| | import os |
| | import re |
| |
|
| | import pathlib |
| | from argparse import ArgumentParser |
| | from typing import List, Dict, Optional |
| | from dataclasses import dataclass, field |
| |
|
| | import torch |
| | from torch import nn |
| | import torch.nn.functional as F |
| | from torch.optim import AdamW |
| | from torch.utils.data import DataLoader, Dataset |
| | from transformers import get_cosine_schedule_with_warmup, AutoTokenizer |
| |
|
| | from transformers import ( |
| | AutoTokenizer, |
| | AutoModelForCausalLM, |
| | AutoModelForMaskedLM, |
| | AutoProcessor, |
| | ) |
| |
|
| | from datasets import load_dataset, DatasetDict |
| |
|
| | from peft import get_peft_model, LoraConfig, prepare_model_for_kbit_training |
| | from transformers import BitsAndBytesConfig |
| |
|
| | import pytorch_lightning as pl |
| | from pytorch_lightning.callbacks import ModelCheckpoint, LearningRateMonitor |
| | from pytorch_lightning.loggers import WandbLogger |
| |
|
| | from trl import GRPOConfig, GRPOTrainer, ModelConfig, ScriptArguments, TrlParser, get_peft_config |
| | |
| |
|
| | from bioreason.models.dna_llm import DNALLMModel |
| | from bioreason.models.protein_llm import ProteinLLMModel |
| | from bioreason.dna_modules import NucleotideDNAModule |
| | from bioreason.models.dl.processing_dl import DLProcessor |
| | from bioreason.trainer import DNALLMGRPOTrainer, DNALLMGRPOConfig |
| | from bioreason.models.evo2_tokenizer import Evo2Tokenizer, register_evo2_tokenizer |
| | register_evo2_tokenizer() |
| |
|
| | |
| | from transformers import TrainerCallback, TrainerState, TrainerControl |
| | from transformers.trainer_utils import PREFIX_CHECKPOINT_DIR |
| |
|
| | class SaveWithPyTorchCallback(TrainerCallback): |
| | """Custom callback to save models with PyTorch's native save mechanism instead of safetensors""" |
| | def on_save(self, args, state, control, **kwargs): |
| | |
| | checkpoint_folder = os.path.join( |
| | args.output_dir, f"{PREFIX_CHECKPOINT_DIR}-{state.global_step}" |
| | ) |
| | os.makedirs(checkpoint_folder, exist_ok=True) |
| | |
| | |
| | checkpoint_path = os.path.join(checkpoint_folder, "pytorch_model.bin") |
| | model = kwargs.get("model") |
| | |
| | |
| | unwrapped_model = model.module if hasattr(model, "module") else model |
| | |
| | |
| | torch.save(unwrapped_model.state_dict(), checkpoint_path) |
| | |
| | |
| | |
| | if hasattr(unwrapped_model, "text_model"): |
| | if hasattr(unwrapped_model.text_model, "config"): |
| | unwrapped_model.text_model.config.save_pretrained(checkpoint_folder) |
| | |
| | elif hasattr(unwrapped_model.text_model, "base_model") and hasattr(unwrapped_model.text_model.base_model, "config"): |
| | unwrapped_model.text_model.base_model.config.save_pretrained(checkpoint_folder) |
| | |
| | |
| | print(f"Saved model checkpoint to {checkpoint_folder}") |
| | lora_params = [k for k in unwrapped_model.state_dict().keys() if "lora" in k] |
| | print(f"Checkpoint contains {len(lora_params)} LoRA parameters") |
| | |
| | |
| | control.should_save = False |
| | return control |
| |
|
| | def _get_target_modules(model: ProteinLLMModel): |
| | |
| | target_modules = [] |
| |
|
| | |
| | seen_names = set() |
| | for name, module in model.text.named_modules(): |
| | if isinstance(module, torch.nn.Linear): |
| | names = name.split(".") |
| | target_name = names[-1] |
| |
|
| | |
| | if target_name != "lm_head" and target_name not in seen_names: |
| | target_modules.append(target_name) |
| | seen_names.add(target_name) |
| |
|
| | |
| | |
| | attention_patterns = [ |
| | "q_proj", |
| | "k_proj", |
| | "v_proj", |
| | "o_proj", |
| | "out_proj", |
| | "query", |
| | "key", |
| | "value", |
| | "gate_proj", |
| | "up_proj", |
| | "down_proj", |
| | ] |
| | for pattern in attention_patterns: |
| | if pattern not in seen_names: |
| | target_modules.append(pattern) |
| |
|
| | |
| | return list(target_modules) |
| |
|
| |
|
| | def extract_xml_answer(text: str) -> str: |
| | |
| | |
| | answer = text.split("</think>")[-1] |
| | return answer.strip() |
| |
|
| | def extract_hash_answer(text: str) -> str | None: |
| | if "####" not in text: |
| | return None |
| | return text.split("####")[1].strip() |
| |
|
| |
|
| | def get_kegg_questions() -> Dataset: |
| | data = load_dataset('wanglab/kegg', 'default') |
| | |
| | example_protein_sequences = ["MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG", |
| | "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRISSKLLERGKTHYPPHTMVGTGVLVTKMRVAGQEPDVQGPHAGIVVQGAGDAPVVVKPVVEMLNRMVVVVSGSAAPVVVNNNNNGAAAAAAA", |
| | "MSQVQVQVQNQALNTLVKQLGRVLLQGKGRPPLQGFRIIEQNGGDSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP"] |
| | num_protein_sequences = 2 |
| |
|
| | data = data.map(lambda x: { |
| | 'prompt': [ |
| | { |
| | 'role': 'user', |
| | 'content': [ |
| | *({'type': 'protein', 'text': None} for _ in range(num_protein_sequences)), |
| | {'type': 'text', 'text': x['question']}, |
| | ], |
| | }, |
| | ], |
| | 'protein_sequences': [example_protein_sequences[0], example_protein_sequences[1]], |
| | 'answer': x['answer'], |
| | }) |
| |
|
| | return data |
| |
|
| |
|
| | |
| |
|
| | |
| |
|
| |
|
| |
|
| | def correctness_reward_func(prompts, completions, answer, **kwargs) -> list[float]: |
| | responses = [completion[0]['content'] for completion in completions] |
| | q = prompts[0][-1]['content'] |
| | extracted_responses = [extract_xml_answer(r) for r in responses] |
| | |
| | print('-'*20, f"Question:\n{q}", f"\nAnswer:\n{answer[0]}", f"\nResponse:\n{responses[0]}", f"\nExtracted:\n{extracted_responses[0]}") |
| | return [2.0 if a.lower() in r.lower() else 0.0 for r, a in zip(extracted_responses, answer[0])] |
| |
|
| | def less_than_4_reward_func(completions, **kwargs) -> list[float]: |
| | responses = [completion[0]['content'] for completion in completions] |
| | extracted_responses = [extract_xml_answer(r) for r in responses] |
| | return [0.5 if len(r.split(' ')) <= 4 else 0.0 for r in extracted_responses] |
| |
|
| | def strict_format_reward_func(completions, **kwargs) -> list[float]: |
| | """Reward function that checks if the completion has a specific format.""" |
| | pattern = r"^<think>\n.*?\n</think>\n.*?\n$" |
| | responses = [completion[0]["content"] for completion in completions] |
| | matches = [re.match(pattern, r) for r in responses] |
| | return [0.5 if match else 0.0 for match in matches] |
| |
|
| | def soft_format_reward_func(completions, **kwargs) -> list[float]: |
| | """Reward function that checks if the completion has a specific format.""" |
| | pattern = r"<think>.*?</think>\s*.*?" |
| | responses = [completion[0]["content"] for completion in completions] |
| | matches = [re.match(pattern, r) for r in responses] |
| | return [0.5 if match else 0.0 for match in matches] |
| |
|
| | def count_xml(text) -> float: |
| | count = 0.0 |
| | if text.count("<think>\n") == 1: |
| | count += 0.125 |
| | if text.count("\n</think>\n") == 1: |
| | count += 0.125 |
| | return count |
| |
|
| | def xmlcount_reward_func(completions, **kwargs) -> list[float]: |
| | contents = [completion[0]["content"] for completion in completions] |
| | return [count_xml(c) for c in contents] |
| |
|
| | |
| | def repeatness_reward(s: str): |
| | """计算文本重复度,返回值越高表示重复度越低""" |
| | def ranks(l): |
| | index = {v: i for i, v in enumerate(sorted(set(l)))} |
| | return [index[v] for v in l] |
| | |
| | def suffixArray(s): |
| | line = ranks(s) |
| | n, k, ans, sa = len(s), 1, line, [0] * len(s) |
| | while k < n - 1: |
| | line = ranks(list(zip_longest(line, islice(line, k, None), fillvalue=-1))) |
| | ans, k = line, k << 1 |
| | for i, k in enumerate(ans): |
| | sa[k] = i |
| | return ans, sa |
| | |
| | def lcp(arr, suffixArr, inv_suff): |
| | n, ans, k = len(arr), [0] * len(arr), 0 |
| | for i in range(n): |
| | if inv_suff[i] == n - 1: |
| | k = 0 |
| | continue |
| | j = suffixArr[inv_suff[i] + 1] |
| | while i + k < n and j + k < n and arr[i + k] == arr[j + k]: |
| | k += 1 |
| | ans[inv_suff[i]] = k |
| | if k > 0: |
| | k -= 1 |
| | return ans |
| | |
| | arr = [ord(i) for i in s] |
| | n = len(arr) |
| | if n <= 1: |
| | return 0 |
| | c, sa = suffixArray(arr) |
| | cnt = sum(lcp(arr, sa, c)) |
| | return 1 - cnt * 2 / (n * (n + 1)) |
| |
|
| | def format_reward(predict_str: str) -> float: |
| | """ |
| | 格式奖励函数,严格要求输出格式为: |
| | <think>...</think><answer>...</answer> |
| | 中间不能有多余内容 |
| | """ |
| | pattern = r'^<think>.*?</think>\s*<answer>\s*.*?\s*</answer>$' |
| | return 1.0 if re.fullmatch(pattern, predict_str.strip(), re.DOTALL) else 0.0 |
| |
|
| | def acc_reward(predict_str: str, ground_truth) -> float: |
| | """ |
| | 准确率奖励函数 |
| | 要求<answer>中内容与ground_truth完全一致 |
| | """ |
| | match = re.search(r'<answer>\s*([^<]*?)\s*</answer>', predict_str) |
| | if not match: |
| | return 0.0 |
| | answer_content = match.group(1).strip() |
| | |
| | |
| | if isinstance(ground_truth, str): |
| | return 1.0 if answer_content == ground_truth else 0.0 |
| | elif isinstance(ground_truth, (int, float)): |
| | try: |
| | |
| | return 1.0 if float(answer_content) == float(ground_truth) else 0.0 |
| | except ValueError: |
| | |
| | return 1.0 if answer_content == str(ground_truth) else 0.0 |
| | else: |
| | |
| | return 1.0 if answer_content == str(ground_truth) else 0.0 |
| |
|
| | |
| | def repeatness_reward_func(completions, **kwargs) -> list[float]: |
| | """重复度奖励函数包装器""" |
| | responses = [completion[0]['content'] for completion in completions] |
| | return [repeatness_reward(r) for r in responses] |
| |
|
| | def format_reward_func(completions, **kwargs) -> list[float]: |
| | """格式奖励函数包装器""" |
| | responses = [completion[0]['content'] for completion in completions] |
| | return [format_reward(r) for r in responses] |
| |
|
| | def acc_reward_func(prompts, completions, answer, **kwargs) -> list[float]: |
| | """准确率奖励函数包装器""" |
| | responses = [completion[0]['content'] for completion in completions] |
| | |
| | |
| | print(f"DEBUG acc_reward_func - answer type: {type(answer)}, answer: {answer}") |
| | |
| | |
| | try: |
| | if isinstance(answer, list) and len(answer) > 0: |
| | |
| | if isinstance(answer[0], list): |
| | ground_truths = answer[0] |
| | else: |
| | |
| | ground_truths = [answer[0]] * len(responses) |
| | else: |
| | |
| | print(f"DEBUG: Unexpected answer format, returning zeros") |
| | return [0.0] * len(responses) |
| | except (IndexError, TypeError) as e: |
| | print(f"DEBUG: Error processing answer: {e}, returning zeros") |
| | return [0.0] * len(responses) |
| | |
| | print(f"DEBUG: ground_truths: {ground_truths}") |
| | |
| | |
| | rewards = [] |
| | for i, response in enumerate(responses): |
| | if i < len(ground_truths): |
| | reward = acc_reward(response, ground_truths[i]) |
| | print(f"DEBUG: response {i}: '{response[:100]}...', ground_truth: '{ground_truths[i]}', reward: {reward}") |
| | else: |
| | |
| | reward = acc_reward(response, ground_truths[0] if ground_truths else "") |
| | print(f"DEBUG: response {i} (fallback): reward: {reward}") |
| | rewards.append(reward) |
| | |
| | return rewards |
| |
|
| |
|
| | |
| |
|
| |
|
| |
|
| | |
| | def make_conversation(example): |
| | return { |
| | "prompt": [ |
| | {"role": "system", "content": SYSTEM_PROMPT}, |
| | {"role": "user", "content": example["problem"]}, |
| | ], |
| | } |
| |
|
| | def make_conversation_image(example): |
| | return { |
| | "prompt": [ |
| | { |
| | "role": "user", |
| | "content": [ |
| | {"type": "image"}, |
| | ], |
| | }, |
| | ], |
| | } |
| |
|
| | @dataclass |
| |
|
| | class GRPOModelConfig(ModelConfig): |
| |
|
| | model_name_or_path: str = field(default="Qwen/Qwen3-0.6B", metadata={"help": "Model checkpoint for LLM weights initialization."}) |
| | protein_model_name_or_path: str = field(default="esm2_t33_650M_UR50D", metadata={"help": "Model checkpoint for ESM-2 protein weights initialization."}) |
| | cache_dir: str = field(default=None, metadata={"help": "Path to model cache directory."}) |
| | max_length_text: int = field(default=800, metadata={"help": "Maximum length of text sequences."}) |
| | max_length_protein: int = field(default=800, metadata={"help": "Maximum length of protein sequences (number of amino acids)."}) |
| | sft_checkpoint: str = field(default=None, metadata={"help": "Path to the checkpoint for SFT."}) |
| | lora_r: int = field(default=32, metadata={"help": "LoRA R value."}) |
| | lora_alpha: int = field(default=64, metadata={"help": "LoRA alpha."}) |
| | lora_dropout: float = field(default=0.05, metadata={"help": "LoRA dropout."}) |
| | lora_modules_to_save: Optional[list[str]] = field( |
| | default_factory=lambda: ["embed_tokens", "lm_head"], |
| | metadata={"help": "Model layers to unfreeze & train with LoRA."}, |
| | ) |
| | |
| | |
| | freeze_protein_model: bool = field(default=True, metadata={"help": "Whether to freeze the ESM-2 protein model during training."}) |
| | |
| | num_query_tokens: int = field(default=32, metadata={"help": "Number of query tokens for QFormer."}) |
| | qformer_num_layers: int = field(default=6, metadata={"help": "Number of layers in QFormer."}) |
| | qformer_num_heads: int = field(default=8, metadata={"help": "Number of attention heads in QFormer."}) |
| | qformer_dropout: float = field(default=0.1, metadata={"help": "Dropout rate for QFormer."}) |
| |
|
| | @dataclass |
| | class GRPOScriptArguments(ScriptArguments): |
| | """ |
| | Script arguments for the GRPO training script. |
| | """ |
| | dataset_name: str = field(default="wanglab/kegg", metadata={"help": "Dataset name with default."}) |
| | data_file_paths: str = field( |
| | default=None, |
| | metadata={"help": "Paths to data files, separated by ':'"}, |
| | ) |
| | arrow_cache_dir: str = field( |
| | default=None, |
| | metadata={"help": "Path to arrow cache directory"}, |
| | ) |
| | val_split_ratio: float = field( |
| | default=0.0, |
| | metadata={"help": "Ratio of validation split, default 0.0"}, |
| | ) |
| | reward_funcs: list[str] = field( |
| | |
| | default_factory=lambda: ["repeatness", "format", "acc", "xmlcount", "soft_format"], |
| | metadata={"help": "List of reward functions. Possible values: 'repeatness', 'format', 'acc', 'xmlcount', 'soft_format', 'strict_format', 'less_than_4', 'correctness'"}, |
| | ) |
| |
|
| | reward_funcs_registry = { |
| | |
| | |
| | "repeatness": repeatness_reward_func, |
| | "format": format_reward_func, |
| | "acc": acc_reward_func, |
| | "xmlcount": xmlcount_reward_func, |
| | "soft_format": soft_format_reward_func, |
| | "strict_format": strict_format_reward_func, |
| | "less_than_4": less_than_4_reward_func, |
| | "correctness": correctness_reward_func, |
| | } |
| |
|
| | def get_vlm_module(model_name_or_path): |
| | if any(mini_name in model_name_or_path.lower() for mini_name in ["qwen", "smol"]): |
| | |
| | try: |
| | from bioreason.protein_modules import ProteinModule |
| | return ProteinModule |
| | except ImportError: |
| | |
| | print("Warning: Using NucleotideDNAModule for protein processing. Consider creating a dedicated ProteinModule.") |
| | return NucleotideDNAModule |
| | else: |
| | raise ValueError(f"Unsupported model: {model_name_or_path}") |
| |
|
| |
|
| | def _prep_for_training(model: ProteinLLMModel, model_args, protein_model_finetune: bool = False) -> LoraConfig: |
| | """ |
| | 准备ProteinLLMModel进行训练。 |
| | """ |
| | |
| | if not protein_model_finetune: |
| | for param in model.protein_model.parameters(): |
| | param.requires_grad = False |
| | print("Frozen protein model parameters") |
| | else: |
| | print("Protein model parameters will be finetuned") |
| |
|
| | |
| | target_modules = _get_target_modules(model) |
| | print(f"LoRA target modules: {target_modules}") |
| |
|
| | lora_config = LoraConfig( |
| | r=model_args.lora_r, |
| | lora_alpha=model_args.lora_alpha, |
| | lora_dropout=model_args.lora_dropout, |
| | target_modules=target_modules, |
| | init_lora_weights="gaussian", |
| | bias="none", |
| | task_type="CAUSAL_LM", |
| | ) |
| |
|
| | |
| | model.text_model = prepare_model_for_kbit_training(model.text_model) |
| | model.text_model = get_peft_model(model.text_model, lora_config) |
| |
|
| | |
| | for param in model.protein_projection.parameters(): |
| | param.requires_grad = True |
| | print("QFormer projection layer set as trainable") |
| |
|
| | |
| | trainable_params = sum(p.numel() for p in model.parameters() if p.requires_grad) |
| | total_params = sum(p.numel() for p in model.parameters()) |
| | print(f"Trainable parameters: {trainable_params:,} / {total_params:,} ({100 * trainable_params / total_params:.2f}%)") |
| |
|
| | return lora_config |
| |
|
| | |
| | |
| |
|
| | def main(script_args, training_args, model_args): |
| |
|
| | print(training_args.output_dir) |
| | |
| | |
| | torch.cuda.empty_cache() |
| | torch.set_float32_matmul_precision("medium") |
| |
|
| | |
| | |
| | |
| | |
| |
|
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | print("Initializing ProteinLLMModel...") |
| | model = ProteinLLMModel( |
| | text_model_name=model_args.model_name_or_path, |
| | protein_model_name=model_args.protein_model_name_or_path, |
| | biomedbert_model_name=getattr(model_args, 'biomedbert_model_name', |
| | "microsoft/BiomedNLP-BiomedBERT-base-uncased-abstract-fulltext"), |
| | cache_dir=model_args.cache_dir, |
| | max_length_text=model_args.max_length_text, |
| | max_length_protein=model_args.max_length_protein, |
| | text_model_finetune=True, |
| | protein_model_finetune=not model_args.freeze_protein_modules, |
| | biomedbert_finetune=getattr(model_args, 'biomedbert_finetune', True), |
| | |
| | qformer_num_query_tokens=getattr(model_args, 'qformer_num_query_tokens', 8), |
| | ) |
| | |
| | if model_args.sft_checkpoint is not None: |
| | print(f"Loading SFT checkpoint from {model_args.sft_checkpoint}") |
| | |
| | |
| | is_directory = os.path.isdir(model_args.sft_checkpoint) |
| | |
| | if is_directory: |
| | |
| | from peft import PeftModel |
| | |
| | |
| | print("Loading as PEFT checkpoint directory") |
| | model.text_model = PeftModel.from_pretrained( |
| | model.text_model, |
| | model_args.sft_checkpoint, |
| | is_trainable=True |
| | ) |
| | |
| | |
| | print("Loaded LoRA adapters:", model.text_model.active_adapter) |
| | |
| | |
| | print("Merging SFT LoRA weights into base model...") |
| | model.text_model = model.text_model.merge_and_unload() |
| | print("Successfully merged SFT knowledge into base model") |
| | |
| | else: |
| | |
| | print("Loading as PyTorch state dict file") |
| | checkpoint = torch.load(model_args.sft_checkpoint, map_location="cpu") |
| | |
| | |
| | def new_key(k): |
| | if k.startswith("=model."): return k[6:] |
| | elif k.startswith("_forward_module."): return k[len("_forward_module."):] |
| | else: return k |
| | |
| | if "state_dict" in checkpoint: |
| | magic = {new_key(k): v for k, v in checkpoint["state_dict"].items()} |
| | elif "module" in checkpoint: |
| | magic = {new_key(k): v for k, v in checkpoint["module"].items()} |
| | elif isinstance(checkpoint, dict) and all(isinstance(k, str) for k in checkpoint.keys()): |
| | |
| | print("Detected direct state dict format") |
| | magic = {new_key(k): v for k, v in checkpoint.items()} |
| | else: |
| | raise ValueError(f"Unsupported checkpoint format: {model_args.sft_checkpoint}") |
| | |
| | |
| | lora_prefix = any("lora" in key for key in state_dict.keys()) |
| | |
| | if lora_prefix: |
| | print("Detected LoRA weights in state dict") |
| | |
| | _prep_for_training(model, model_args, protein_model_finetune=model_args.freeze_protein_modules) |
| | |
| | |
| | model_keys = set(model.state_dict().keys()) |
| | checkpoint_keys = set(state_dict.keys()) |
| | print(f"Model has {len(model_keys)} keys") |
| | print(f"Checkpoint has {len(checkpoint_keys)} keys") |
| | |
| | |
| | new_state_dict = {} |
| | for k, v in state_dict.items(): |
| | |
| | if "base_model.model" in k and k not in model_keys: |
| | new_k = k.replace("text_model.base_model.model", "text_model") |
| | if new_k in model_keys: |
| | new_state_dict[new_k] = v |
| | continue |
| | |
| | |
| | if k.startswith("text_model.") and k not in model_keys: |
| | new_k = "text_model.base_model.model." + k[len("text_model."):] |
| | if new_k in model_keys: |
| | new_state_dict[new_k] = v |
| | continue |
| | |
| | |
| | new_state_dict[k] = v |
| | |
| | state_dict = new_state_dict |
| | print(f"After key mapping: {len(state_dict)} keys") |
| | |
| | |
| | result = model.load_state_dict(state_dict, strict=False) |
| | |
| | if len(result.unexpected_keys) > 0: |
| | print(f"Sample unexpected keys: {result.unexpected_keys[:5]}") |
| | if len(result.missing_keys) > 0: |
| | print(f"Sample missing keys: {result.missing_keys[:5]}") |
| | |
| | print(f"Loaded checkpoint with {len(result.missing_keys)} missing keys and {len(result.unexpected_keys)} unexpected keys") |
| | else: |
| | print("Standard weights detected - loading before LoRA setup") |
| | |
| | |
| | for key in list(state_dict.keys()): |
| | if 'lm_head.weight' in key: |
| | state_dict[key] = state_dict[key].clone() |
| | |
| | |
| | result = model.load_state_dict(state_dict, strict=False) |
| | print(f"Loaded checkpoint with {len(result.missing_keys)} missing keys and {len(result.unexpected_keys)} unexpected keys") |
| | |
| | |
| | _prep_for_training(model, model_args, protein_model_finetune=model_args.freeze_protein_modules) |
| | else: |
| | |
| | _prep_for_training(model, model_args, protein_model_finetune=not model_args.freeze_protein_model) |
| |
|
| | |
| | reward_funcs = [reward_funcs_registry[func] for func in script_args.reward_funcs] |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | print("reward_funcs:", [func.__name__ for func in reward_funcs]) |
| |
|
| | vlm_module_cls = get_vlm_module(model_args.model_name_or_path) |
| | print("using vlm module:", vlm_module_cls.__name__) |
| | question_prompt = vlm_module_cls.get_question_template() |
| |
|
| |
|
| | dataset = get_kegg_questions() |
| | |
| | |
| |
|
| | print(dataset) |
| |
|
| | |
| |
|
| | |
| | custom_save_callback = SaveWithPyTorchCallback() |
| |
|
| | |
| | trainer = DNALLMGRPOTrainer( |
| | model=model, |
| | reward_funcs=reward_funcs, |
| | args=training_args, |
| | dna_module=vlm_module_cls(), |
| | train_dataset=dataset['train'], |
| | eval_dataset=dataset['val'] if training_args.eval_strategy != "no" else None, |
| | peft_config=get_peft_config(model_args), |
| | attn_implementation=model_args.attn_implementation, |
| | torch_dtype=model_args.torch_dtype, |
| | callbacks=[custom_save_callback], |
| | ) |
| |
|
| | |
| | training_args.save_safetensors = False |
| |
|
| | |
| | |
| | |
| | |
| | |
| |
|
| | |
| | trainer.train() |
| |
|
| |
|
| | if __name__ == "__main__": |
| | |
| | print(f"CUDA_VISIBLE_DEVICES: {os.environ.get('CUDA_VISIBLE_DEVICES')}") |
| | parser = TrlParser((GRPOScriptArguments, DNALLMGRPOConfig, GRPOModelConfig)) |
| | script_args, training_args, model_args = parser.parse_args_and_config() |
| | |
| | |
| | training_args.save_safetensors = False |
| |
|
| | main(script_args, training_args, model_args) |
| | |
| | |
| | |
| |
|
| | |
| |
|