECKSDDKEVLKIISVLEDKVSSQRCLAERSFLRELEGGCQVPIGVNSSIQNDEIALIGMVASIDGKRLIKNESIGNIKYPEEVGKKLAEKLKLQGADKILSEIFEQFRDK	This protein is involved in the following processs: tetrapyrrole biosynthetic process, protoporphyrinogen IX biosynthetic process, peptidyl-pyrromethane cofactor linkage, chlorophyll biosynthetic process, and porphyrin-containing compound biosynthetic process. This protein is involved in metabolic process: tetrapyrrole biosynthetic process, chlorophyll biosynthetic process, peptidyl-pyrromethane cofactor linkage, protoporphyrinogen IX biosynthetic process, and porphyrin-containing compound biosynthetic process. This protein enables transferase activity: transferase activity, and hydroxymethylbilane synthase activity. This protein enables the following functions: hydroxymethylbilane synthase activity, and transferase activity.
MIETDRIISANTAQTNDENVIDRAIRPKTLAEYEGQPAVREQMEIFIQAAKARKDALDHTLIFGPPGLGKTTLSNIIANEMGVELKQTSGPVLEKAGDLAALLTNLEENDVLFIDEIHRLSPVVEEILYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLVGATTRAGLLTSPLRDRFGIIQRLEFYSIDDLSKIVYRSAKLLNLDITTDGAMEIAKRSRGTPRIANRLLRRVRDYAQVKGSGVICFEIADKALSMLKVDPVGFDHMDHRYLLTLMEKFAGGPVGLDTMSAALSEEKGTIEDVIEPYLIQQGYIMRTARGRIATLLAYNHFKLKIPDNLSADQQQTLSI	This protein is involved in the following processs: DNA duplex unwinding, SOS response, DNA recombination, DNA repair, and cellular response to DNA damage stimulus. This protein enables hydrolase activity: hydrolase activity. This protein is involved in metabolic process: DNA recombination. This protein enables catalytic activity: helicase activity, four-way junction helicase activity, and DNA helicase activity. This protein enables nucleotide binding: nucleotide binding, and ATP binding. This protein is involved in cellular response to DNA damage stimulus: SOS response, cellular response to DNA damage stimulus, and DNA repair. This protein enables DNA binding: DNA binding. This protein enables the following functions: ATP binding, helicase activity, nucleotide binding, hydrolase activity, DNA binding, DNA helicase activity, and four-way junction helicase activity.
MTELRDETPLFHKGEIVLCYEPDKSKARVLYTSKVLNVFERRNEHGLRFYEYKIHFQGWRPSYDRCVRATVLLKDTEENRQLQRELAEAAKLQIRGDYSYKGTPDKPSAKKKRGGKAAHVEEPIVVPMDTGHLEAEHEMAPTPRAAGNRTRDNSGGKRKEKPPSGDGRLKGNRGRQTETFYNNAINDVSVYNHVPQEDRIMMRVSERLRELIEYDRNMIKVLGKQHALPARVPIVTIMENFVKQQAVELAISIKQDSSRARNTQSRNARMEREYDRVMSTVCMLKEVVDGLRIYFEFHVDDHLLYTEEKEYVHNYLTDDNMRNCSLILNKSYEYINPSGDTELIGLDGTPVVEGSGDTNGQIGVINIGGPEYEKQLQKCLLYIVTASGKNTAQAYERTSPYTAAYKLPVEMRGFLNETFKWRLLSAESPPEKSMVFGAPHLVRLMIKMPMFLNASPISNKKLEDLLPHLDAFINYLENHREWFDRENFVNSTALPQEDLQRELLDSLDGIAA	This protein is part of the following components: X chromosome, polytene chromosome, X chromosome located dosage compensation complex, transcription activating, nuclear chromosome, MSL complex, histone acetyltransferase complex, nucleus, chromosome, NuA4 histone acetyltransferase complex, and chromocenter. This protein is involved in the following processs: dosage compensation by hyperactivation of X chromosome, regulation of hemocyte proliferation, chromatin silencing, negative regulation of chromatin silencing, histone deacetylation, dosage compensation, histone H2A acetylation, histone H4 acetylation, histone acetylation, chromatin organization, regulation of transcription, DNA-templated, and histone H4-K16 acetylation. This protein is located in the following components: X chromosome, nucleus, chromosome, chromocenter, polytene chromosome, and nuclear chromosome. This protein is involved in metabolic process: histone acetylation, histone deacetylation, histone H4 acetylation, histone H4-K16 acetylation, and histone H2A acetylation. This protein enables RNA binding: RNA binding, and mRNA binding. This protein is part of nucleus: nucleus. This protein is involved in regulation of transcription, DNA-templated: regulation of transcription, DNA-templated. This protein enables the following functions: methylated histone binding, chromatin binding, mRNA binding, and RNA binding.
MNGYSVFCVSDHTGLTIEAVAKSVLAQFPRIEFSLITLPFIDDAAKARAAAGRVAVTARALVFSSLTDPALRAHFKDAGLHVFDLFEHVSPAVERVLGEPATPSGGHTHGMASDYEARMDAVNFALRLDDGLSPEHLGQADLILVGVSRVGKTPTALYLALHYGLRAANYPLTPDDLANDGLPRALQPHLPRLRGLTLAPERLAAIREARLPGSRYASVAQCRSELDAAERLLAAHAIPLIDTSRMSVEEIAARLRAS	This protein is involved in the following processs: phosphorylation, protein phosphorylation, and protein dephosphorylation. This protein is involved in metabolic process: protein dephosphorylation. This protein enables nucleotide binding: nucleotide binding, ATP binding, and ADP binding. This protein enables transferase activity: transferase activity, kinase activity, transferase activity, transferring phosphorus-containing groups, phosphotransferase activity, phosphate group as acceptor, and protein serine/threonine kinase activity. This protein is involved in phosphorylation: phosphorylation, and protein phosphorylation. This protein enables the following functions: transferase activity, transferring phosphorus-containing groups, ADP binding, nucleotide binding, transferase activity, phosphotransferase activity, phosphate group as acceptor, protein serine/threonine kinase activity, ATP binding, and kinase activity.
MELDAILDNLSDEEQIELLELLEEEENYRNTHLLYEFTPYSKQREFIDAGHDYQSDVLWLVTSLVSHLLALLKSRFTLPGDTRERKVIRLMVNMAESGKVSVSMSQLSSGIGGETNETVTKTTQRILCGRIEENDEPGYGSPKEDSSWEKSSVLLILLIIFSLSHHRLMVLKMHSICYFKHTRRHRHAAGDTITAYGLTKRLPYSIYAEGLTRTNKYGQFSILTFTPLMGMSDGVTKFLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEETIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDADVFYLARVWKKSENTAVQAWGAVKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSMLPDHATFPDGGNSVESGISELRDLMLEGRFKVFNTCEPFFEEFRLYHRDENGKIVKTNDDVLDATRYGYMMRLRQDDARY	This protein is involved in the following process: nucleic acid phosphodiester bond hydrolysis. This protein enables hydrolase activity: nuclease activity, hydrolase activity, and endonuclease activity. This protein is involved in metabolic process: nucleic acid phosphodiester bond hydrolysis. This protein enables metal ion binding: metal ion binding. This protein enables nucleotide binding: nucleotide binding, and ATP binding. This protein enables the following functions: nucleotide binding, nuclease activity, hydrolase activity, endonuclease activity, ATP binding, and metal ion binding.
MRVVKVKKTVVIIGGGAAGMSAASRVKRLKPEWDVKVFEATEWVSHAPCGIPYVVEGISPTEKLMHYPPEVFIKKRGIDLHLNAEVIEVDTGYVRVREKDGEKSYEWDYLVFANGASPQVPAIEGVDLKGVFTADLPPDAVAIREYMEKNRVEDVVIVGGGYIGLEMAEAFVAQGKRVTMIVRGERILRRSFDKEVTDIIEEKLKQHVNLRLQEIVLRIEGKDRVEKVVTDAGEYRADLVILATGIKPNIELARQLGVRIGETGAIWTNEKMQTSVENVYAAGDVAETKHVITGRRVWVPLAPPGNKMGYVAGSNIAGKEIHFPGVLGTTVTKFLDVEIGKTGLTETEALKEGYDIRTAFIKASTRPHYYPGGKEIWLKGVVDNETNRLLGVQAVGAEILPRIDAAAAMLMANFTTKDAFFTDLAYAPPFAPVWDPLVVLARVLKF	This protein is involved in the following process: cell redox homeostasis. This protein enables catalytic activity: protein disulfide isomerase activity, oxidoreductase activity, and CoA-disulfide reductase activity. This protein enables nucleotide binding: flavin adenine dinucleotide binding, and NADP binding. This protein enables the following functions: oxidoreductase activity, NADPH, CoA-disulfide reductase activity, protein disulfide isomerase activity, NADP binding, and flavin adenine dinucleotide binding.
MENLLSVKDLSKQQILDLLALAKAVKANPAEYSQALAGKSIVTIYEKPSLRTRVTFDIGIHKLGGHAVYLDAQNGAIGERETVKDFAANISRWADAIVARVVSHKTLEGLVEHGSVPVVNSLCDLYHPCQALADFLTISEHYEDVSKVKLAYVGEGNNVTHSLMLTGAILGAEVTAVCPRGSSPDAQIVKQAMALAEISGGKINVTDNLDDIVDYDVIYGDTWVSMGDDTPLAQVKEKYMPYQINKALLMRTGIKHVLHCQPAHRELEITSEVMDGEHSLIFDQAENRMHAQNAVLLTLLK	This protein is part of the following component: cytoplasm. This protein is involved in the following processs: cellular amino acid metabolic process, cellular amino acid biosynthetic process, ornithine metabolic process, and arginine biosynthetic process. This protein is located in the following component: cytoplasm. This protein is involved in metabolic process: ornithine metabolic process, and cellular amino acid metabolic process. This protein is part of cytoplasm: cytoplasm. This protein enables transferase activity: carboxyl- or carbamoyltransferase activity, transferase activity, and ornithine carbamoyltransferase activity. This protein is involved in cellular amino acid biosynthetic process: arginine biosynthetic process, and cellular amino acid biosynthetic process. This protein enables the following functions: ornithine carbamoyltransferase activity, transferase activity, amino acid binding, and carboxyl- or carbamoyltransferase activity.
MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK	This protein is part of the following components: endosome, cytoplasmic vesicle, cytosol, membrane, phagophore assembly site, phagocytic vesicle membrane, late endosome, phagocytic vesicle, phosphatidylinositol 3-kinase complex, class III, peroxisome, phosphatidylinositol 3-kinase complex, class III, type I, cytoplasm, phosphatidylinositol 3-kinase complex, class III, type II, autophagosome, axoneme, autolysosome, and midbody. This protein is involved in the following processs: phosphatidylinositol biosynthetic process, cell cycle, regulation of cytokinesis, protein processing, macroautophagy, phosphatidylinositol phosphate biosynthetic process, regulation of protein secretion, protein localization to phagophore assembly site, autophagy of peroxisome, phosphatidylinositol-3-phosphate biosynthetic process, protein phosphorylation, cell division, toll-like receptor 9 signaling pathway, protein lipidation, cellular response to glucose starvation, autophagosome assembly, endosome organization, autophagy, early endosome to late endosome transport, response to leucine, phosphorylation, phosphatidylinositol-mediated signaling, endocytosis, and cellular response to starvation. This protein is active in the following components: membrane, endosome, phagophore assembly site, cytoplasm, and peroxisome. This protein is located in the following components: midbody, late endosome, endosome, membrane, cytoplasmic vesicle, phagocytic vesicle, autophagosome, axoneme, cytosol, and phagocytic vesicle membrane. This protein is involved in signal transduction: phosphatidylinositol-mediated signaling, and toll-like receptor 9 signaling pathway. This protein is involved in metabolic process: autophagy of peroxisome, macroautophagy, protein lipidation, and autophagy. This protein enables nucleotide binding: nucleotide binding, and ATP binding. This protein is part of membrane: phagocytic vesicle membrane, and membrane. This protein is part of cytoplasm: cytoplasm. This protein enables transferase activity: transferase activity, 1-phosphatidylinositol-3-kinase activity, phosphatidylinositol 3-kinase activity, protein kinase activity, kinase activity, and phosphatidylinositol kinase activity. This protein is involved in proteolysis: protein processing. This protein is involved in lipid metabolic process: phosphatidylinositol-3-phosphate biosynthetic process, phosphatidylinositol biosynthetic process, and phosphatidylinositol phosphate biosynthetic process. This protein is part of cytosol: cytosol. This protein is involved in phosphorylation: phosphorylation, and protein phosphorylation. This protein is involved in cell cycle: cell cycle. This protein is involved in cell division: cell division. This protein enables the following functions: nucleotide binding, 1-phosphatidylinositol-3-kinase activity, transferase activity, ATP binding, phosphatidylinositol kinase activity, phosphatidylinositol 3-kinase activity, kinase activity, protein binding, and protein kinase activity.
MILKPENEKKLIIDVLKKFGVPEEDAKITADVFVDADLKGFTSHGIGRFPQYITALKLGNINPKPDIKIVKESPATAVIDGDLGLGQVVGKKAMELAIKKAKNVGVGVVATRNANHFGIAGYYSELAMNQDMIGITITNTEPAMAPFGGKEKILGTNPIAIAFKGNKYKFSLDMATASIARGKILEALRKKIKIPEGCAVDKDGKPTTDPAKALEGCILPFGGPKGYGLALAIEMLSAIGGAEVGTKVKGTANPEERCTKGDLFIAINPEFFMGKEEFKRKVDELLDEIKNSEPAEGFEILIPGEIEERNKMKRKDGFEIDKNLYNQLKEICNELGLNIEDYIE	This protein is part of the following component: cytoplasm. This protein is involved in the following process: coenzyme M biosynthetic process. This protein is located in the following component: cytoplasm. This protein is involved in metabolic process: coenzyme M biosynthetic process. This protein enables catalytic activity: L-2-hydroxycarboxylate dehydrogenase (NAD+) activity, oxidoreductase activity, and sulfopyruvate decarboxylase activity. This protein is part of cytoplasm: cytoplasm. This protein enables the following functions: oxidoreductase activity, L-2-hydroxycarboxylate dehydrogenase (NAD+) activity, and sulfopyruvate decarboxylase activity.
MRTVLLTGFEPFENEPINPSWEAVRALDGERVGDAVIVARQLPCVFGAAIDTIGELVDVLRPALVIAVGQAGGRAEMSVERVAINVDDARIADNAGAQPIDTAIVAGGPAAYFATLPIKAMVRDMRAAGVPASVSQTAGTFVCNHVFYGLMHRLSQQPDGDVRGGFIHIPYLPEQAARHPGQPSLAQETLVKGLRAAVATALSTRADVREQGGQLH	This protein is part of the following components: cytoplasm, and cytosol. This protein is involved in the following process: proteolysis. This protein is located in the following components: cytoplasm, and cytosol. This protein enables hydrolase activity: peptidase activity, pyroglutamyl-peptidase activity, hydrolase activity, and cysteine-type peptidase activity. This protein is part of cytoplasm: cytoplasm. This protein is involved in proteolysis: proteolysis. This protein is part of cytosol: cytosol. This protein enables the following functions: peptidase activity, hydrolase activity, cysteine-type peptidase activity, and pyroglutamyl-peptidase activity.
MSRGRADTAGDCSKNGRRSRILHYLMAIYLLNGLPGGEYARFIKIARLLDVSPSTVSIMTRRLQMKGLVELIPNMGVRLTEQGLKILSNYLWKSAILEVLLARAGVDIDNCRGMGLRMAEGLSDEDAWILYKVLGEPKYCPHKKPIIPPDEINAENARQIALCCGISILQIPNNRLQPPS	This protein is involved in the following process: regulation of transcription, DNA-templated. This protein enables metal ion binding: transition metal ion binding. This protein enables DNA binding: DNA binding. This protein is involved in regulation of transcription, DNA-templated: regulation of transcription, DNA-templated. This protein enables the following functions: transition metal ion binding, protein dimerization activity, DNA binding, and DNA-binding transcription factor activity.
MSEKNEIYDESQIQVLEGLEAVRKRPGMYIGSTGTRGLHHLVYEIVDNSIDEALAGYCSHIKVFIHKDNSVTVSDDGRGMPIGIHHKMKKPTVEVIMTILHAGGKFGGGAYRVSGGLHGVGASVVNALSETCEVEVKTEGHIWKQTYHRGKVASPFEKIGDSDEHGTKIYFKPDPEIFEDTEYDYDTLSQRLRELAFLNKGIKIELTDERHDKNEIFHYEGGLKSFVSYLNRNKEVVFKEPIYVEGSIDSNYSVEIALQYNDGYNENIFSFANNIHTIEGGTHLAGFKTALTRVINDYAKKFGYLKENDKNLSGEDIREGLTAVVSVKLTEPQFEGQTKTKLGNTEVRGIVDSIISERVSTYLEENPQIGKLVIDKALVASRAREAAKKAREITRRKSVLESTSLPGKLADCSSKDAEECEIYIVEGDSAGGSAKQGRNRRFQAILPLRGKIMNVEKQRIDKILNSEEIKAMATAFGGGIGKDFDVSKLRYHKIIIMTDADVDGAHIRTLILTFFYRYMTELISEGHVFIAQPPLYKVTKTRKEYYAYSDKELEDVLQDVGGKDKNTDIQRYKGLGEMNPEQLWETTMNPEQRTLIKVNIEDAMAADEIFTILMGDKVDPRRKFIEENATKVVNLDV	This protein is part of the following components: cytoplasm, and chromosome. This protein is involved in the following processs: DNA-dependent DNA replication, and DNA topological change. This protein is located in the following components: cytoplasm, and chromosome. This protein is involved in metabolic process: DNA-dependent DNA replication, and DNA topological change. This protein enables metal ion binding: metal ion binding. This protein enables catalytic activity: DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity, DNA topoisomerase activity, and isomerase activity. This protein enables nucleotide binding: ATP binding, and nucleotide binding. This protein is part of cytoplasm: cytoplasm. This protein enables DNA binding: DNA binding. This protein enables the following functions: metal ion binding, DNA binding, ATP binding, DNA topoisomerase activity, nucleotide binding, DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity, and isomerase activity.
MKAVLALATLIGSTLASSCSSTALSCSNSANSDTCCSPEYGLVVLNMQWAPGYGPDNAFTLHGLWPDKCSGAYAPSGGCDSNRASSSIASVIKSKDSSLYNSMLTYWPSNQGNNNVFWSHEWSKHGTCVSTYDPDCYDNYEEGEDIVDYFQKAMDLRSQYNVYKAFSSNGITPGGTYTATEMQSAIESYFGAKAKIDCSSGTLSDVALYFYVRGRDTYVITDALSTGSCSGDVEYPTK	This protein is involved in the following processs: nucleic acid phosphodiester bond hydrolysis, and RNA phosphodiester bond hydrolysis, endonucleolytic. This protein enables hydrolase activity: ribonuclease T2 activity, hydrolase activity, nuclease activity, and endonuclease activity. This protein is involved in metabolic process: nucleic acid phosphodiester bond hydrolysis, and RNA phosphodiester bond hydrolysis, endonucleolytic. This protein enables catalytic activity: lyase activity. This protein enables RNA binding: RNA binding. This protein enables the following functions: hydrolase activity, nuclease activity, RNA binding, ribonuclease T2 activity, endonuclease activity, and lyase activity.
MGVEVPPEESNRCVRGCCRSAAIPLHLPPSSFSLLSPIAKGSESTVYEARLGGERVAAKKPVLSTSDDLDKFHYQLQLLWWVLPIELDHPGLARLVAAHARPPNYLMFFDFFEPPNLADKIHVEEWNPSVQQVVTIATDLAKALQYLNILGIVHRDIKPANILIDKDFHPHLADFGLAMYQKDIKHVSVENWRSSGKPTGGFHKKNMVGTLIYMAPEILRKDIHTEKSDVYSFAISINELLTGVVPYTDLRAEAQAHTVLEMTYTEQQLTAAIVSQGLRPALALPESGAPPSLLSLIQRCWDSDPQQRPSFKDITEELKIIEKHIAVNSCSLASPANKSQNGNTEVHHYQEALSWLNQGELFAKGNKLDSTVDHWSDIFDQSSKYCPTLSWGSFATCGRRETMEDTHFMLPHMSEEKDLHAFGIFDGHRGSAAAEFSVRAVPGFLKQFNSNTSPTDALTEAFVRTDIAFREELILHQKSKRITQKNWHPGCTAVTALIVRNKLFVANAGDCRAILNRAGEPFPMTRDHVASCPKERERIVKEGTEVKWQIDTWRVGAAALQVTRSIGDDDLKPAVTAQPEVIETILSPDDEFLVMASDGLWDVMSNEDVLSIIKDTVKEPGMCSKRLATEAAARGSKDNITVIVVFLRPVSTAERIY	This protein is part of the following components: nucleus, and cytosol. This protein is involved in the following processs: metabolic process, protein dephosphorylation, protein phosphorylation, L-ascorbic acid metabolic process, and phosphorylation. This protein is active in the following components: nucleus, and cytosol. This protein enables hydrolase activity: phosphoprotein phosphatase activity, protein serine/threonine phosphatase activity, and hydrolase activity. This protein is involved in metabolic process: metabolic process, and protein dephosphorylation. This protein enables metal ion binding: metal ion binding. This protein enables catalytic activity: catalytic activity. This protein enables nucleotide binding: nucleotide binding, and ATP binding. This protein enables transferase activity: kinase activity, protein kinase activity, transferase activity, and protein serine/threonine kinase activity. This protein is involved in phosphorylation: protein phosphorylation, and phosphorylation. This protein enables the following functions: ATP binding, metal ion binding, protein threonine kinase activity, protein serine/threonine kinase activity, protein serine/threonine phosphatase activity, protein serine/threonine phosphatase activity, protein serine kinase activity, kinase activity, phosphatase activity, phosphoprotein phosphatase activity, protein serine phosphatase activity, protein kinase activity, transferase activity, catalytic activity, hydrolase activity, protein threonine phosphatase activity, and nucleotide binding.
MESVRSLVEDKPVVIFSKSSCCMSHSIQTLISGFGAKMTVYELDQFSNGQEIEKALVQMGCKPSVPAVFIGQQFIGGANQVMTLQVKNQLAAMLRRAGAIWV	This protein is part of the following component: cytoplasm. This protein is involved in the following processs: cell redox homeostasis, negative regulation of transcription by RNA polymerase II, and electron transport chain. This protein is located in the following component: cytoplasm. This protein is involved in metabolic process: electron transport chain. This protein enables metal ion binding: metal ion binding. This protein enables catalytic activity: electron transfer activity, and protein-disulfide reductase activity. This protein is part of cytoplasm: cytoplasm. This protein is involved in regulation of transcription, DNA-templated: negative regulation of transcription by RNA polymerase II. This protein enables the following functions: protein binding, 2 iron, 2 sulfur cluster binding, electron transfer activity, protein-disulfide reductase activity, metal ion binding, and iron-sulfur cluster binding.
MAPTKKKTSRKPKNRCVKNEKLASFIKDFDSQVKIITEELKASVVNILKEVDSQYNIEIIKLPMAIREMCWLDYIAKGGSQKALEAAATVKVDMEEITSTVTKTPFKLDKKVKKGKCKSDETLEPNPLQSVIRTKTKAKVAAKKPSTARKTRASTANLTNTSKRTSKRGRATPSASKQIETSLLGYTPAATPRIDTSIFKTPALRTPCLQEPVYTFSANGSPLAGMDELFINVPAGDGKNIRLLASEVDSLDINRLDNQAFENIKLLSSQLQRFCKKLK	This protein is part of the following components: chromosome, spindle midzone, cytoplasm, spindle, cytoskeleton, chromosome, centromeric region, chromosome passenger complex, and nucleus. This protein is involved in the following processs: mitotic sister chromatid segregation, cell division, chromosome segregation, and cell cycle. This protein is active in the following components: chromosome, centromeric region, and spindle midzone. This protein is located in the following components: cytoplasm, chromosome, nucleus, spindle, chromosome, centromeric region, and cytoskeleton. This protein is part of cytoplasm: cytoplasm. This protein is part of nucleus: nucleus. This protein is involved in cell cycle: cell cycle. This protein is involved in cell division: cell division.
MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQKQEKPRTPMPSSVEAERTDTAVQATGSVPSTPIAHRGPSSSLNTPGSFRRGLDDSTGGTPLTPAARISALNIVGDLLRKVGALESKLASCRNLVYDQSPNRTGGPASGRSSKNRDGGERRPSSTSVPLGDKGLDTSCRWLSKSTTRSSSSC	This protein is part of the following components: cytoplasm, membrane, cytoskeleton, chromosome, kinetochore, kinesin complex, kinetochore, spindle pole centrosome, microtubule, spindle, cleavage furrow, chromosome, centromeric region, synapse, cytosol, microtubule organizing center, and centrosome. This protein is involved in the following processs: nervous system development, neuron migration, microtubule organizing center organization, cell differentiation, chromosome segregation, cerebral cortex development, G2/M transition of mitotic cell cycle, forebrain development, centrosome duplication, centrosome localization, cell cycle, microtubule nucleation, multicellular organism development, regulation of G2/M transition of mitotic cell cycle, vesicle transport along microtubule, mitotic spindle organization, neuroblast proliferation, establishment of mitotic spindle orientation, cell division, establishment of chromosome localization, cell migration, ciliary basal body-plasma membrane docking, and mitotic centrosome separation. This protein is active in the following components: centrosome, and kinetochore. This protein is located in the following components: chromosome, centromeric region, cytoskeleton, microtubule organizing center, microtubule, centrosome, cytosol, spindle, kinetochore, cleavage furrow, membrane, cytoplasm, spindle pole centrosome, chromosome, and synapse. This protein is part of membrane: membrane, and cleavage furrow. This protein is part of cytoplasm: cytoplasm. This protein is part of cytosol: cytosol. This protein is involved in cell cycle: cell cycle. This protein is involved in cell division: cell division. This protein enables the following functions: microtubule binding, identical protein binding, protein binding, and protein domain specific binding.
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRATKGLMKGKHYYEVSCHDQGLCRVGWSTMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQGLAALEKEAQTSFLHLGYLPNQLFRTS	This protein is part of the following components: cytoplasm, nucleus, cytosol, tRNA-splicing ligase complex, cytoplasmic stress granule, mitochondrion, and cleavage body. This protein is involved in the following processs: innate immune response, DNA duplex unwinding, tRNA processing, regulation of transcription, DNA-templated, tRNA splicing, via endonucleolytic cleavage and ligation, positive regulation of I-kappaB kinase/NF-kappaB signaling, immune system process, mRNA processing, defense response to virus, regulation of nucleic acid-templated transcription, nucleic acid phosphodiester bond hydrolysis, and double-strand break repair. This protein is located in the following components: cytoplasmic stress granule, mitochondrion, cleavage body, nucleus, cytosol, and cytoplasm. This protein enables hydrolase activity: nuclease activity, hydrolase activity, and exonuclease activity. This protein is involved in metabolic process: mRNA processing, and nucleic acid phosphodiester bond hydrolysis. This protein enables catalytic activity: RNA helicase activity, helicase activity, and DNA/RNA helicase activity. This protein enables nucleotide binding: ATP binding, and nucleotide binding. This protein is involved in cellular response to DNA damage stimulus: double-strand break repair. This protein is part of mitochondrion: mitochondrion. This protein enables RNA binding: RNA binding, and poly(A) binding. This protein is part of cytoplasm: cytoplasm. This protein enables DNA binding: DNA binding. This protein is part of nucleus: nucleus. This protein is part of cytosol: cytosol. This protein is not involved in tRNA processing: tRNA processing, and tRNA splicing, via endonucleolytic cleavage and ligation. This protein enables the following functions: DNA binding, RNA binding, chromatin binding, transcription coregulator activity, helicase activity, hydrolase activity, ATP binding, nucleic acid binding, exonuclease activity, DNA/RNA helicase activity, nucleotide binding, nuclease activity, poly(A) binding, and RNA helicase activity.
MKRIFLLIATNLAVLLVASIVMSILGVNTSTMGGLLVFAAIFGFGGAFISLAISKWMAKKTMGCEVITTPRDSTERWLVETVARQAKQAGIKMPEVAIYQSSDMNAFATGPSKDNSLVAVSTGLLYGMSQDEIEGVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVAGIINNFVSSNDEEGEGLGMFAYMAVVFVLDMLFGILASIIVAYFSRIREYKADEGAARLAGKGKMIAALERLRQGPESTAMPAQMSAFGINGKRSMAEMMMSHPPLEKRIAALRAS	This protein is part of the following components: plasma membrane, membrane, and integral component of membrane. This protein is involved in the following process: proteolysis. This protein is located in the following components: membrane, integral component of membrane, and plasma membrane. This protein enables hydrolase activity: metallopeptidase activity, hydrolase activity, metalloendopeptidase activity, and peptidase activity. This protein enables metal ion binding: metal ion binding, and zinc ion binding. This protein is part of membrane: membrane, and plasma membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is involved in proteolysis: proteolysis. This protein enables the following functions: hydrolase activity, zinc ion binding, metallopeptidase activity, metal ion binding, metalloendopeptidase activity, and peptidase activity.
MDSIISAASVIAAGLAIGLAAIGPGIGQGNAAGQAVEGIARQPEAENKIRGTLLLSLAFMEALTIYGLVVALALLFANPFNS	This protein is part of the following components: chloroplast, proton-transporting two-sector ATPase complex, proton-transporting domain, membrane, proton-transporting ATP synthase complex, coupling factor F(o), plastid, integral component of membrane, chloroplast thylakoid membrane, and thylakoid. This protein is involved in the following processs: ion transport, ATP biosynthetic process, proton transmembrane transport, and ATP synthesis coupled proton transport. This protein is located in the following components: chloroplast thylakoid membrane, membrane, chloroplast, thylakoid, integral component of membrane, and plastid. This protein is involved in metabolic process: ATP biosynthetic process. This protein enables catalytic activity: proton-transporting ATP synthase activity, rotational mechanism. This protein is part of membrane: chloroplast thylakoid membrane, and membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is involved in cation transport: ATP synthesis coupled proton transport, proton transmembrane transport, and ion transport. This protein is part of plastid: plastid, and chloroplast. This protein enables the following functions: proton-transporting ATP synthase activity, rotational mechanism, lipid binding, and proton transmembrane transporter activity.
MDIIGGQHLRQMWDDLADVYGHKTALICESSGGVVNRYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLREESAWILQNSQACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSSFTQLKNQQPATLCYAPPLLTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQCALRDDDVYLTVMPAFHIDCQCTAAMAAFSAGATFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMVQPPSANDRQHRLREVMFYLNLSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGEIGEICIKGVPGKTIFKEYFLNPKATAKVLEADGWLHTGDTGYCDEEGFFYFVDRRCNMIKRGGENVSCVELENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPSYLEIRKDLPRNCSGKIIRKNLK	This protein is involved in the following process: carnitine metabolic process. This protein is involved in metabolic process: carnitine metabolic process. This protein enables catalytic activity: CoA-ligase activity, ligase activity, catalytic activity, carnitine-CoA ligase activity, acid-thiol ligase activity, and crotonobetaine-CoA ligase activity. This protein enables the following functions: ligase activity, crotonobetaine-CoA ligase activity, catalytic activity, CoA-ligase activity, acid-thiol ligase activity, and carnitine-CoA ligase activity.
MGCDRNCGLITGAVIGAVLAVFGGILMPVGDLLIEKTIKREVVLEEGTIAFKNWVKTGTTVYRQFWIFDVQNPEEVAKNSSKIKVKQRGPYTYRVRYLAKENITQDPKDSTVSFVQPNGAIFEPSLSVGTENDNFTVLNLAVAAAPHIYTNSFVQGVLNSLIKKSKSSMFQTRSLKELLWGYKDPFLSLVPYPISTTVGVFYPYNNTVDGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESYCDMINGTDAASFPPFVEKSQTLRFFSSDICRSIYAVFESEVNLKGIPVYRFVLPANAFASPLQNPDNHCFCTEKVISNNCTSYGVLDIGKCKEGKPVYISLPHFLHASPDVSEPIEGLNPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPARKIEALKNLKRPYIVPILWLNETGTIGDEKAEMFRNQVTGKIKLLGLVEMVLLGVGVVMFVAFMISYCACRSKNGK	This protein is part of the following components: external side of plasma membrane, receptor complex, mitochondrion, integral component of membrane, apical part of cell, apical plasma membrane, cell periphery, intracellular membrane-bounded organelle, endoplasmic reticulum, plasma membrane, brush border membrane, Golgi apparatus, membrane, caveola, protein-containing complex, sarcolemma, membrane raft, and cell surface. This protein is involved in the following processs: cellular response to amyloid-beta, low-density lipoprotein particle mediated signaling, response to linoleic acid, phagocytosis, recognition, response to estradiol, amyloid fibril formation, positive regulation of interleukin-1 beta production, positive regulation of cold-induced thermogenesis, positive regulation of reactive oxygen species biosynthetic process, response to nutrient, positive regulation of gene expression, triglyceride metabolic process, positive regulation of cytosolic calcium ion concentration, fatty acid transport, cellular response to oxidised low-density lipoprotein particle stimulus, fatty acid metabolic process, amyloid-beta clearance by cellular catabolic process, cholesterol import, cholesterol transport, positive regulation of nitric oxide biosynthetic process, energy homeostasis, response to activity, response to growth hormone, long-chain fatty acid transport, short-chain fatty acid transport, positive regulation of NLRP3 inflammasome complex assembly, cellular response to low-density lipoprotein particle stimulus, regulation of removal of superoxide radicals, triglyceride transport, glucose homeostasis, negative regulation of angiogenesis, response to fatty acid, nitric oxide mediated signal transduction, cell-cell adhesion via plasma-membrane adhesion molecules, positive regulation of cytokine production, intestinal absorption, intestinal cholesterol absorption, cellular response to lipopolysaccharide, negative regulation of gene expression, regulation of toll-like receptor signaling pathway, positive regulation of tumor necrosis factor production, positive regulation of peptidyl-tyrosine phosphorylation, positive regulation of I-kappaB kinase/NF-kappaB signaling, positive regulation of blood microparticle formation, interleukin-1 beta production, immune response, oxidised low-density lipoprotein particle clearance, defense response to Gram-positive bacterium, lipoprotein transport, positive regulation of phagocytosis, long-chain fatty acid import into cell, positive regulation of cholesterol storage, cellular response to bacterial lipopeptide, receptor-mediated endocytosis, cellular response to insulin stimulus, positive regulation of cell death, eating behavior, positive regulation of reactive oxygen species metabolic process, positive regulation of phagocytosis, engulfment, cGMP-mediated signaling, lipid transport across blood-brain barrier, positive regulation of triglyceride metabolic process, digestive tract development, interleukin-1 beta production, positive regulation of cytokine production, positive regulation of macrophage derived foam cell differentiation, negative regulation of protein import into nucleus, positive regulation of interleukin-12 production, response to stilbenoid, response to mechanical stimulus, regulation of protein-containing complex assembly, positive regulation of cell-matrix adhesion, cell adhesion, maternal placenta development, positive regulation of interleukin-6 production, positive regulation of MAPK cascade, negative regulation of transcription by RNA polymerase II, cellular response to hydroperoxide, cellular response to diacyl bacterial lipopeptide, response to bacterium, low-density lipoprotein particle clearance, long-chain fatty acid import across plasma membrane, cellular response to lipoteichoic acid, apoptotic cell clearance, long-chain fatty acid metabolic process, positive regulation of ERK1 and ERK2 cascade, positive regulation of NF-kappaB transcription factor activity, sensory perception of taste, positive regulation of glycogen biosynthetic process, positive regulation of blood coagulation, response to lipid, cell surface receptor signaling pathway, response to drug, positive regulation of macrophage cytokine production, receptor internalization, fatty acid oxidation, regulation of action potential, lipid storage, plasma lipoprotein particle clearance, and negative regulation of systemic arterial blood pressure. This protein is active in the following components: cell surface, cytoplasm, caveola, and plasma membrane. This protein is located in the following components: membrane, sarcolemma, plasma membrane, brush border membrane, Golgi apparatus, cell periphery, mitochondrion, cell surface, membrane raft, integral component of membrane, intracellular membrane-bounded organelle, external side of plasma membrane, apical part of cell, endoplasmic reticulum, apical plasma membrane, and caveola. This protein is involved in signal transduction: low-density lipoprotein particle mediated signaling, cell surface receptor signaling pathway, cGMP-mediated signaling, and nitric oxide mediated signal transduction. This protein is involved in metabolic process: amyloid fibril formation, amyloid-beta clearance by cellular catabolic process, and receptor internalization. This protein is part of membrane: membrane raft, caveola, apical plasma membrane, membrane, brush border membrane, sarcolemma, and plasma membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is part of mitochondrion: mitochondrion. This protein is involved in lipid metabolic process: triglyceride metabolic process, fatty acid metabolic process, fatty acid oxidation, and long-chain fatty acid metabolic process. This protein is involved in regulation of transcription, DNA-templated: positive regulation of NF-kappaB transcription factor activity, and negative regulation of transcription by RNA polymerase II. This protein is involved in protein transport: lipoprotein transport. This protein enables the following functions: low-density lipoprotein particle binding, oleic acid binding, protein binding, lipid binding, scavenger receptor activity, Toll-like receptor binding, lipoprotein particle binding, transforming growth factor beta binding, protein-containing complex binding, short-chain fatty acid transmembrane transporter activity, long-chain fatty acid transporter activity, amyloid-beta binding, oleate transmembrane transporter activity, oxidised low-density lipoprotein particle receptor activity, thrombospondin receptor activity, high-density lipoprotein particle binding, low-density lipoprotein particle receptor activity, and lipoteichoic acid immune receptor activity.
MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLASSIGGTLGL	This protein is part of the following components: integral component of membrane, cytosol, membrane, synaptic vesicle, presynaptic active zone membrane, endomembrane system, presynaptic membrane, cytoplasm, neuromuscular junction, cytoskeleton, SNARE complex, plasma membrane, nucleus, microtubule organizing center, axon, presynapse, and spindle. This protein is involved in the following processs: intracellular protein transport, regulation of gene expression, negative regulation of synaptic vesicle recycling, positive regulation of neurotransmitter secretion, spontaneous neurotransmitter secretion, exocytosis, positive regulation of spontaneous neurotransmitter secretion, vesicle fusion, neurotransmitter transport, regulation of synaptic vesicle priming, negative regulation of macropinocytosis, calcium ion-regulated exocytosis of neurotransmitter, exocytic insertion of neurotransmitter receptor to postsynaptic membrane, vesicle docking, synaptic vesicle fusion to presynaptic active zone membrane, synaptic vesicle exocytosis, regulation of exocytosis, protein localization to membrane, vesicle docking involved in exocytosis, vesicle-mediated transport, synaptic vesicle docking, negative regulation of neuron projection development, protein transport, positive regulation of excitatory postsynaptic potential, and regulation of synaptic activity. This protein is active in the following components: presynaptic active zone membrane, integral component of membrane, plasma membrane, endomembrane system, and synaptic vesicle. This protein is located in the following components: microtubule organizing center, cytoplasm, axon, presynapse, presynaptic membrane, cytosol, presynaptic active zone membrane, membrane, integral component of membrane, nucleus, neuromuscular junction, plasma membrane, spindle, and cytoskeleton. This protein is part of membrane: membrane, plasma membrane, presynaptic active zone membrane, and presynaptic membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is part of cytoplasm: cytoplasm. This protein is part of nucleus: nucleus. This protein is part of cytosol: cytosol. This protein is involved in protein transport: protein transport, and intracellular protein transport. This protein enables the following functions: signaling receptor binding, protein kinase binding, protein binding, SNAP receptor activity, protein domain specific binding, and SNARE binding.
MSDVPDDANAGCPGTGSAGAGKASGCAGCPNQGSCATGQGPPPDADVPKIQDRFSRIKHKILILSGKGGVGKSTLTSNLARALASDPSKQVAILDVDICGPSQPRMMGVEDEEVHNSADGWTPVGIQPNLTLMSIAFLLGDKNDAVIWRGARKNGMIKQFLKDVDWGEVDYLLIDTPPGTSDEHISLVQFLLQAGPLDGALIVSTPQEVSLLDVRKEVSFCVKTKVPILGVVENMARFVCPNCAHTTLLFPTSTGGAEQMCKDSNLELLAQLPLEPALAKALDNGEDFFETNPDSTLAKSFLDLAEKVKAKLV	This protein is part of the following components: cytoplasm, cytosol, cilium, and cell projection. This protein is involved in the following processs: regulation of non-motile cilium assembly, cell projection organization, and iron-sulfur cluster assembly. This protein is active in the following component: cytosol. This protein is located in the following components: cytosol, cilium, cell projection, and cytoplasm. This protein is involved in metabolic process: iron-sulfur cluster assembly. This protein enables metal ion binding: metal ion binding. This protein enables nucleotide binding: ATP binding, and nucleotide binding. This protein is part of cytoplasm: cytoplasm. This protein is part of cytosol: cytosol. This protein enables the following functions: ATP binding, nucleotide binding, iron-sulfur cluster binding, metal ion binding, and 4 iron, 4 sulfur cluster binding.
MIEQNKHQQLRIGLASPEQICAWSEKILPNGEIVGQVTKPYTLHYETNKPERDGSFCERIFGPIKSRVCACGNSPGIGNEKIDSKFCTQCGVEFVDSRIRRYQMGYIKLACPVVHVWYLKRLPSYIANLLAKTRKELEGPVYCDLFLARPIAKKPTLLRSRGTFNYEIQSWKDIIPHYLSARPHYLFARGSGTFKEREIATGGDAIGEQLTGLDLQMIIDRSHMEWKNLVELKWNRLEENQESTVDRWEDEKIRRRKDFLVGRIKLAKHFLRTNIEPKWMVLCLLPVLPPEPRPIVQLGEGGLITSSDLNELYRRVINRNNTLTNLLARSGSESFVICQKKLIQEAVDALLDNGICGQPMRDSHDRPYKSFSDVIEGKEGRFRENLLGKRVDYSGRSVIVVGPFLSLYQCGLPSEIAIELFQAFVIRSLIGRHIAPNLRAAKSMIRDKGPIVWEVLQEVMQGHPVLLNRAPTLHKLGIQAFQPILVEGRAIRLHPSVCGGFNADFDGDQMAVHVPLSLEARAEARLLMFSETNLLSPAIGDPISIPTQDMLLGLYISTVENSQGIYGNRYHPYHSEKKSFSCKKPSFYSYDDVLRAYRQKRIDLYSPLWLRWGELDLRIITSVNQEAPIEVQYESLGTFHEIHEHYRIRKGRMGEILNIYIRTTVGRTRFNREMEEAIQGFACFEHPKKSLPALRI	This protein is part of the following components: plastid, and chloroplast. This protein is involved in the following process: transcription, DNA-templated. This protein is located in the following components: chloroplast, and plastid. This protein is involved in metabolic process: transcription, DNA-templated. This protein enables metal ion binding: metal ion binding, magnesium ion binding, and zinc ion binding. This protein enables DNA binding: DNA binding. This protein enables transferase activity: DNA-directed 5'-3' RNA polymerase activity, nucleotidyltransferase activity, and transferase activity. This protein is part of plastid: plastid, and chloroplast. This protein enables the following functions: DNA binding, nucleotidyltransferase activity, zinc ion binding, transferase activity, DNA-directed 5'-3' RNA polymerase activity, magnesium ion binding, and metal ion binding.
MPNDSVLSLFFFVTLFTCLLSATSHDDHIFLPSQLHDDDSVSCTATDPSLNYKPVIGILTHPGDGASGRLSNATGVSYIAASYVKFVESGGARVIPLIYNESPENLNKKLDLVNGVLFTGGWAVSGPYLDTLGNIFKKALERNDAGDHFPVIAFNLGGNLVIRIVSEQTDILEPFTASSLPSSLVLWNEANAKGSLFQRFPSDLLTQLKTDCLVLHNHRYAISPRKLQYNTKLSDFFEILATSGDRDGKTFVSTARGRKYPVTVNLWQPEKNAFEWATSLKAPHTEDAIRVTQSTANFFISEARKSTNTPDAQKVRDSLIYNYKPTFGGTAGKGYDQVYLFE	This protein is part of the following components: vacuole, extracellular space, cell wall, and extracellular region. This protein is involved in the following processs: tetrahydrofolylpolyglutamate metabolic process, and proteolysis. This protein is active in the following component: vacuole. This protein is located in the following components: extracellular region, extracellular space, and cell wall. This protein enables hydrolase activity: omega peptidase activity, hydrolase activity, and gamma-glutamyl-peptidase activity. This protein is involved in metabolic process: tetrahydrofolylpolyglutamate metabolic process. This protein is part of extracellular region: extracellular region. This protein is involved in proteolysis: proteolysis. This protein enables the following functions: gamma-glutamyl-peptidase activity, omega peptidase activity, and hydrolase activity.
MVADPPKGDPKGLAAVEPTANGAPAQDPLEDSGAAVGRCCSSRDQVRRCLRANLLVLLTVVAVVAGVALGLAVSGAGGALALGPARLIAFAFPGELLLRLLKMIILPLVVCSLVGGAASLDPSALGRLGAWALLFFLVTTLLASALGVGLALALQPGAAFAAMNASLSSTGAVEQTPSKQVLDSFLDLLRNIFPSNLVSAAFRSYSTSYEEKNFNGTLVKVPVAHEEEGMNILGLVVFAIVFGVALRKLGPEGEPLIRFFNSFNDATMVLVSWIMWYAPVGILFLVASKIVEMDDVGVLFASLGKYILCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWGILTPLAMAFGTSSSSATLPLMMKCVEERNGVAKHISRFVLPIGATVNMDGAALFQCVAAVFIAQLNRQSLDFVKIITILVTATASSVGAAGIPAGGVLTLAIILEAVSLPVSEISLILAVDWLVDRSCTIINVEGDAFGAGLLQHYVDRTEQRGSEPELTQVKSEVPLGSLPAPNEEGNPLLRHSPGAAGDAGACEKESVM	This protein is part of the following components: plasma membrane, melanosome, integral component of membrane, and membrane. This protein is involved in the following processs: amino acid transport, transmembrane transport, protein homotrimerization, and glutamine transport. This protein is located in the following components: integral component of membrane, melanosome, membrane, and plasma membrane. This protein enables metal ion binding: metal ion binding. This protein is part of membrane: membrane, and plasma membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is involved in transmembrane transport: transmembrane transport. This protein is involved in cation transport: glutamine transport. This protein enables the following functions: metal ion binding, L-glutamine transmembrane transporter activity, and symporter activity.
MATEEDVKQRQIIESRARNISHNVRCTECGSQSIEDSQADIAILLRKLIRDEIKSGKSDKEIYKKLQADYGETILYTPKFDLQTAAIWLSPVIVGGVAAGVWAYKKHRQRTNVHIMALNLVRGVPLTPREKETMLDVLTPPPPANKWWWPGK	This protein is part of the following components: protein-containing complex, mitochondrion, integral component of membrane, mitochondrial inner membrane, and membrane. This protein is involved in the following processs: embryo development ending in seed dormancy, and cytochrome complex assembly. This protein is located in the following components: mitochondrial inner membrane, integral component of membrane, mitochondrion, and membrane. This protein enables metal ion binding: metal ion binding. This protein enables catalytic activity: oxidoreductase activity. This protein is part of membrane: mitochondrial inner membrane, and membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is part of mitochondrion: mitochondrion. This protein enables the following functions: metal ion binding, and oxidoreductase activity.
MAFSGKYEFESEKNYDEFMKRLGLPGDVIERGRNFKIITEVQQDGQDFTWSQSYSGGNIMSNKFTIGKECEMQTMGGKKFKATVKMEGGKVVAEFPNYHQTSEVVGDKLVEISTIGDVTYERVSKRLA	This protein is part of the following components: cytosol, membrane, and cytoplasm. This protein is involved in the following process: lipid transport. This protein acts upstream of or within the following process: bile acid metabolic process. This protein is located in the following components: membrane, cytosol, and cytoplasm. This protein is part of membrane: membrane. This protein is part of cytoplasm: cytoplasm. This protein is involved in lipid metabolic process: bile acid metabolic process. This protein is part of cytosol: cytosol. This protein enables the following functions: fatty acid binding, and lipid binding.
MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPVLKVIVNSLKNMINTFVPSGKIMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTDIPLGEIISFNIFYELFTICTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDVMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW	This protein is part of the following components: tertiary granule lumen, extracellular exosome, extracellular space, lysosome, lysosomal lumen, ficolin-1-rich granule lumen, nucleus, extracellular region, and cytoplasm. This protein is involved in the following processs: ceramide biosynthetic process, sphingosine biosynthetic process, regulation of programmed necrotic cell death, cellular response to tumor necrosis factor, neutrophil degranulation, regulation of steroid biosynthetic process, fatty acid metabolic process, glycosphingolipid metabolic process, sphingolipid metabolic process, lipid metabolic process, ceramide catabolic process, and keratinocyte differentiation. This protein is not part of the following components: early endosome, and endoplasmic reticulum. This protein is located in the following components: cytoplasm, tertiary granule lumen, extracellular exosome, ficolin-1-rich granule lumen, lysosome, extracellular space, lysosomal lumen, extracellular region, and nucleus. This protein is not located in the following components: endoplasmic reticulum, and early endosome. This protein enables hydrolase activity: hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides, N-acylsphingosine amidohydrolase activity, hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, ceramidase activity, and hydrolase activity. This protein is part of extracellular region: extracellular region. This protein is part of cytoplasm: cytoplasm. This protein is part of nucleus: nucleus. This protein is involved in lipid metabolic process: lipid metabolic process, glycosphingolipid metabolic process, sphingosine biosynthetic process, sphingolipid metabolic process, ceramide biosynthetic process, and ceramide catabolic process. This protein enables the following functions: hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides, ceramidase activity, N-acylsphingosine amidohydrolase activity, fatty acid amide hydrolase activity, hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, and hydrolase activity.
MRKLTKMSAMLLASGLILTGCGGNKGLEEKKENKQLTYTTVKDIGDMNPHVYGGSMSAESMIYEPLVRNTKDGIKPLLAKKWDVSEDGKTYTFHLRDDVKFHDGTPFDADAVKKNIDAVQENKKLHSWLKISTLIDNVKVKDKYTVELNLKEAYQPALAELAMPRPYVFVSPKDFKNGTTKDGVKKFDGTGPFKLGEHKKDESADFNKNDQYWGEKSKLNKVQAKVMPAGETAFLSMKKGETNFAFTDDRGTDSLDKDSLKQLKDTGDYQVKRSQPMNTKMLVVNSGKKDNAVSDKTVRQAIGHMVNRDKIAKEILDGQEKPATQLFAKNVTDINFDMPTRKYDLKKAESLLDEAGWKKGKDSDVRQKDGKNLEMAMYYDKGSSSQKEQAEYLQAEFKKMGIKLNINGETSDKIAERRTSGDYDLMFNQTWGLLYDPQSTIAAFKEKNGYESATSGIENKDKIYNSIDDAFKIQNGKERSDAYKNILKQIDDEGIFIPISHGSMTVVAPKDLEKVSFTQSQYELPFNEMQYK	This protein is part of the following components: plasma membrane, ATP-binding cassette (ABC) transporter complex, membrane, and outer membrane-bounded periplasmic space. This protein is involved in the following processs: zinc ion transport, peptide transport, cobalt ion transport, ion transport, nickel cation transport, and transmembrane transport. This protein is active in the following component: outer membrane-bounded periplasmic space. This protein is located in the following components: plasma membrane, and membrane. This protein enables metal ion binding: nickel cation binding. This protein is part of membrane: plasma membrane, and membrane. This protein is involved in transmembrane transport: transmembrane transport. This protein is involved in cation transport: ion transport, nickel cation transport, zinc ion transport, and cobalt ion transport. This protein enables the following functions: heme binding, peptide transmembrane transporter activity, and nickel cation binding.
MAGERPPLRGPGPGPGEVPGEGPPGPGGTGGGPGRGRPSSYRALRSAVSSLARVDDFHCAEKIGAGFFSEVYKVRHRQSGQVMVLKMNKLPSNRGNTLREVQLMNRLRHPNILRFMGVCVHQGQLHALTEYMNGGTLEQLLSSPEPLSWPVRLHLALDIARGLRYLHSKGVFHRDLTSKNCLVRREDRGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGDDCPLPFLLLAIHCCNLEPSTRAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDPRLSRSRSDLFLPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKLLDTPSKPVLPLVPPSPFPSTQLPLVTTPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPAVGPSAEEKMECEGSSPEPEPPGPAPQLPLAVATDNFISTCSSASQPWSPRSGPVLNNNPPAVVVNSPQGWAGEPWNRAQHSLPRAAALERTEPSPPPSAPREPDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCEAGSLLCHRGHHAKPPTPSLQLPGARS	This protein is part of the following components: cytosol, cytoplasmic vesicle, nucleus, and cytoplasm. This protein is involved in the following processs: negative regulation of cilium assembly, positive regulation of protein localization to nucleus, establishment of vesicle localization, positive regulation of protein phosphorylation, regulation of actin cytoskeleton organization, peptidyl-tyrosine phosphorylation, phosphorylation, positive regulation of stress fiber assembly, regulation of protein localization, spermatogenesis, protein phosphorylation, positive regulation of substrate adhesion-dependent cell spreading, actin cytoskeleton organization, glomerular visceral epithelial cell migration, negative regulation of protein autophosphorylation, negative regulation of phosphorylation, and negative regulation of protein serine/threonine kinase activity. This protein colocalizes with the following component: cytoplasmic vesicle. This protein is active in the following components: cytoplasm, and nucleus. This protein is located in the following components: perinuclear region of cytoplasm, cytoskeleton, cytoplasm, centrosome, microtubule organizing center, lamellipodium, cytoplasmic vesicle, cytosol, and cell projection. This protein enables metal ion binding: metal ion binding. This protein enables nucleotide binding: ATP binding, and nucleotide binding. This protein is part of cytoplasm: cytoplasm. This protein is part of nucleus: nucleus. This protein enables transferase activity: protein serine/threonine/tyrosine kinase activity, protein serine/threonine kinase activity, transferase activity, protein tyrosine kinase activity, kinase activity, and protein kinase activity. This protein is part of cytosol: cytosol. This protein is involved in phosphorylation: phosphorylation, peptidyl-tyrosine phosphorylation, and protein phosphorylation. This protein enables the following functions: protein serine/threonine kinase activity, protein kinase activity, transmembrane receptor protein tyrosine kinase activity, metal ion binding, protein serine/threonine/tyrosine kinase activity, protein binding, protein kinase binding, transferase activity, ATP binding, protein serine kinase activity, protein tyrosine kinase activity, protein threonine kinase activity, kinase activity, protein C-terminus binding, and nucleotide binding.
MESLCGVLVFLLLAAGLPLQAAKRFRDVLGHEQYPDHMRENNQLRGWSSDENEWDEQLYPVWRRGEGRWKDSWEGGRVQAALTSDSPALVGSNITFVVNLVFPRCQKEDANGNIVYERNCRSDLELASDPYVYNWTTGADDEDWEDSTSQGQHLRFPDGKPFPRPHGRKKWNFVYVFHTLGQYFQKLGRCSARVSINTVNLTVGPQVMEVIVFRRHGRAYIPISKVKDVYVITDQIPIFVTMYQKNDRNSSDETFLRDLPIFFDVLIHDPSHFLNYSAISYKWNFGDNTGLFVSNNHTLNHTYVLNGTFNFNLTVQTAVPGPCPSPTPSPSSSTSPSPASSPSPTLSTPSPSLMPTGHKSMELSDISNENCRINRYGYFRATITIVDGILEVNIIQVADVPIPTPQPDNSLMDFIVTCKGATPTEACTIISDPTCQIAQNRVCSPVAVDELCLLSVRRAFNGSGTYCVNFTLGDDASLALTSALISIPGKDLGSPLRTVNGVLISIGCLAMFVTMVTILLYKKHKTYKPIGNCTRNVVKGKGLSVFLSHAKAPFSRGDREKDPLLQDKPWML	This protein is part of the following components: membrane, cytoplasmic vesicle, plasma membrane, early endosome membrane, endosome, integral component of membrane, melanosome membrane, and integral component of plasma membrane. This protein is involved in the following processs: positive regulation of cell migration, regulation of tissue remodeling, signal transduction, negative regulation of neuron death, negative regulation of G1/S transition of mitotic cell cycle, positive regulation of protein phosphorylation, osteoblast differentiation, cell-cell signaling, positive regulation of protein autophosphorylation, negative regulation of T cell proliferation, negative regulation of cytokine production, cell adhesion, positive regulation of ERK1 and ERK2 cascade, bone mineralization, negative regulation of T cell activation, and negative regulation of tumor necrosis factor production. This protein is active in the following component: integral component of plasma membrane. This protein is located in the following components: plasma membrane, integral component of membrane, membrane, cytoplasmic vesicle, endosome, integral component of plasma membrane, melanosome membrane, and early endosome membrane. This protein is involved in signal transduction: signal transduction. This protein is part of membrane: early endosome membrane, membrane, melanosome membrane, and plasma membrane. This protein is part of integral component of membrane: integral component of membrane, and integral component of plasma membrane. This protein enables the following functions: receptor ligand activity, syndecan binding, heparin binding, and integrin binding.
MRRLRRWAIAALLLLPLLPPPGLGALGPRGALHWRSSAHVGSPESPEGSEVTEPSRLVRQSSGGEVRKPQLDTRVRQDPPRGTPVHLAQVSFVIPAFDSNFTLDLELNHHLLSSQYVERHFSREGTRQHSTGAGDHCYYHGKLRGNPQSFAALSTCQGLHGVFSDGNLTYIVEPKEIAGPWGPPQGPLPHLIYRTPLLPAPLGCREPGCLFAVPAQSALPNWPKLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICSLSRGGGVNEYGNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSIDEYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTLTHDAMCSDGLCCRRCKYEPRGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHEQGRCYGGRCKTRDRQCQALWGHAAADRFCYEKLNVEGTERGNCGRKGSGWVQCSKQDVLCGFLLCVNISGAPRLGDLGGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNMLCLDHRCLPASAFNFSTCPGSGERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTSPPTGETERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFKNIRRGRSGGA	This protein is part of the following components: membrane, and integral component of membrane. This protein is involved in the following process: proteolysis. This protein is located in the following components: membrane, and integral component of membrane. This protein enables hydrolase activity: metallopeptidase activity, and metalloendopeptidase activity. This protein is part of membrane: membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is involved in proteolysis: proteolysis. This protein enables the following functions: metallopeptidase activity, protein binding, and metalloendopeptidase activity.
MQELIACVDHIRFDLELAVEQQLGAQPLPFPGMDKSGAAVCEFFLKSACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCIEGPNCKFMHPRFELPMGTTEQPPLPQQTQTQQKQNNNQVLQRSSSLIQLTSQNSPVSQQRSPQTIGVMQSQSGNQGNRGPRPLDQVTCYKCGEKGHYANRCTKGHLAFLSGQ	This protein is part of the following components: nucleus, and mRNA cleavage and polyadenylation specificity factor complex. This protein is involved in the following processs: pre-mRNA cleavage required for polyadenylation, and mRNA processing. This protein is located in the following component: nucleus. This protein is involved in metabolic process: pre-mRNA cleavage required for polyadenylation, and mRNA processing. This protein enables metal ion binding: zinc ion binding, and metal ion binding. This protein enables RNA binding: RNA binding. This protein is part of nucleus: nucleus. This protein enables the following functions: nucleic acid binding, zinc ion binding, metal ion binding, and RNA binding.
MTSILNTVSTIHSSRVTSVDRVGVLSLRNSDSVEFTRRRSGFSTLIYESPGRRFVVRAAETDTDKVKSQTPDKAPAGGSSINQLLGIKGASQETNKWKIRLQLTKPVTWPPLVWGVVCGAAASGNFHWTPEDVAKSILCMMMSGPCLTGYTQTINDWYDRDIDAINEPYRPIPSGAISEPEVITQVWVLLLGGLGIAGILDVWAGHTTPTVFYLALGGSLLSYIYSAPPLKLKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEGDRALGLQSLPVAFGTETAKWICVGAIDITQLSVAGYLLASGKPYYALALVALIIPQIVFQFKYFLKDPVKYDVKYQASAQPFLVLGIFVTALASQH	This protein is part of the following components: chloroplast, chloroplast membrane, integral component of membrane, membrane, plastid, chloroplast thylakoid, and cytosol. This protein is involved in the following process: chlorophyll biosynthetic process. This protein is located in the following components: chloroplast, cytosol, membrane, chloroplast thylakoid, integral component of membrane, chloroplast membrane, and plastid. This protein is involved in metabolic process: chlorophyll biosynthetic process. This protein is part of membrane: membrane, and chloroplast membrane. This protein is part of integral component of membrane: integral component of membrane. This protein enables transferase activity: transferase activity, transferase activity, transferring alkyl or aryl (other than methyl) groups, and chlorophyll synthetase activity. This protein is part of cytosol: cytosol. This protein is part of plastid: chloroplast, and plastid. This protein enables the following functions: transferase activity, transferring alkyl or aryl (other than methyl) groups, transferase activity, and chlorophyll synthetase activity.
MATKNKPNLSVQDVKLLNVNELTPLTPNVISRQATINIGTIGHVAHGKSTVVKAISGVLTVRFTSEFKRNITIKLGYANAKIYKCDNPQCERPGCYKSARSNTEDNPQCERPGCGGRMTLLRHVSFVDCPGHDVLMATMLNGAAVMDAALLLIAGNESCPQPQTSEHIAAIEIMNLKNIIILQNKIDLVKEAAAQEQYGQILKFIQGTIAENAPIIPISAQMKYNIDVICEYIVKKIPIPVRDFTSDPRMIVIRSFDVNKPGSRVDEIKGGVAGGSILKGVLKIGDEIEVRPGVISKELDGKIKCSPIFCRIISLFAEENELQYAVPGGLIGVGTKIDPTLCRADRLVGQVLGSVGKLPEIFVALEVNFFLLRRLLGVKSDGDKQSKVKKLSKEDTLMVNIGSTSTGCRVVAVKHDLAKLQLLTPVCSQEGEKIALSRRVDKNWRLIGWGEIKKGTVLTN	This protein is part of the following components: cytoplasm, eukaryotic translation initiation factor 2 complex, and cytosol. This protein is involved in the following processs: translational initiation, formation of translation preinitiation complex, positive regulation of translational fidelity, and translation. This protein contributes to the following function: tRNA binding. This protein is active in the following component: cytosol. This protein enables hydrolase activity: GTPase activity, and hydrolase activity. This protein is involved in metabolic process: translational initiation. This protein enables nucleotide binding: nucleotide binding, and GTP binding. This protein enables RNA binding: translation initiation factor activity. This protein is part of cytoplasm: cytoplasm. This protein is part of cytosol: cytosol. This protein is involved in translation: translation. This protein enables the following functions: GTPase activity, tRNA binding, translation initiation factor activity, hydrolase activity, GTP binding, and nucleotide binding.
MYEDCVKSTEDYYLFCDNEGPWAIVLESLAVIGIVVTILLLLAFLFLMRKVQDCSQWNVLPTQFLFLLAVLGLFGLTFAFIIQLNHQTAPVRYFLFGVLFAICFSCLLAHASNLVKLVRGRVSFCWTTILFIAIGVSLLQTIIAIEYVTLIMTRGLMFEHMTPYQLNVDFVCLLIYVLFLMALTFFVSKATFCGPCENWKQHGRLIFATVLVSIIIWVVWISMLLRGNPQLQRQPHWDDAVICIGLVTNAWVFLLIYIIPELSILYRSCRQECPTQGNVCQVPVYQRSFRMDTQEPTRARDSDGAQEDVALTAYGTPIQLQSADPSREYLIPSATLSPQQDAGL	This protein is part of the following components: intracellular membrane-bounded organelle, integral component of membrane, extracellular exosome, membrane, plasma membrane, and receptor complex. This protein is involved in the following processs: activation of protein kinase activity, signal transduction, hair cycle, G protein-coupled receptor signaling pathway, and keratinization. This protein acts upstream of or within the following process: G protein-coupled receptor signaling pathway. This protein is active in the following components: plasma membrane, intracellular membrane-bounded organelle, and extracellular exosome. This protein is located in the following components: integral component of membrane, plasma membrane, and membrane. This protein is involved in signal transduction: G protein-coupled receptor signaling pathway, and signal transduction. This protein is part of membrane: plasma membrane, and membrane. This protein is part of integral component of membrane: integral component of membrane. This protein enables the following functions: molecular_function, G protein-coupled receptor activity, and protein kinase activator activity.
MDDFERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLRQKQEEESLGQVTDQVEVNAQNSVPDEEAKTTTTNTQVEGDDEAAFLERLARREERRQKRLQEALERQKEFDPTITDASLSLPSRRMQNDTAENETTEKEEKSESRQERYEIEETETVTKSYQKNDWRDAEENKKEDKEKEEEEEEKPKRGSIGENQVEVMVEEKTTESQEETVVMSLKNGQISSEEPKQEEEREQGSDEISHHEKMEEEDKERAEAERARLEAEERERIKAEQDKKIADERARIEAEEKAAAQERERREAEERERMREEEKRAAEERQRIKEEEKRAAEERQRIKEEEKRAAEERQRIKEEEKRAAEERQRARAEEEEKAKVEEQKRNKQLEEKKHAMQETKIKGEKVEQKIEGKWVNEKKAQEDKLQTAVLKKQGEEKGTKVQAKREKLQEDKPTFKKEEIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV	This protein is part of the following components: membrane, cytoplasm, myofibril, plasma membrane, cytoskeleton, actin cytoskeleton, cytosol, and actin cap. This protein is involved in the following processs: angiogenesis, muscle contraction, and actin filament bundle assembly. This protein is active in the following component: actin cytoskeleton. This protein is located in the following components: plasma membrane, membrane, actin cap, cytoplasm, myofibril, actin cytoskeleton, cytosol, and cytoskeleton. This protein is part of membrane: plasma membrane, and membrane. This protein is part of cytoplasm: cytoplasm. This protein is part of cytosol: cytosol. This protein enables the following functions: protein binding, calmodulin binding, actin binding, cadherin binding, tropomyosin binding, and myosin binding.
MNSNEDIHEERIEVPRTPHQTQPEKDSDRIALRDEISVPEGDEKAYSDEKVEMATTNASSNFGSNESAKDGESIGAFSNPHEALMQSKLREESQSKTILPSDDLSQQLETEESKVEEALKRITSPPLPPRADCIEESASALKSSLPPVLAGNKNDQAPLDRPQLPPRQVVNAETLHLKAPHGNATPSKSPTSAVGNSSSSTPPTLPPRRIEDPLDLAAQKHFLASTFKRNMLFYKSEDNSIKCDLDKNILNLKEDSKKINNNEIPEEVSSFWLKVIGDYQNILINDIETLHFQLSRGIPAAYRLVVWQLVSYAKSKSFDPIYETYLTEMAPFDVQEFENQLKMMDEVPSEYVKRISNVLKAYLLFDPECEFSTDIAYIINMILDVCEEEANAFGLLVRLMKVYGLRLLFLPSASEIDILCYKFDRLVEEFYPEIHNHMVEKGVRSSMFLPGFFTTLFQKKLPTEIQPRIGDMVFLEGIDSIMRILATLLSNSRDHLLKMGFDDMLELLKSGLLDAYIKQNDGTRGDTLLSNECMDKLLQDSMMKVAITPKTMKKYSSEYEEIHRLDNEKEVQYKSITEKNLHLQKHVRKLENDYTSLNREHVTIANELVKNRLNIESVLNENNGYKLQILDLKKKLDSEKKKQVLGVYVPNDLKKDLEETMKKNTQVMDENLKLQDRISELERLIEEIKTANKNGTLFEYSNSKNNPLGAGWSGFKKVFK	This protein is part of the following components: incipient cellular bud site, cytoplasm, cellular bud neck, plasma membrane, mitochondrion, Golgi-associated vesicle, cellular bud tip, and cellular bud. This protein is involved in the following processs: regulation of catalytic activity, activation of GTPase activity, positive regulation of GTPase activity, exocytosis, vesicle-mediated transport, endoplasmic reticulum to Golgi vesicle-mediated transport, protein transport, and regulation of exocytosis. This protein is located in the following components: plasma membrane, cellular bud tip, Golgi-associated vesicle, cytoplasm, mitochondrion, cellular bud neck, and cellular bud. This protein is part of membrane: plasma membrane. This protein is part of mitochondrion: mitochondrion. This protein is part of cytoplasm: cytoplasm. This protein is involved in protein transport: intracellular protein transport, and protein transport. This protein enables the following functions: protein binding, small GTPase binding, and GTPase activator activity.
MAQWPEKEEEEQPMFGEEYTGYIPSYLEKDEPCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYDCCCIIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRRLIEENRERRKKEEIVKTLQNRPEPTGAEWELIRMVTEAHRHTNAQGAQWKQKRKFLPDKIGQSPVAPTSDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSEQLPCEDQIILLKGCCMEIMSLRAAMRYDPESETLTLSGEMAVKREQLKNGGLGVVSDAIFDLGKSLAQFNLDDTEVALLQAVLLMSSDRSGLTCMDKIEKCQETYLLAFEHYINYRKHNIPHFWPKLLMKVTDLRMIGACHASRFLHMKVECPNELFPPLFLEVFEDQEV	This protein is part of the following components: nucleus, and host cell nucleus. This protein is involved in the following processs: regulation of transcription, DNA-templated, and intracellular receptor signaling pathway. This protein is located in the following component: nucleus. This protein is involved in signal transduction: intracellular receptor signaling pathway, and steroid hormone mediated signaling pathway. This protein enables metal ion binding: zinc ion binding, and metal ion binding. This protein enables DNA binding: sequence-specific DNA binding, and DNA binding. This protein is part of nucleus: nucleus. This protein is involved in regulation of transcription, DNA-templated: regulation of transcription, DNA-templated. This protein enables the following functions: DNA-binding transcription factor activity, metal ion binding, DNA binding, sequence-specific DNA binding, nuclear receptor activity, zinc ion binding, and steroid hormone receptor activity.
MAASRAPRRRLEDLSVDEFLASGFESGSESELEGAAEERRARGAAWNRERRGARTSPGPAGRLRKGRASEHKDQLSRLKDRDPEFYKFLQENDRSLLDFSDSDSSAEEEEPFHSLPDTLEEASETEEDGGEDSDALPRGLRSKKNEPVPVTLAMVERWRQGSRHHLTPRLFHEVVQAFRAAVATTQGEQEAAETCRFQVADSAVFNALVTFCIRDLCGCLQKLLFGKTPKDSNRLLLPSSSPLWGKLRVDVKSYLSAVVQLAACLAEATVSAAVLQHISSLVPYFLTFPKQCRMLLKRMVVLWSTGEESLRVLAFLVLIRVCRHKKEAFLGPILKQMYIMYVRNCKFTSPSTLPLISFMQRTLTEMLALDPSVSYQHAFLYIRQLAVHLRNAMTTGKKETHQSVYNWQYVHCLYLWCRVLSTLGSSEILQPLLYPLSQIIIGCIKLLPTARFYPLRMHCVRALTLLSQTIGTFIPVLPFILEIFQQVDFNRRPGRMSSKPINFSVILKLSSTNLQEKAYRDGLLEQLCDLILEYLHSQAHSIAFPELVLPTVLQLKSFLRECKVANYCRQVRQLLEKVQENARHIESLRQSATFSVSDRTAVDAWEKQVREEGTPLTRYYGHWKKLRDREIQLEISGKERLEDLNFPEIKRRKVEDRKDEDRKELKDLFELDSSEGEDSTDFFERGVPRLPEAHQGLKEDQEEEDKEEGDSDSEDGDTDTGVDLSELWQLAQGAQDELEDLQLSEED	This protein is part of the following components: nucleoplasm, nucleolus, cytosol, Noc2p-Noc3p complex, Noc1p-Noc2p complex, and nucleus. This protein is involved in the following processs: ribosomal large subunit biogenesis, negative regulation of transcription by RNA polymerase II, apoptotic process, negative regulation of intrinsic apoptotic signaling pathway, negative regulation of histone acetylation, negative regulation of B cell apoptotic process, chromatin assembly, and cellular response to UV. This protein acts upstream of or within the following processs: cellular response to UV, negative regulation of transcription by RNA polymerase II, negative regulation of histone acetylation, negative regulation of intrinsic apoptotic signaling pathway, negative regulation of B cell apoptotic process, and chromatin assembly. This protein is active in the following components: nucleoplasm, and nucleolus. This protein is located in the following components: nucleoplasm, cytosol, chromosome, nucleolus, and nucleus. This protein is part of nucleus: nucleus. This protein is part of cytosol: cytosol. This protein is involved in regulation of transcription, DNA-templated: negative regulation of transcription by RNA polymerase II. This protein enables the following functions: DNA-binding transcription factor binding, DNA-binding transcription factor binding, nucleosome binding, p53 binding, histone binding, chromatin binding, nucleosomal histone binding, and transcription corepressor activity.
MVKSLQLAHQLKDKKILLIGGGEVGLTRLYKLIPTGCKLTLVSPDLHKSIIPKFGKFIQNEDQPDYREDAKRFINPNWDPTKNEIYEYIRSDFKDEYLDLEDENDAWYIIMTCIPDHPESARIYHLCKERFGKQQLVNVADKPDLCDFYFGANLEIGDRLQILISTNGLSPRFGALVRDEIRNLFTQMGDLALEDAVVKLGELRRGIRLLAPDDKDVKYRMDWARRCTDLFGIQHCHNIDVKRLLDLFKVMFQEQNCSLQFPPRERLLSEYCSS	This protein is part of the following component: cellular_component. This protein is involved in the following processs: cellular amino acid biosynthetic process, porphyrin-containing compound biosynthetic process, sulfate assimilation, siroheme biosynthetic process, methionine biosynthetic process, and metabolic process. This protein is active in the following component: cellular_component. This protein is involved in metabolic process: metabolic process, siroheme biosynthetic process, sulfate assimilation, and porphyrin-containing compound biosynthetic process. This protein enables catalytic activity: oxidoreductase activity, sirohydrochlorin ferrochelatase activity, precorrin-2 dehydrogenase activity, lyase activity, ferrochelatase activity, and catalytic activity. This protein is involved in cellular amino acid biosynthetic process: cellular amino acid biosynthetic process, and methionine biosynthetic process. This protein enables the following functions: catalytic activity, lyase activity, ferrochelatase activity, oxidoreductase activity, precorrin-2 dehydrogenase activity, and sirohydrochlorin ferrochelatase activity.
MKIRHWSALSLFVLPALAQAEALTGEVHRQPLNIQAIVMFLLFVGGTLYITYWASKRTRSRQDYYTAGGRITGFQNGLAIAGDYMSAASFLGISALVYASGYDGLIYSIGFLIGWPIILFLIAERLRNLGRYTFADVASYRLQQRPIRTLSACGSLVVVALYLIAQMVGAGKLIQLLFGLNYHVAVVLVGILMVLYVLFGGMLATTWVQIIKAVMLLSGATFMAIMVMKSVNFNFNTLFSEAVKVHPKGLSIMSPGGLVSDPISALSLGLALMFGTAGLPHILMRFFTVSDAKEARKSVFYATGFIGYFYILTFIIGFGAILLVGPNQTFKDAAGALLGGNNMAAVHLANAVGGSFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYASVIKKGKANERDELRVSKITVIILGIVAIGLGILFEKQNIAFMVGLAFSIAASCNFPIIIISMYWDKLTTRGAMIGGWLGLSTAVILMILGPTIWVTILGHEKPIYPYEYPALFSMIAAFVGTWFFSITDNSETGKQERLLFKSQFVRSQTGLGASKGGAH	This protein is part of the following components: integral component of membrane, integral component of plasma membrane, membrane, and plasma membrane. This protein is involved in the following processs: transmembrane transport, sodium ion transport, ion transport, acetate transmembrane transport, and glycolate transmembrane transport. This protein is located in the following components: integral component of plasma membrane, membrane, plasma membrane, and integral component of membrane. This protein is part of membrane: plasma membrane, and membrane. This protein is part of integral component of membrane: integral component of plasma membrane, and integral component of membrane. This protein is involved in transmembrane transport: transmembrane transport. This protein is involved in cation transport: acetate transmembrane transport, ion transport, glycolate transmembrane transport, and sodium ion transport. This protein enables the following functions: symporter activity, transmembrane transporter activity, glycolate transmembrane transporter activity, and acetate transmembrane transporter activity.
MRPEPGGCCCRRPMRANGCVKNGEVRNGYLRSSTATIAAAGQIHHITENGGLYKRPFNEAFEETPMLVAVLTYVGYGVLTLFGYLRDFLRHWRIEKCHHATEREEQKDFVSLYQDFENFYTRNLYMRIRDNWNRPICSVPGAKVDIMERQSHDYNWSFKYTGNIIKGVINMGSYNYLGFARNTGSCQEAAAEVLKTYGAGVCSTRQEIGNLDKHEELEKLVARFLGVEAALTYGMGFATNSMNIPALVGKGCLILSDELNHASLVLGARLSGATIRIFKHNNMQSLEKLLKDAIVYGQPRTRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPSGRGVVDYFGLDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSMSPPVMEQIITSMKCIMGQDGTSLGKECIQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRHRPLPLLDRPFDETTYEETED	This protein is part of the following components: membrane, endoplasmic reticulum, serine C-palmitoyltransferase complex, cytoplasm, integral component of membrane, and endoplasmic reticulum membrane. This protein is involved in the following processs: sphingolipid biosynthetic process, sphingolipid metabolic process, sphingosine biosynthetic process, sphingomyelin biosynthetic process, sphinganine biosynthetic process, biosynthetic process, ceramide biosynthetic process, positive regulation of lipophagy, adipose tissue development, and lipid metabolic process. This protein contributes to the following function: serine C-palmitoyltransferase activity. This protein is located in the following components: integral component of membrane, endoplasmic reticulum membrane, endoplasmic reticulum, and membrane. This protein is involved in metabolic process: biosynthetic process. This protein enables catalytic activity: catalytic activity. This protein is part of membrane: endoplasmic reticulum membrane, and membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is part of cytoplasm: cytoplasm. This protein enables transferase activity: transferase activity, serine C-palmitoyltransferase activity, and acyltransferase activity. This protein is involved in lipid metabolic process: ceramide biosynthetic process, lipid metabolic process, sphinganine biosynthetic process, sphingolipid metabolic process, sphingolipid biosynthetic process, sphingosine biosynthetic process, and sphingomyelin biosynthetic process. This protein enables the following functions: transferase activity, serine C-palmitoyltransferase activity, catalytic activity, pyridoxal phosphate binding, and acyltransferase activity.
MKLNKLFDSKTVVFKKSDKYGKSDCCKTKCVEGQIEFGVKIPTDFPAFNRALVTFLKTQKNQLNVDLDSFVELYKAENLCYKTALKVVVASITFCETTPFTMKTEPQKNVEVAVKCDSEHTSLIKEYEVVGNYVNMARQLQDTPSDQLYPEEFVKRFEKAATGLGVKITVLKQADLIKKKMGLLLGVNKGSEREARLLVISYNNNKKSSETLALVGKGITYDSGGMNIKTGDYMRGMKYDMSGAAIVCSTVLALAKNKVKTNVVAVAALTENLPGPHAQRPDDIQTAYNGKTVEIDNTDAEGRLVLADAISYAAKDLKATQIIDVATLTGLMSYILSTTYTGIFSTCDMAWDAFKKAACCAGEPVWRLPMHPDYLKPLESKLADLQNSTSVKGAGSSRAACFLAEFREGVPLIHCDIASTASIQDLGQGVLVRTLYERAAQQAKE	This protein is part of the following component: cytoplasm. This protein is involved in the following processs: proteolysis, and protein metabolic process. This protein is located in the following component: cytoplasm. This protein enables hydrolase activity: metalloexopeptidase activity, hydrolase activity, peptidase activity, and aminopeptidase activity. This protein is involved in metabolic process: protein metabolic process. This protein enables metal ion binding: manganese ion binding, and metal ion binding. This protein is part of cytoplasm: cytoplasm. This protein is involved in proteolysis: proteolysis. This protein enables the following functions: metalloexopeptidase activity, peptidase activity, hydrolase activity, aminopeptidase activity, metal ion binding, manganese ion binding, and metalloaminopeptidase activity.
MHLLLAAAFGLLLLLPPPGAVASRKPTMCQRCRTLVDKFNQGMANTARKNFGGGNTAWEEKTLSKYEFSEIRLLEIMEGLCDSSDFECNQLLEQQEEQLEAWWQTLKKEHPNLFEWFCVHTLKACCLPGTYGPDCQECQGGSERPCSGNGYCSGDGSRQGDGSCQCHTGYKGPLCIDCTDGFFSLQRNETHSICSACDESCKTCSGPSNKDCIQCEVGWARVEDACVDVDECAAETSPCSDGQYCENVNGSYTCEDCDSTCVGCTGKGPANCKECIAGYTKESGQCTDIDECSLEEKACKRKNENCYNVPGSFVCVCPEGFEETEDACVQTAEGKVTEENPTQPPSREDL	This protein is part of the following components: extracellular space, endoplasmic reticulum, and Golgi apparatus. This protein is involved in the following process: biological_process. This protein acts upstream of or within the following process: biological_process. This protein is located in the following components: Golgi apparatus, extracellular space, and endoplasmic reticulum. This protein enables metal ion binding: calcium ion binding. This protein enables catalytic activity: protein disulfide isomerase activity, and isomerase activity. This protein enables the following functions: protein disulfide isomerase activity, extracellular matrix structural constituent, isomerase activity, and calcium ion binding.
SLRKMHALGET	This protein is part of the following components: extracellular space, and extracellular region. This protein is involved in the following process: proteolysis. This protein is located in the following components: extracellular region, and extracellular space. This protein enables hydrolase activity: peptidase activity, hydrolase activity, and aspartic-type endopeptidase activity. This protein is part of extracellular region: extracellular region. This protein is involved in proteolysis: proteolysis. This protein enables the following functions: hydrolase activity, aspartic-type endopeptidase activity, and peptidase activity.
MGVPAFFRWLSRKYPSVIIECNENKQVDADTGRNIYEDPTLPNPNGIEFDNLYLDMNGIIHPCTHPEDKPAPKNEDEMMVAIFECIDRLFGIVRPRKLLYMAIDGVAPRAKMNQQRSRRFRAAKETTEKRLEIARIREELLSRGCKLPPEKEKGEHFDSNCITPGTPFMDRLSKCLHYFVHDRQNNNPAWKGIKVILSDANVPGEGEHKIMDYIRKQRAQPDHDPNTQHVLCGADADLIMLGLATHEPNFTIIREEFLPNKPRPCDICNGFGHEMDKCVGLGATAPTSANFKPDVPIGAEVKFIFVRLSVLREYLKQTLEMPNLPFEYSFERALDDWVFMCFFVGNDFLPHLPSLEIREGAVDRLVELYKKCVYKTRGYLTDSGDVNLDRVQLIMTDLGNAEDQIFKSRQRREEQFKARDKARKRQERNQDHGSLNQSAFGASAVGPNSQQRSVGNYKEEAAALRNRKRTSDMANLDDEDEEENNDEVRLWEDGFKDRYYESKFDVAPGNQQFRYAVALQYVRGLCWVLKYYYQGCASWNWYFPYHYAPFASDFVNIQGLSTMFEKGTKPFNPLEQLMGVFPAASSSHVPEPWAKLMSDPESPIIDFYPEDFKIDLNGKKFAWQGVALLPFVDEKRLFKALVPYYDQLTGEEVKRNKRGDNYLYISNQSPHYKKVKKISEKDDESVCKAISFDGMRGTLGKTELNTAISGVLKSPISGLSDINDNITVTTTFRDPEYDEDYIFEAKRLENAVDPPQVLPNEQSGNKHRPVIGFNSHLTRAYVPDSGHRMLNAGIRNQQGGGGNGGGGGGYGQGGGYGQGIGGNQGQSYQNNSRNYNYNYNNNYNQHQGGGYQNNYNNRQQQQYGHNQRFNQDNSNQQQRNFNNYNGPRNNNYQQQGGSRQQNQNYRRF	This protein is part of the following component: nucleus. This protein is involved in the following processs: DNA-templated transcription, termination, mRNA processing, nuclear-transcribed mRNA catabolic process, DNA catabolic process, exonucleolytic, RNA phosphodiester bond hydrolysis, exonucleolytic, and nucleobase-containing compound metabolic process. This protein is active in the following component: nucleus. This protein is located in the following component: nucleus. This protein enables hydrolase activity: hydrolase activity, exonuclease activity, 5'-3' exoribonuclease activity, nuclease activity, and 5'-3' exonuclease activity. This protein is involved in metabolic process: nuclear-transcribed mRNA catabolic process, DNA-templated transcription, termination, DNA catabolic process, exonucleolytic, mRNA processing, RNA phosphodiester bond hydrolysis, exonucleolytic, and nucleobase-containing compound metabolic process. This protein enables metal ion binding: metal ion binding. This protein enables RNA binding: RNA binding. This protein is part of nucleus: nucleus. This protein enables the following functions: 5'-3' exoribonuclease activity, 5'-3' exonuclease activity, nucleic acid binding, RNA binding, nuclease activity, metal ion binding, exonuclease activity, and hydrolase activity.
MSVVSQVILQADDQLRYPTSGELKGIQAFLTTGAQRIRIAETLAENEKKIVDQAQKQLFKKHPEYRAPGGNAYGQRQYNQCLRDYGWYLRLVTYGVLAGNKEPIETTGLIGVKEMYNSLNVPVPGMVDAVTVLKDAALGLLSAEDANETAPYFDYIIQFMS	This protein is part of the following components: thylakoid membrane, membrane, light-harvesting complex, thylakoid, and phycobilisome. This protein is involved in the following processs: photosynthesis, and protein-chromophore linkage. This protein is located in the following components: plasma membrane-derived thylakoid membrane, thylakoid, and membrane. This protein is involved in metabolic process: photosynthesis, and protein-chromophore linkage. This protein is part of membrane: thylakoid membrane, and membrane.
MSEGSEDTKTKLDSAGELSDVDNENCSSSGSGGGSSSGDTKRTCVDCGTIRTPLWRGGPAGPKSLCNACGIKSRKKRQAALGMRSEEKKKNRKSNCNNDLNLDHRNAKKYKINIVDDGKIDIDDDPKICNNKRSSSSSSNKGVSKFLDLGFKVPVMKRSAVEKKRLWRKLGEEERAAVLLMALSCSSVYA	This protein is part of the following component: nucleus. This protein is involved in the following processs: cell differentiation, and regulation of transcription, DNA-templated. This protein is active in the following component: nucleus. This protein is located in the following component: nucleus. This protein enables metal ion binding: zinc ion binding, and metal ion binding. This protein enables DNA binding: sequence-specific DNA binding, and DNA binding. This protein is part of nucleus: nucleus. This protein is involved in regulation of transcription, DNA-templated: regulation of transcription, DNA-templated. This protein enables the following functions: transcription cis-regulatory region binding, metal ion binding, DNA-binding transcription factor activity, sequence-specific DNA binding, zinc ion binding, transcription cis-regulatory region binding, and DNA binding.
MSDIALTVSVLALVAVVGLWIGNIKVRGVGFGIGGVLFGGIIVGHFVDQAGVTLSGDMLHFIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIMGGLVTAILHKIFAIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPVDLVDQMGMSYAMAYPFGICGILLTMWLMRLIFRVNVEAEAQKHESSLANGHSLIQTMNIRVENPNLNNMAIQDVPILNSDKIICSRLKRDDTLMVPSPGTIIQAGDLLHLVGQPTDLHNAQLVIGKEVDTSLSTRGTDLRVERVVVTNEKVLGKRIRDLHFKERYDVVISRLNRAGVELVASSDASLQFGDILNLVGRPASIDAVANVVGNAQQKLQQVQMLPVFIGIGLGVLLGSIPLFVPGFPVALKLGLAGGPLIMALILGRIGSIGKLYWFMPPSANLALRELGIVLFLAVVGLKSGGDFVDTLTQGEGLSWIGYGIFITAIPLITVGLLARIFAKMNYLTLCGMLAGSMTDPPALAFANNLHATSGAAALSYATVYPLVMFLRIITPQLLAVIFWGMG	This protein is part of the following components: membrane, integral component of membrane, and plasma membrane. This protein is involved in the following processs: potassium ion transport, cation transmembrane transport, and transmembrane transport. This protein is located in the following components: integral component of membrane, plasma membrane, and membrane. This protein is part of membrane: plasma membrane, and membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is involved in transmembrane transport: transmembrane transport. This protein is involved in cation transport: potassium ion transport, and cation transmembrane transport. This protein enables the following functions: transmembrane transporter activity, and cation transmembrane transporter activity.
MLHLFSYSDLNHSLLVFLALFFVLFYEAINGFHDTANAVSTLIYTRAMSAHVAVIMSGIFNFLGVLLGGLTVAYTIVHLLPNDLLLNATSKNALAMVFSMLLAAIIWNLSTWYFCLPASSSHSLIGAIIGIGLTNAFVTDSSLVDAFNIPKMTSVFLSLVFSPIIGLIIAGSLIFLLRYYLNNNKIFYRIHMTPLERKEKDGKKIPPFLIRMALILSSIGVSYAHGANDGQKGIGLIMLVLIGIVPSSFLVNLNTNKYEINCTKHTLNHLEKYFLEKNIKKSNIIKNKEEINNLVVRSQSYNSIKNIKNTKLLLKNISNYNDLSIKKRFQLRHYLLCISDSIDKKVNSSDICSKDKRFLIHSKKVILKTIEYAPMWIILIVALSLSIGTMIGWKRIVVTIGEKIGKKRMTYAQAMSAQITASFSIGIASYTGIPVSTTHILSSSVAGTMLIDGDGIQTKTIKNIALAWILTLPVSMLLSSFLYWIALFLI	This protein is part of the following components: membrane, plasma membrane, and integral component of membrane. This protein is involved in the following processs: transmembrane transport, and phosphate ion transport. This protein is located in the following components: membrane, plasma membrane, and integral component of membrane. This protein is part of membrane: membrane, and plasma membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is involved in transmembrane transport: transmembrane transport. This protein is involved in cation transport: phosphate ion transport. This protein enables the following function: inorganic phosphate transmembrane transporter activity.
MSDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVVAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAITLGADYVATGHYARVARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLEKPEVRRLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLPAQPGRMMTVDGRDMGEHAGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQVHFTREMPEEFTLECTAKFRYRQPDSKVTVHVKGEKTEVIFAEPQRAITPGQAVVFYDGEECLGGGLIDNAYRDGQVCQYI	This protein is part of the following component: cytoplasm. This protein is involved in the following processs: tRNA processing, and tRNA modification. This protein is located in the following component: cytoplasm. This protein enables nucleotide binding: nucleotide binding, and ATP binding. This protein enables RNA binding: RNA binding, and tRNA binding. This protein is part of cytoplasm: cytoplasm. This protein enables transferase activity: sulfurtransferase activity, and transferase activity. This protein is not involved in tRNA processing: tRNA processing, and tRNA modification. This protein enables the following functions: tRNA binding, RNA binding, nucleotide binding, sulfurtransferase activity, ATP binding, and transferase activity.
MKTFLLLLLVLLELGQAPGALHRVPLSRRESLRKKLRAQGQLTELWKSQNLNMDQCSTIQSANEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACQTHPVFHPSLSSTYREVGNSFSIQYGTGSLTGIIGADQVSVEGLTVVGQQFGESVQEPGKTFVHAEFDGILGLGYPSLAAGGVTPVFDNMMAQNLVALPMFSVYMSSNPGGSGSELTFGGYDPSHFSGSLNWVPVTKQAYWQIALDGIQVGDSVMFCSEGCQAIVDTGTSLITGPPGKIKQLQEALGATYVDEGYSVQCANLNMMLDVTFIINGVPYTLNPTAYTLLDFVDGMQVCSTGFEGLEIQPPAGPLWILGDVFIRQFYAVFDRGNNRVGLAPAVP	This protein is part of the following component: endosome. This protein is involved in the following processs: proteolysis, protein autoprocessing, and antigen processing and presentation of exogenous peptide antigen via MHC class II. This protein is located in the following component: endosome. This protein enables hydrolase activity: hydrolase activity, peptidase activity, and aspartic-type endopeptidase activity. This protein is involved in proteolysis: proteolysis, and protein autoprocessing. This protein enables the following functions: aspartic-type endopeptidase activity, hydrolase activity, identical protein binding, and peptidase activity.
MIIYKDILTGDEIISDAFNLKEVDNILWEVDCRNITIGDENIQLEGANPSAEGEDDDAGGAGNAEQVLDIKHNFRLNDYPKLEKDEYKKAIKGYMKKVLAKLEEKKAPEETIKEFKENAQTALKRILANYKDYDVLVGESFGADAMHILINYREDGVTPYATFWKHGLEEYKV	This protein is part of the following components: cytoskeleton, microtubule, and cytoplasm. This protein is involved in the following process: translation. This protein is located in the following components: microtubule, cytoplasm, and cytoskeleton. This protein is part of cytoplasm: cytoplasm. This protein is involved in translation: translation. This protein enables the following function: molecular_function.
MIVSQYLSALTFVLLLFKESRTWSYHASTEMMTFEEARDYCQKTYTALVAIQNQEEIEYLNSTFSYSPSYYWIGIRKINGTWTWIGTNKSLTKEATNWAPGEPNNKQSDEDCVEIYIKREKDSGKWNDEKCTKQKLALCYKAACNPTPCGSHGECVETINNYTCQCHPGFKGLKCEQVVTCPAQKHPEHGHLVCNPLGKFTYNSSCSISCAEGYLPSSTEATRCMSSGEWSTPLPKCNVVKCDALSNLDNGVVNCSPNHGSLPWNTTCTFECQEGYKLTGPQHLQCTSSGIWDNKQPTCKAVSCAAISHPQNGTVNCSHSVVGDFAFKSSCHFTCAEGFTLQGPTQVECTAQGQWTQRVPVCEVVRCSRLDVSGKLNMNCSGEPVLGTECTFACPERWTLNGSVVLTCGATGHWSGMLPTCEAPTVSQTPLAVGLSTAGVSLVTIPSFLFWLLKRLQKKAKKFSPASSCSSLKSNGCYSTPSKLI	This protein is part of the following components: caveola, integral component of plasma membrane, clathrin-coated pit, extracellular space, plasma membrane, integral component of membrane, membrane raft, cortical cytoskeleton, membrane, and perinuclear region of cytoplasm. This protein is involved in the following processs: response to cytokine, actin filament-based process, leukocyte tethering or rolling, cell adhesion, activation of phospholipase C activity, leukocyte cell-cell adhesion, response to interleukin-1, positive regulation of receptor internalization, heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules, and positive regulation of leukocyte tethering or rolling. This protein is active in the following components: external side of plasma membrane, and extracellular space. This protein is located in the following components: integral component of plasma membrane, perinuclear region of cytoplasm, caveola, cortical cytoskeleton, extracellular space, membrane, integral component of membrane, membrane raft, plasma membrane, and clathrin-coated pit. This protein enables metal ion binding: metal ion binding, and calcium ion binding. This protein is part of membrane: clathrin-coated pit, membrane raft, plasma membrane, membrane, and caveola. This protein is part of integral component of membrane: integral component of membrane, and integral component of plasma membrane. This protein enables the following functions: phospholipase binding, calcium ion binding, metal ion binding, sialic acid binding, carbohydrate binding, transmembrane signaling receptor activity, and oligosaccharide binding.
MSAGLETFALKEEDAIKLLACQTHVGAANCDFQMEQYVWKRRADGIHIIHLRKTWEKLLLAARAIAAIDNPGDVCVVSARPYAQRALLKFAAHTGSTPIFGRFTPGCLTNQIQKQFKEPRLLIVSDPRVDHQAVTEASYVGVPVISFCNTDSPLKFIDIAIPCNNKGVQSIGLMWWLLAREVLLIKGKMTRQTGFVLDDKEIMPDLYFYRNPEEQEKEELAEPREVKEPWPGVPPPEVAKIDEVVRSIGMYQTIGGVEPAKKLDFSMVEPVSDWAQETERAVQLDAAQQQEWGASTQNSNW	This protein is part of the following components: ribosome, cytosolic small ribosomal subunit, cytoplasm, and small ribosomal subunit. This protein is involved in the following processs: ribosomal small subunit assembly, and translation. This protein is located in the following components: ribosome, and cytoplasm. This protein is part of cytoplasm: cytoplasm. This protein is involved in translation: translation. This protein enables structural constituent of ribosome: structural constituent of ribosome. This protein is part of ribosome: ribosome. This protein enables the following function: structural constituent of ribosome.
MKSYEIALIGNPNVGKSTIFNALTGENVYIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSLTANSIDEIIARDYIINEKPDLVVNIVDATALERNLYLTLQLMEMGANLLLALNKMDLAKSLGIEIDVDKLEKILGVKVVPLSAAKKMGIEDLKKAISIAVKDKKTAEIKYPNFEPYIKKITSILQKDEDLKKYNLRYLAIKLLENDKYVEEIVKNSKVWNELKPVLDSIINELSKKYGEAELGIVEERYKVIDKIVKEVMKKTSGKLTTTEMLDDVLTDEKIGTLLIIPFLWMLFKFTFDVSKPFSAMIEYFFGFLSEVVKSSISNKFIASLLADGIISGVGAVLVFFPILAFLFFAISFLEDSGYMARIPFITDRIMNKFGLPGKAVISMVMGFGCNVPAIMATRTIEDEKDRILTILINPLLSCSARLPIYALFAGALFSKYQGVVILSMYALGVVLALITAFLFRKLIFKTSPSYLIVELPPYHIPHLNVVLKNTWERVYDFLRKAGTIIVFGVILVWVLSVYGPSGYLGEEVFENPQLIANSWVAVIGKTLAPLFSPMGWDWRACSALVFGIIAKEVVVGSLAMLYGTGEENLSSVIAHAFSPVSAYAFMAFSLIYLPCIATLAVIKQEIGWKWALFAVTYEMILAYVVALVISVIGNLLF	This protein is part of the following components: membrane, plasma membrane, and integral component of membrane. This protein is involved in the following processs: iron ion transmembrane transport, ion transport, iron ion transport, iron ion homeostasis, and inorganic cation transmembrane transport. This protein is active in the following component: plasma membrane. This protein is located in the following components: membrane, integral component of membrane, and plasma membrane. This protein enables metal ion binding: metal ion binding. This protein enables nucleotide binding: nucleotide binding, and GTP binding. This protein is part of membrane: membrane, and plasma membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is involved in cation transport: ion transport, iron ion transport, and iron ion transmembrane transport. This protein enables the following functions: nucleotide binding, ferrous iron transmembrane transporter activity, metal ion binding, and GTP binding.
MGLVDGYDTSSDSDLNFDEGKSVHEKKNGNLHEDTSYEPSSNNIHKRKSHFTKSELKRRRKTRKGDGPWGSWSSSDDETSQASETQKEDQDIFVHALAEDNLDSEQIEVEEVSHFYGKSEKDYQGRGYLYPPNDVDVDLREERISFRCYLPKKVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRFTEDCQSFLSSSFDRSVKIWDTETGKVKTRLHLNSTPADVESRPTNPHEFIVGLSNSKILHYDDRVSENQGLVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWENQINVPIKQISDTAQHSMPFLNVHPSQNYFCAQSMDNRIYSFSLKPKYKRHPKKIFKGHSSAGYGISLAFSGDGRYICSGDSKSRLFTWDWNTSRLLNNIKIPGNKPITQVDWHPQETSKVICSGAAGKIYVCD	This protein is part of the following components: spliceosomal complex, nucleus, nuclear periphery, and catalytic step 2 spliceosome. This protein is involved in the following processs: mRNA branch site recognition, mRNA 3'-splice site recognition, RNA splicing, mRNA splicing, via spliceosome, generation of catalytic spliceosome for second transesterification step, and mRNA processing. This protein contributes to the following function: second spliceosomal transesterification activity. This protein is located in the following components: nuclear periphery, and nucleus. This protein is involved in metabolic process: RNA splicing, mRNA processing, and mRNA splicing, via spliceosome. This protein enables catalytic activity: second spliceosomal transesterification activity. This protein is part of nucleus: nucleus. This protein enables the following function: protein binding.
MSRRLLPRAEKRRRRLEQRQQPDEQRRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGHRRGPSRYGPQYGHPPPPPPPPEYGPHADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQSYGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAPLEVTEENFFEICDELGVKRPSSVKVFSGKSERSSSGLLEWESKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQHAS	This protein is part of the following components: membrane, ribonucleoprotein complex, nucleus, pronucleus, extracellular exosome, ribonucleoprotein granule, perinuclear region of cytoplasm, nucleoplasm, and cytoplasm. This protein is involved in the following processs: mRNA splicing, via spliceosome, regulation of translation, regulation of alternative mRNA splicing, via spliceosome, positive regulation of translation, circadian rhythm, mRNA processing, regulation of RNA splicing, negative regulation of mRNA splicing, via spliceosome, RNA metabolic process, positive regulation of mRNA binding, cellular response to amino acid starvation, response to peptide, and RNA processing. This protein is active in the following component: nucleus. This protein is located in the following components: extracellular exosome, nucleoplasm, ribonucleoprotein granule, nucleus, membrane, and cytoplasm. This protein is involved in metabolic process: mRNA processing, mRNA splicing, via spliceosome, RNA processing, and RNA metabolic process. This protein is part of membrane: membrane. This protein enables RNA binding: mRNA binding, mRNA 3'-UTR binding, mRNA CDS binding, RNA binding, and pre-mRNA intronic binding. This protein is part of cytoplasm: cytoplasm. This protein is part of nucleus: pronucleus, and nucleus. This protein is part of cytosol: cytosol. This protein enables the following functions: transcription cis-regulatory region binding, RNA binding, transcription cis-regulatory region binding, pre-mRNA intronic binding, protein binding, nucleic acid binding, and mRNA binding.
MDLVRGLWRKHRRKILVTTTCLGSGYLLYKLYNAHTRKLADLERELANERENDEIIKTQMKAHFDNIQMIADTTTLPHAIHHLSSRVVEEIDVSSIMDKLSKGKGILIPSEKLQLWNELKILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYIDTARGLGSSHLLDELDLIERDDEQKFLTSADFLATSGMPSLISNMQNAVKEVLKGKQLKDVLTTSALRETVMRILDVFMSTGSPHHWVDYLMMSQDATTDVSSSDATVTKFHLLITETREVLTSNDFSNVAEISLKCCAVALVEEMETQTGLATGMQLAKLLPQIEKTMPEISAEPEKNRFLQLIRDLPEVKLFFTLLYANMPQ	This protein is part of the following components: peroxisome, membrane, integral component of peroxisomal membrane, integral component of membrane, and peroxisomal membrane. This protein is involved in the following processs: protein import into peroxisome membrane, peroxisome organization, and protein transport. This protein is active in the following component: integral component of peroxisomal membrane. This protein is located in the following components: peroxisomal membrane, integral component of peroxisomal membrane, integral component of membrane, membrane, and peroxisome. This protein is part of membrane: membrane, and peroxisomal membrane. This protein is part of integral component of membrane: integral component of peroxisomal membrane, and integral component of membrane. This protein is involved in protein transport: protein import into peroxisome membrane, and protein transport. This protein enables the following function: protein-macromolecule adaptor activity.
MASHSSTLFTSPSSFILFSSHRLKSSPNYFTYHFPRSVKRPHFDLRCSVSIEKEVPETERPFTFLRVSDGDQTQSSSYSVRARFEKMIRTAQDKVCEAIEAVEEGPKFKEDVWSRPGGGGGISRILQDGNVWEKAGVNVSVIYGVMPPEAYRAAKAATSEQKPGPIPFFAAGTSSVLHPQNPFAPTLHFNYRYFETDAPKDVPGAPRQWWFGGGTDFTPAYIFEEDVKHFHSV	This protein is part of the following components: chloroplast, cytoplasm, chloroplast stroma, cytosol, and plastid. This protein is involved in the following processs: heme biosynthetic process, porphyrin-containing compound biosynthetic process, chlorophyll biosynthetic process, and protoporphyrinogen IX biosynthetic process. This protein is active in the following components: chloroplast stroma, and cytoplasm. This protein is located in the following components: plastid, chloroplast, chloroplast stroma, and cytosol. This protein is involved in metabolic process: heme biosynthetic process, protoporphyrinogen IX biosynthetic process, chlorophyll biosynthetic process, and porphyrin-containing compound biosynthetic process. This protein enables catalytic activity: coproporphyrinogen oxidase activity, and oxidoreductase activity. This protein is part of cytoplasm: cytoplasm. This protein is part of cytosol: cytosol. This protein is part of plastid: plastid, and chloroplast. This protein enables the following functions: coproporphyrinogen oxidase activity, and oxidoreductase activity.
MPEPGPRMNGFSLGELCWLFCCPPCPSRIAAKLAFLPPEPTYTVLAPEQRAPAPAATPAPAPAAQPAPAEEGAGPGACSLHLSERADWQYSQRELDAVEVFFSRTARDNRLGCMFVRCAPSSRYTLLFSHGNAVDLGQMCSFYIGLGSRINCNIFSYDYSGYGVSSGKPSEKNLYADIDAAWQALRTRYGVSPENIILYGQSIGTVPTVDLASRYECAAVILHSPLMSGLRVAFPDTRKTYCFDAFPSIDKISKVTSPVLVIHGTEDEVIDFSHGLAMYERCPRAVEPLWVEGAGHNDIELYAQYLERLKQFISHELPNS	This protein is part of the following components: cell projection, synapse, postsynaptic membrane, cell junction, dendritic spine, glutamatergic synapse, endosome membrane, plasma membrane, postsynaptic density, endosome, membrane, recycling endosome membrane, and postsynaptic density membrane. This protein is involved in the following processs: regulation of postsynapse organization, protein palmitoylation, positive regulation of protein localization to endosome, protein depalmitoylation, and negative regulation of protein localization to microtubule. This protein acts upstream of or within the following processs: protein palmitoylation, and regulation of postsynapse organization. This protein is active in the following components: plasma membrane, and endosome membrane. This protein is located in the following components: dendritic spine, glutamatergic synapse, membrane, postsynaptic density, postsynaptic membrane, synapse, cell projection, endosome, recycling endosome membrane, postsynaptic density membrane, cell junction, and plasma membrane. This protein enables hydrolase activity: palmitoyl-(protein) hydrolase activity, and hydrolase activity. This protein is involved in metabolic process: protein palmitoylation, and protein depalmitoylation. This protein is part of membrane: endosome membrane, plasma membrane, membrane, postsynaptic density membrane, postsynaptic membrane, and recycling endosome membrane. This protein enables the following functions: hydrolase activity, and palmitoyl-(protein) hydrolase activity.
MLFNNFLCFAVSAIPLVSAMPLGNAPYHHHHHAGLNASNITVGVNVTNTTAFSKRDGGFPDGVYDCSSFPDDQNGVVRLDYLGFGGWSGVQKNDGKYGTASTCQDNTYCSYACKPGMSKTQWPSEQPDNGVSVGGLYCKNGKLYLTQKDNSNLCEDGKGTAYVKNTLSSNVAICRTDYPGTENMNIPTNIDGGSKQPLSDVDEDSYYNWGGKKTSAQYYVNKSGRSAEDVCVWGNEGDDYGNWAPMNFGSGYTDGKTWLSMSFNPLSSAKLDYNIRIKSDGGSLSGDCYYEDGSFHGSTADSSGCTVSVTGGNAYFELY	This protein is part of the following components: fungal-type cell wall, cell surface, and extracellular region. This protein is involved in the following processs: cell wall organization, fungal-type cell wall organization, metabolic process, polysaccharide catabolic process, and carbohydrate metabolic process. This protein is active in the following components: fungal-type cell wall, and cell surface. This protein is located in the following components: fungal-type cell wall, and extracellular region. This protein enables hydrolase activity: hydrolase activity, hydrolase activity, acting on glycosyl bonds, and beta-glucosidase activity. This protein is involved in metabolic process: metabolic process. This protein is part of extracellular region: extracellular region. This protein is involved in carbohydrate metabolic process: carbohydrate metabolic process, and polysaccharide catabolic process. This protein enables the following functions: hydrolase activity, hydrolase activity, acting on glycosyl bonds, and beta-glucosidase activity.
MARTKQTACKSTGRKAPRKQLATKAAHKSAPAMGGVKKPHCYRPGTVALHEIHRYQKSTELLICKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVSIMPKDIQLTRRIRGERA	This protein is part of the following components: nucleus, chromosome, and nucleosome. This protein is located in the following components: chromosome, and nucleus. This protein enables DNA binding: DNA binding. This protein is part of nucleus: nucleus. This protein enables the following functions: protein heterodimerization activity, and DNA binding.
MDSAARPVSFPKSRWYAKSSKPKAPYKLPESVKPPQSEQPSSTPKPEYSAEQTEFDTKADPAGNAAPEASEATESKPQQPLPDLTQGIPSTLAAELEGRTKKSGQTSLNLTEDPSRFEDYTDDGRGDIPKDGYVSSLDRRRARMANLMYAFFLLAGAGGVAYLGRNWETEEEAKAHPDIPSGWSFSSWYNRMKARLSDITSYYKDPAFPKLLPDEDPNLRQPYTLVLSLEDLLVHSEWSREHGWRIAKRPGVDYFLRYLNQYYELVLFTSVPSMMADQVLRKLDPYRIIRWPLFREATRYKDGEYIKDLSYLNRDLSKVILIDTKEEHARLQPENAIILDKWLGDPKDKNLVALIPFLEYIAGMGVEDVRPVLKSFEGTSIPVEFAKRERIMREKFEKELEEERKRRPKRGVGSLASALGLKSTRTLDGEQSPSEGLAQGKMLWDQIRERGQKNYEMIEKEIRENGEKWLAEMAAEEEKARQEQMKMMKGSFTSMFGAGKQ	This protein is part of the following components: integral component of membrane, membrane, mitochondrial inner membrane, TIM23 mitochondrial import inner membrane translocase complex, and mitochondrion. This protein is involved in the following processs: protein dephosphorylation, protein import into mitochondrial matrix, and protein transport. This protein is located in the following components: mitochondrion, membrane, integral component of membrane, and mitochondrial inner membrane. This protein enables hydrolase activity: phosphoprotein phosphatase activity. This protein is involved in metabolic process: protein dephosphorylation. This protein is part of membrane: membrane, and mitochondrial inner membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is part of mitochondrion: mitochondrion. This protein is involved in transmembrane transport: protein import into mitochondrial matrix. This protein is involved in protein transport: protein transport. This protein enables the following function: phosphoprotein phosphatase activity.
MAALASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP	This protein is part of the following components: nucleus, extracellular region, and cytoplasm. This protein is involved in the following processs: signal transduction, regulation of voltage-gated sodium channel activity, nervous system development, and cell-cell signaling. This protein is active in the following components: cytoplasm, and nucleus. This protein is located in the following component: extracellular region. This protein is involved in signal transduction: signal transduction. This protein is part of extracellular region: extracellular region. This protein enables the following functions: growth factor activity, protein binding, and sodium channel regulator activity.
MATRNRTLLFRKYRNSLRSVRAPLSSSSLTGTRSGGVGPVIEMASTSLLNPNRSYAPISTEDPGTSSKGAITVGLPPAWVDVSEEISVNIQRARTKMAELGKAHAKALMPSFGDGKEDQHNIESLTQEITFLLKKSEKQLQRLSASGPSEDSNVRKNVQRSLATDLQLLSMELRKKQSTYLKRLRQQKEDGMDLEMNLSRNRYRPEEDDFGDMLNEHQMSKIKKSEEVSVEREKEIQQVVESVNDLAQIMKDLSALVIDQGTIVDRIDYNIENVATTVEDGLKQLQKAERTQRHGGMVKCASVLVILCFIMLLLLILKEIFL	This protein is part of the following components: SNARE complex, integral component of membrane, membrane, endomembrane system, Golgi apparatus, and trans-Golgi network. This protein is involved in the following processs: vesicle docking, vesicle fusion, intracellular protein transport, vesicle-mediated transport, and protein transport. This protein is active in the following components: integral component of membrane, and endomembrane system. This protein is located in the following components: membrane, integral component of membrane, trans-Golgi network, and Golgi apparatus. This protein is part of membrane: membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is involved in protein transport: intracellular protein transport, and protein transport. This protein enables the following functions: SNARE binding, protein binding, and SNAP receptor activity.
MAPIEILKFPISSPGDISPLKKLQDAGYDPSNILAVVGKTEGNGCVNDFSRTLASAVWEPRIPSDAVTIFSGGTEGVLSPHVTFFLRSPGDKETGLSAAVGHTRRFEPHEIGTDEQAQQVATTTSSLIEQMGVTPDQVHMVLIKCPLLTSEKLETIRALGRVPVTTDTYESMARSRYASAVGIAAAVGEIQHTRIPEAVSKAGTWSAKASCSSGAELEDCHILVLASTSAQGSRLHAVSRPMADAMDAASILALMELAKKDGGKIVQVFAKAEADPSGHVREWRHTMNTDSDIHSTRHARAAVGGLIAGLVSDAEIYVSGGAEGQGPSGGGSLCLVYETSI	This protein is involved in the following process: atrazine catabolic process. This protein enables hydrolase activity: cyanuric acid amidohydrolase activity, hydrolase activity, and hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides. This protein is involved in metabolic process: atrazine catabolic process. This protein enables metal ion binding: metal ion binding. This protein enables the following functions: metal ion binding, cyanuric acid amidohydrolase activity, hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides, and hydrolase activity.
MSDDTKSPHEETHGLNRRGFLGASALTGAAALVGASALGSAVVGREARAAGKGERSKAEVAPGELDEYYGFWSGGHSGEVRVLGVPSMRELMRIPVFNVDSATGWGLTNESKRVLGDSARFLNGDCHHPHISMTDGKYDGKYLFINDKANSRVARIRLDVMKCDRIVTIPNVQAIHGLRLQKVPHTRYVFCNAEFIIPHPNDGSTFDLSGDNAFTLYNAIDAETMEVAWQVIVDGNLDNTDMDYSGRFAASTCYNSEKAVDLGGMMRNERDWVVVFDIPRIEAEIKAKRFVTLGDSKVPVVDGRRKDGKDSPVTRYIPVPKNPHGLNTSPDGKYFIANGKLSPTCTMIAIERLGDLFAGKLADPRDVVVGEPELGLGPLHTTFDGRGNAYTTLFIDSQLVKWNLADAVRAYKGEKVDYIRQKLDVQYQPGHNHATLCETSEADGKWIVVLSKFSKDRFLPTGPLHPENDQLIDISGEEMKLVHDGPTFAEPHDCILARRDQIKTRKIWDRKDPFFAETVKRAEKDGIDLMKDNKVIREGNKVRVYMVSMAPSFGLTEFKVKQGDEVTVTITNLDEIEDVTHGFVMVNHGVCMEISPQQTSSITFVADKPGVHWYYCSWFCHALHMEMCGRMLVEKA	This protein is part of the following components: periplasmic space, and membrane. This protein is involved in the following processs: electron transport chain, proton transmembrane transport, and denitrification pathway. This protein is located in the following components: periplasmic space, and membrane. This protein is involved in metabolic process: electron transport chain, and denitrification pathway. This protein enables metal ion binding: metal ion binding, calcium ion binding, and copper ion binding. This protein enables catalytic activity: oxidoreductase activity, nitrous-oxide reductase activity, and cytochrome-c oxidase activity. This protein is part of membrane: membrane. This protein is involved in cation transport: proton transmembrane transport. This protein enables the following functions: nitrous-oxide reductase activity, oxidoreductase activity, cytochrome-c oxidase activity, metal ion binding, calcium ion binding, and copper ion binding.
MDEAKEENRRLKSSLSKIKKDFDILQTQYNQLMAKHNEPTKFQSKGHHQDKGEDEDREKVNEREELVSLSLGRRLNSEVPSGSNKEEKNKDVEEAEGDRNYDDNEKSSIQGLSMGIEYKALSNPNEKLEIDHNQETMSLEISNNNKIRSQNSFGFKNDGDDHEDEDEILPQNLVKKTRVSVRSRCETPTMNDGCQWRKYGQKIAKGNPCPRAYYRCTIAASCPVRKQVQRCSEDMSILISTYEGTHNHPLPMSATAMASATSAAASMLLSGASSSSSAAADLHGLNFSLSGNNITPKPKTHFLQSPSSSGHPTVTLDLTTSSSSQQPFLSMLNRFSSPPSNVSRSNSYPSTNLNFSNNTNTLMNWGGGGNPSDQYRAAYGNINTHQQSPYHKIIQTRTAGSSFDPFGRSSSSHSPQINLDHIGIKNIISHQVPSLPAETIKAITTDPSFQSALATALSSIMGGDLKIDHNVTRNEAEKSP	This protein is part of the following component: nucleus. This protein is involved in the following process: regulation of transcription, DNA-templated. This protein is located in the following component: nucleus. This protein enables DNA binding: sequence-specific DNA binding, and DNA binding. This protein is part of nucleus: nucleus. This protein is involved in regulation of transcription, DNA-templated: regulation of transcription, DNA-templated. This protein enables the following functions: DNA binding, sequence-specific DNA binding, and DNA-binding transcription factor activity.
MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREGDTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ	This protein is part of the following components: intracellular membrane-bounded organelle, PML body, cytoplasm, myofibril, sarcomere, euchromatin, cytosol, nucleus, and I band. This protein is involved in the following processs: muscle organ development, muscle contraction, negative regulation of transcription by RNA polymerase II, regulation of myoblast proliferation, negative regulation of myoblast differentiation, regulation of intrinsic apoptotic signaling pathway by p53 class mediator, regulation of transcription from RNA polymerase II promoter in response to oxidative stress, skeletal muscle cell differentiation, negative regulation of myotube differentiation, regulation of cytokine production, and regulation of transcription by RNA polymerase II. This protein colocalizes with the following component: I band. This protein is active in the following component: nucleus. This protein is located in the following components: euchromatin, nucleus, cytosol, I band, PML body, intracellular membrane-bounded organelle, and cytoplasm. This protein is part of cytoplasm: cytoplasm. This protein is part of nucleus: nucleus. This protein is part of cytosol: cytosol. This protein is involved in regulation of transcription, DNA-templated: negative regulation of transcription by RNA polymerase II, regulation of transcription from RNA polymerase II promoter in response to oxidative stress, and regulation of transcription by RNA polymerase II. This protein enables the following functions: RNA polymerase II-specific DNA-binding transcription factor binding, structural constituent of muscle, chromatin binding, protein binding, titin binding, and protein kinase B binding.
MTALNPVLFLLCGVSVSLSLKVVSKRGSVDGCTDWSVDYLKYRVLHGEPVRIKCALFYGYIRANYTQAQSIGLSLMWYRSSGLGHGDFEEPISFDGTRMSKEEDAIWFRPAELQDAGLYSCVLRNSTFCMKVSMTLLVADNDTAGCYNSKLRYTEKGELGKSKDISCPDIQDYVQPGEKPQITWYKECNVQQWRSSVLQTADLLAIQDVREDDIGNYTCELLFGGFLVRRTTYLSVTAPLTEEPPRILFPSENKLLAMDVQLGSMLNLTCRAFFGYSGDISPLVYWMKGEKFIEDMDQSRIRESEIKTVREHLGEQEVSITLTIDSLEEVDLGNYSCYAENGNGRRQANVQIGKRVELMYTVELAGGLGAILLLLALLLSVYKCYRIELLLCYRHHFGGEDTDGDNKEYDAYLSYSKVELDQWGQELQEEERFALEILPDVLEKHYGYKLFIPDRDLIPTSTYIEDVSRCVDMSKRLIIVLTPSYVLRRGWSIFELESRLRNSLVSGDIKVILIECADLRGVINYQEVEELKQSIKCLSVVHWNGPQSNKPGSRFWKQLRYTMPYRRPQQTITNHALDTSEPGPFADLQTVSAISMATATSAALAPAHPELRPSLRSSYRSHSLARQKHSHYRSYDYELPFTAGGTLPPQHTYCNLPLTLLNGQRPVNNKTLRQHSLDEHHGNNAMLPLLPRETSISSVIW	This protein is part of the following components: plasma membrane, membrane, integral component of membrane, and cytoplasm. This protein is involved in the following processs: signal transduction, negative regulation of exocytosis, and cytokine-mediated signaling pathway. This protein is located in the following components: plasma membrane, cytoplasm, membrane, and integral component of membrane. This protein enables hydrolase activity: NAD+ nucleotidase, cyclic ADP-ribose generating, hydrolase activity, and NAD(P)+ nucleosidase activity. This protein is involved in signal transduction: signal transduction, and cytokine-mediated signaling pathway. This protein is part of membrane: plasma membrane, and membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is part of cytoplasm: cytoplasm. This protein enables the following functions: interleukin-1 receptor activity, NAD(P)+ nucleosidase activity, NAD+ nucleotidase, cyclic ADP-ribose generating, hydrolase activity, and NAD+ nucleosidase activity.
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMSHSHQQYSDRRQQNLNDQQASALPYNDQIQQPLPNQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRAEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMSKIVEVLGIPPAHILDQAPKARKFFEKMPEGTWNLKKTKDGKKEYKPPGTRKLHNLLGVETGGPGGRRGGESGHTVADYLKFKDLILRMLDYDAKTRIQPYYALQHSFFKKTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGGHFTAAVQAMDCETHSPQVRQQFPPGWTVPEAPTQVTIETHPVQETTFHVPSSQQNVPHHHGNGSHHHHHHHHHHHGQHVLSNRTRTRIYNSPSTSSSTQDSMDVGHSHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGTMDVNLTAFSNPRQETGITGHPDYQYSANTGPGHYVTEGHLTMRQGMDREDSPMTGVCVQQSPVASS	This protein is part of the following components: nuclear speck, and nucleus. This protein is involved in the following processs: phosphorylation, peptidyl-serine phosphorylation, protein phosphorylation, positive regulation of transcription, DNA-templated, peptidyl-tyrosine phosphorylation, protein autophosphorylation, and peptidyl-threonine phosphorylation. This protein is active in the following component: nucleus. This protein is located in the following components: nucleus, and nuclear speck. This protein enables nucleotide binding: ATP binding, and nucleotide binding. This protein is part of nucleus: nucleus. This protein enables transferase activity: protein serine/threonine/tyrosine kinase activity, kinase activity, protein tyrosine kinase activity, transferase activity, protein serine/threonine kinase activity, and protein kinase activity. This protein is involved in regulation of transcription, DNA-templated: positive regulation of transcription, DNA-templated. This protein is involved in phosphorylation: peptidyl-serine phosphorylation, peptidyl-tyrosine phosphorylation, peptidyl-threonine phosphorylation, protein autophosphorylation, protein phosphorylation, and phosphorylation. This protein enables the following functions: transcription coactivator activity, transferase activity, protein kinase activity, ATP binding, protein threonine kinase activity, protein serine kinase activity, protein serine/threonine kinase activity, nucleotide binding, kinase activity, protein tyrosine kinase activity, transmembrane receptor protein tyrosine kinase activity, and protein serine/threonine/tyrosine kinase activity.
MAQLYYKKVNYSPYRDRIPLQIVRAETELSAEEKAFLNAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRKPSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQARSSRELEIILNHRDDHSEELDPQKYHDLAKLKVAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFIKKPFIKFICHTASYLTFLFMLLLASQHIVRTDLHVQGPPPTVVEWMILPWVLGFIWGEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNGSRPREEWEMWHPTLIAEALFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFLYLGNWFNNTFCPKRDPDGRRRRHNLRSFTERHADSLIQNQHYQEVIRNLVKRYVAAMIRNSKTNEGLTEENFKELKQDISSFRYEVLDLLGNRKQPRRSLSTSSTELSQRDDTNDGSGGARAKSKSVSFNLGCKKKACHGPPLIRTMPRASGAQGKSKAESSSKRSFMGPSLKKLGLLFSKFNGHMSEPSSEPMYTISDGIVQQHYMWQDIRYSQMEKGKAEACSQSEINLSEVELGEVRGAAQSSECPLTCSSSLHCASSICSSNSKLLDSSEDVFETWGEACDLLMHKWGDGQEEQVTTRL	This protein is part of the following components: integral component of membrane, plasma membrane, calcium channel complex, and membrane. This protein is involved in the following processs: phosphatidylserine exposure on apoptotic cell surface, neuron apoptotic process, calcium ion transport, ion transport, calcium ion transmembrane transport, and transmembrane transport. This protein is located in the following components: plasma membrane, integral component of membrane, and membrane. This protein is part of membrane: membrane, and plasma membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is involved in transmembrane transport: transmembrane transport. This protein is involved in cation transport: calcium ion transport, ion transport, and calcium ion transmembrane transport. This protein enables the following functions: calcium channel activity, inositol 1,4,5 trisphosphate binding, and ion channel activity.
MTDLPDSTRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAMTFVTLPGQVGPLLGPALGGLLVEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLLLAVGMAVLTLALDGSKGTGLSPLAIAGLVAVGVVALVLYLLHARNNNRALFSLKLFRTRTFSLGLAGSFAGRIGSGMLPFMTPVFLQIGLGFSPFHAGLMMIPMVLGSMGMKRIVVQVVNRFGYRRVLVATTLGLSLVTLLFMTTALLGWYYVLPFVLFLQGMVNSTRFSSMNTLTLKDLPDNLASSGNSLLSMIMQLSMSIGVTIAGLLLGLFGSQHVSIDSGTTQTVFMYTWLSMALIIALPAFIFARVPNDTHQNVAISRRKRSAQ	This protein is part of the following components: integral component of membrane, plasma membrane, integral component of plasma membrane, and membrane. This protein is involved in the following process: transmembrane transport. This protein is located in the following components: plasma membrane, membrane, integral component of plasma membrane, and integral component of membrane. This protein is part of membrane: plasma membrane, and membrane. This protein is part of integral component of membrane: integral component of membrane, and integral component of plasma membrane. This protein is involved in transmembrane transport: transmembrane transport. This protein enables the following function: transmembrane transporter activity.
MTNLMDHTQQIVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSVVGAHYTLQSSGSYQFDQMLLTAQNLPVSYNYCRLVSRSLTVRSSTLPGGVYALNGTINAVTFQGSLSELTDYSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLSYVRLGDPIPAAGLDPKLMATCDSSDRPRVYTVTAADEYQFSSQLIPSGVKTTLFTANIDALTSLSVGGELIFSQVTIHSIEVDVTIYFIGFDGTEVTVKAVATDFGLTTGTNNLVPFNLGGPTSEITQPITSMKLEVVTYKRGGTAGDPISWTVSGTLAVTVHGGNYPGALRPVTLVAYERVAAGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERDRLGIKTVWPTREYTDFREYFMEVADLNSPLKIAGAFGFKDIIRAIRKIAVPVVSTLFPPAAPLAHANREGVDYLLGDEAQAASGTARGASGKARAASGRIRQLTLAADKGYEVVANMFQVPQNPIVDGILASPGILRGAHNLDCVSKEGATLFPVVITTLEDELTPKALNSKMFAVIEGAREDLQPPSQRGSFIRTLSGHRVYGYAPDGVLPLETGRDYTVVPIDDVWDDSIMLSQDPIPPIVGNSGNLAIAYMDVFRPKVPIHVAMTGALNASEIESVSFRSTKLATAHRLGMKLAGPGDYDINTGPNWATFIKRFPHNPRGWDRLPYLNLPYLPPTAGRQFHLALAASEFKETPELEDAVRAMDAAANADPLFRSALQVFMWLEENGIVTDMANFALSDPNAHRMKNFLANAPQAGSKSQRAKYGTAGYGVEARGPTPEEAQRAKDARISKKMETMGIYFATPEWVALNGHRGPSPGQLKYWQNTREIPEPNEDYPDYVHAEKSRLASEEQILRAATSIYGAPGQAEPPQAFIDEVARVYETNHGRVPNQEQMKDLLLTAMEMKHRNPRRAPPKPKPKPNAPSQRPPGRLGRWIRTVSDEDLE	This protein is part of the following components: virion component, viral capsid, T=13 icosahedral viral capsid, and host cell cytoplasm. This protein is involved in the following process: proteolysis. This protein is located in the following components: T=13 icosahedral viral capsid, viral capsid, and host cell cytoplasm. This protein enables hydrolase activity: hydrolase activity, serine-type peptidase activity, and peptidase activity. This protein enables metal ion binding: metal ion binding. This protein is involved in proteolysis: proteolysis. This protein enables the following functions: hydrolase activity, metal ion binding, peptidase activity, structural molecule activity, and serine-type peptidase activity.
MQVLGMEEKPARRSVVLVPFPAQGHISPMMQLAKTLHLKGFSITVVQTKFNYFSPSDDFTHDFQFVTIPESLPESDFKNLGPIQFLFKLNKECKVSFKDCLGQLVLQQSNEISCVIYDEFMYFAEAAAKECKLPNIIFSTTSATAFACRSVFDKLYANNVQAPLKETKGQQEELVPEFYPLRYKDFPVSRFASLESIMEVYRNTVDKRTASSVIINTASCLESSSLSFLQQQQLQIPVYPIGPLHMVASAPTSLLEENKSCIEWLNKQKVNSVIYISMGSIALMEINEIMEVASGLAASNQHFLWVIRPGSIPGSEWIESMPEEFSKMVLDRGYIVKWAPQKEVLSHPAVGGFWSHCGWNSTLESIGQGVPMICRPFSGDQKVNARYLECVWKIGIQVEGELDRGVVERAVKRLMVDEEGEEMRKRAFSLKEQLRASVKSGGSSHNSLEEFVHFIRTL	This protein is part of the following component: intracellular membrane-bounded organelle. This protein enables transferase activity: hexosyltransferase activity, transferase activity, flavonol 7-O-beta-glucosyltransferase activity, myricetin 3-O-glucosyltransferase activity, UDP-glycosyltransferase activity, quercetin 7-O-glucosyltransferase activity, flavonol 3-O-glucosyltransferase activity, daphnetin 3-O-glucosyltransferase activity, quercetin 3-O-glucosyltransferase activity, and glycosyltransferase activity. This protein enables the following functions: glycosyltransferase activity, quercetin 3-O-glucosyltransferase activity, daphnetin 3-O-glucosyltransferase activity, flavonol 7-O-beta-glucosyltransferase activity, myricetin 3-O-glucosyltransferase activity, UDP-glycosyltransferase activity, flavonol 3-O-glucosyltransferase activity, transferase activity, and quercetin 7-O-glucosyltransferase activity.
MSSYLEYVSCAAGGGSGGVGGDVLGFAPKFCRADARPVALQPAFPLGSGDGAFVSCLPLATARPTPSPPAGPAQSPVPQPAAPRYAPCTLEGAYERGAAPASAAEYGFLGSGPAFDFPGALGRAADEGGAHVHYATSAVFSGGGSFLLSGQVDFAAFGEPGPFPACLKEPADGHPGPFQTVSPAPGACPKPASPTSSLPAAHSTFEWMKVKRNAPKKSKLSEYGATSPPSAIRTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLQLNDTQVKIWFQNRRMKQKKREREGLLATAASVASIKLPRSETSPIKSGRNLGSPSQAQEPS	This protein is part of the following components: nucleoplasm, and nucleus. This protein is involved in the following processs: multicellular organism development, regulation of transcription by RNA polymerase II, and regulation of transcription, DNA-templated. This protein acts upstream of or within the following processs: sensory perception of pain, neuron differentiation, and embryonic skeletal system development. This protein is active in the following component: nucleus. This protein is located in the following components: nucleoplasm, and nucleus. This protein enables DNA binding: DNA binding, and sequence-specific DNA binding. This protein is part of nucleus: nucleus. This protein is involved in regulation of transcription, DNA-templated: regulation of transcription, DNA-templated. This protein enables the following functions: RNA polymerase II cis-regulatory region sequence-specific DNA binding, DNA-binding transcription factor activity, RNA polymerase II-specific, sequence-specific double-stranded DNA binding, and DNA binding.
MASISTTTWLYRGQVCTDSGKSSNCIVQRRVKCGFPLKTLHAGITSRDRSLRHCIKCKKEDGDGDVSEGSKKSEEGFEYVTVERHPYHSYMDSTSGKLEPASGARASIPGEDYWPEGTSSRVRAARAPQPAGESSSFPSYGKNPGSRRKKNRKATEENVTVETNDEVSDSEDSSEEEENDSSDGFVTYKNEFEREEEETGFELDKKLGRPHPFIDPTKKKQIEKTLTSDESWWNWRKPEKEQWSRWQRRRPDVETVFLKAMAETGQVKLYGEEPTLTETSLYRARRHLFKEERLQAERERLAKEGPMAFYSEWVKAWKRDTSREAVQKHFEETGEDENTQLIEMFSHQTDREYRIMMGTDIRIKRDPLAMRMREDQIKQIWGGDPVYPTINYIQDPNAVMDFRGPDFHEPTPNMLSYLKENGKVISREMHEALLTKEKTEQLEVPDMDDAMAQAVDIGENDDDEDDADVEKDDEKVPRNWSVLKETPELRTAKPKPKKEGRMSLDEAVDDAENLTDFLMDFEEETDP	This protein is part of the following components: nucleus, plastid-encoded plastid RNA polymerase complex, plastid, plastid chromosome, chloroplast nucleoid, and chloroplast. This protein is involved in the following processs: plastid transcription, response to light stimulus, response to far red light, regulation of transcription, DNA-templated, red, far-red light phototransduction, positive regulation of red or far-red light signaling pathway, positive regulation of transcription, DNA-templated, response to red light, response to blue light, and red or far-red light signaling pathway. This protein is active in the following components: chloroplast, and plastid chromosome. This protein is located in the following components: chloroplast, plastid, chloroplast nucleoid, nucleus, and plastid chromosome. This protein is involved in signal transduction: red, far-red light phototransduction, and red or far-red light signaling pathway. This protein is involved in metabolic process: plastid transcription. This protein is part of nucleus: nucleus. This protein is involved in regulation of transcription, DNA-templated: positive regulation of transcription, DNA-templated, and regulation of transcription, DNA-templated. This protein is part of plastid: chloroplast, and plastid. This protein enables the following function: protein binding.
MSPERSQEESPEGDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKMNYNALITVGLRATRPAFMCHRRQAIKLQVDDTEDSDEEWTPRQQVKPPWMAFRGEQSKHQKGMPKASFNNESSLRELSGTPNLLNTSDSEQAQKPVSPPGEASTSGQHSRLKLELRRKETEGKMYSLRERKGHAYKEISEPQDDDYLYCEMCQNFFIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPYEGRITEDEEAANSGYSWLITKGRNCYEYVDGKDKSSANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPGCELLVWSGDEYGQELGIRSSIEPAESLGQAVNCWSGMGMSMARNWASSGAASGRKSSWQGENQSQRSIHVPHAVWPFQVKNFSVNMWNAITPLRTSQDHLQENFSNQRIPAQGIRIRSGNILIHAAVMTKPKVKRSKKGPNS	This protein is part of the following components: nucleus, and chromosome. This protein is involved in the following processs: positive regulation of reciprocal meiotic recombination, regulation of transcription, DNA-templated, methylation, histone H3-K4 trimethylation, chromatin organization, regulation of gene expression, histone H3-K36 methylation, and histone methylation. This protein is active in the following component: nucleus. This protein is located in the following components: chromosome, and nucleus. This protein is part of nucleus: nucleus. This protein enables transferase activity: histone methyltransferase activity (H3-K36 specific), histone methyltransferase activity (H3-K4 specific), transferase activity, methyltransferase activity, and histone methyltransferase activity. This protein is involved in methylation: histone H3-K4 trimethylation, histone H3-K36 methylation, and methylation. This protein is involved in regulation of transcription, DNA-templated: regulation of transcription, DNA-templated. This protein enables the following functions: recombination hotspot binding, methyltransferase activity, transferase activity, histone methyltransferase activity (H3-K36 specific), nucleic acid binding, protein binding, histone methyltransferase activity (H3-K4 specific), histone methyltransferase activity, and histone-lysine N-methyltransferase activity.
MSVASDSPVHSSSSSDDLAAFLDAELDSASDASSGPSEEEEAEDDVESGLKRQKLEHLEEASSSKGECEHPGSFGNMCFVCGQKLEETGVSFRYIHKEMRLNEDEISRLRDSDSRFLQRQRKLYLVLDLDHTLLNTTILRDLKPEEEYLKSHTHSLQDGCNVSGGSLFLLEFMQMMTKLRPFVHSFLKEASEMFVMYIYTMGDRNYARQMAKLLDPKGEYFGDRVISRDDGTVRHEKSLDVVLGQESAVLILDDTENAWPKHKDNLIVIERYHFFSSSCRQFDHRYKSLSELKSDESEPDGALATVLKVLKQAHALFFENVDEGISNRDVRLMLKQVRKEILKGCKIVFSRVFPTKAKPEDHPLWKMAEELGATCATEVDASVTHVVAMDVGTEKARWAVREKKYVVHRGWIDAANYLWMKQPEENFGLEQLKKQLTEEE	This protein is part of the following component: nucleus. This protein is involved in the following processs: dephosphorylation of RNA polymerase II C-terminal domain, and response to salt stress. This protein is located in the following component: nucleus. This protein enables hydrolase activity: phosphoprotein phosphatase activity, hydrolase activity, and RNA polymerase II CTD heptapeptide repeat phosphatase activity. This protein enables metal ion binding: metal ion binding. This protein enables RNA binding: RNA binding. This protein is part of nucleus: nucleus. This protein is involved in regulation of transcription, DNA-templated: dephosphorylation of RNA polymerase II C-terminal domain. This protein enables the following functions: protein C-terminus binding, protein serine/threonine phosphatase activity, RNA polymerase II CTD heptapeptide repeat phosphatase activity, hydrolase activity, protein serine phosphatase activity, metal ion binding, RNA binding, protein threonine phosphatase activity, and phosphoprotein phosphatase activity.
MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDKNGHQAFNEDNLKLILMDCMEGRVAITRVSNLLLCMYAKETVGFGMLKAKAQALVYYLEEPLNQVSSA	This protein is part of the following components: Ragulator complex, membrane, lysosomal membrane, lysosome, endosome, late endosome, and late endosome membrane. This protein is involved in the following processs: regulation of cell growth, cellular protein localization, positive regulation of TOR signaling, cellular response to amino acid stimulus, and regulation of catalytic activity. This protein contributes to the following functions: guanyl-nucleotide exchange factor activity, and molecular adaptor activity. This protein is located in the following components: lysosome, lysosomal membrane, late endosome membrane, membrane, late endosome, and endosome. This protein is part of membrane: late endosome membrane, membrane, and lysosomal membrane. This protein enables the following functions: guanyl-nucleotide exchange factor activity, and molecular adaptor activity.
MGARGAPSRRRQAGRRPRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWSSRRSVFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRLANEEYQILANSWRYSSAFCNKLFFSKVDYDEGTDIFQQLNINSAPTFMHFPPKGRPKRADTFDLQRIGFGAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQVQFVAESHIILVLNAAITMGMDLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSFLIK	This protein is part of the following components: oligosaccharyltransferase complex, endoplasmic reticulum membrane, membrane, endoplasmic reticulum, integral component of membrane, and mitochondrion. This protein is involved in the following processs: protein N-linked glycosylation via asparagine, protein glycosylation, magnesium ion transport, magnesium ion transmembrane transport, and cognition. This protein is located in the following components: endoplasmic reticulum membrane, endoplasmic reticulum, mitochondrion, integral component of membrane, and membrane. This protein is involved in metabolic process: protein glycosylation, and protein N-linked glycosylation via asparagine. This protein is part of membrane: membrane, and endoplasmic reticulum membrane. This protein is part of integral component of membrane: integral component of membrane. This protein is part of mitochondrion: mitochondrion. This protein is involved in cation transport: magnesium ion transmembrane transport, and magnesium ion transport. This protein enables the following functions: magnesium ion transmembrane transporter activity, and oligosaccharyltransferase complex binding.
MRILCDACENAAAIIFCAADEAALCRPCDEKVHMCNKLASRHVRVGLAEPSNAPCCDICENAPAFFYCEIDGSSLCLQCDMVVHVGGKRTHGRFLLLRQRIEFPGDKPKENNTRDNLQNQRVSTNGNGEANGKIDDEMIDLNANPQRVHEPSSNNNGIDVNNENNHEPAGLVPVGPFKRESEK	This protein is part of the following component: nucleus. This protein is involved in the following processs: regulation of transcription, DNA-templated, negative regulation of photomorphogenesis, and photomorphogenesis. This protein is active in the following component: nucleus. This protein is located in the following component: nucleus. This protein enables metal ion binding: metal ion binding, and zinc ion binding. This protein is part of nucleus: nucleus. This protein is involved in regulation of transcription, DNA-templated: regulation of transcription, DNA-templated. This protein enables the following functions: protein binding, metal ion binding, and zinc ion binding.
MAPGKAPAGHFSILYFAAASTFTGKTSEHLPAPVRARHVFTMLEERYPGIGDKVLSSCAVTVNLEYVDIGEEDAEQQIEEGDEVAIIPPVSSG	This protein is part of the following components: cytoplasm, molybdopterin synthase complex, and cytosol. This protein is involved in the following process: Mo-molybdopterin cofactor biosynthetic process. This protein is located in the following components: cytosol, and cytoplasm. This protein is involved in metabolic process: Mo-molybdopterin cofactor biosynthetic process. This protein enables nucleotide binding: nucleotide binding. This protein is part of cytoplasm: cytoplasm. This protein enables transferase activity: molybdopterin synthase activity. This protein is part of cytosol: cytosol. This protein enables the following functions: molybdopterin synthase activity, and nucleotide binding.
MARSRCVHRVVHQAACIGVIGLSTSALTTCDFTGIFVAIQSEVPIKTPSIPGAIYGLVKAGSKLYATNGQLWKKNVAEEGKDWERESCFDSVIGDSRITSLAADNGENGVLVACILGKGAYKWSQGSADQTSGNPSALSGTEKALSVVGTGTSCVYLNHTDDKVGETSSSESGGMTASGETNEFCLHAGNGFLVTTKKVCVGSDGSPVAKSDGEEPVPPILAATDDGSGHVYILTKDKVYCKKVNQSEGKIQDCPQSAAAAPEPTGAHSVAHKVADAHSIAFFKNGSDEFLLIGGRQGYGEIKLERGSGSNGNGAQCVHLKEENVHDQTGWHEKGSTPKGSAEQYRSTIGRWAVSGIYVIKKSTSGGRGKRSTSTDCERPDLYVAVGDTNDTYTGLWRFDSAAQKWNRE	This protein is part of the following components: plasma membrane, and membrane. This protein is located in the following components: membrane, and plasma membrane. This protein is part of membrane: membrane, and plasma membrane.