{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRETKKITTVGARGEATAEQAATEEGPKNNSRISNYKEQWWI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYAKDKEGLYDAGYGTRRPEVADRGNEEKVKLNVNEQQVDRF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIRLEVRGHTQSASNRKDATRAVTDGWGKDVEEYDLEARAEF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8999999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEELTHNWDEEFAGVRQTGDSATRYGVAKAVKERDLASRDRI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.769999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKEAYETITQRTARSEDNGEEWFRERAARQLETRGYTVTREG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVEEETEEWIAQARSNTDRQERLEKAYRGTGYRTFERRTATG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAEVKTTVRDGTGKDEERGTNRIETRWARTGSERAEQVSAEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQEERTESSVTEKRTRTGTAIDNEAEKWLVRTVGGAERDARG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRYFDTWKSTELAWWETSEGELTTSKNRTAKIYEGRAGTAEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDEQTGARRQGATEEVFTNNQKDKEHFPPQGYINEVRNEARR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNAVEATSAEGVSAWYKQTKTETEKTWRYKVEEDGSKTERGT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIRGYFIYTSTHGTETQKGNEYADRTAFTTTTERFTQTHAEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGSPRSKGEENNVKNENYARELADEVAARTVTISRIEGEVRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRDGELWDGKDRGRSDKAKEDVEEYVAVRENQNTTASGRADV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKIQRKGNPEQGGRGITDYGRQKEEAEARSSKEATYTTEDRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYKGEIPISTDKVEENTRVTTAAKDLGVKQVEAKGYDVTADR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKEYGSEATRGRKLKTNTVTEKWERDDFRIGQWIARHEAQEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAHEFGTGGRYDTRRTWEFQEKSNQAEAVFGVHQYEGEREN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVRGEFARPKGSEDRLRTLRSTATEFAARHYEQRIDERTAEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDERRRRGSRRKIEAATASEHRGGTYFPRLFQEVELTETAAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEFGEAERVRAEQSDWRGSYTTTNKTRQSREVYVIRVEEGKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKEFTLDATRVYAEEKTRTDEGNTEAIGETKKKQKAQFEGQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEDNRDRKTRKPTERDITAQTWGATQSEQDDIGGEQIINEFR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTAIPYIGRGKFIEFIEPEREERHRHNSDQARGTAEKKTESR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSETASTVTKYNRANERKRADRVIKQGVIYEGEVEGDNVRLNA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFKKEETEVGSIETKVKRTAYTGVTEFYSEKTTPAGARAKGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAEAEVWRNRSGEGAKWKGDYTVRVKSKQDEEESARTGKRWH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNSVTGGTANARRQEERRARENGTSLLFKSRQESFKDFNAEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.850000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSRGKQSEGSLATEKEADTRNTGAQFRLENRVFENRFRAKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRGEVATGEVEAEKTKGERHVQNGGRLRRLRQDGATNEVYF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTREFEQRNLEDGLGGRGRRAYTKVNVVQKGTAEGRVHATEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRKSNAGDKDEEYPKVTGKEARTDAKEAEKNRYQGYESTTDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYGNRTTATKDVEKSNSTKYGGDRRGKAEDEYDPKAAEEEQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVKLAVRFITKRTGGNDTYEASERAKKEETQAVYKTTVGGEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8199999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLYLEGIRKKEKGESADSGNSRAKNVIVSYIKFKVESAKPQV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEFEVPKPRLRSQDVRDADTSGKKGFANDVNREKAEIDANV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGDGELLTRKVTGTQRDPDRTAKYAKFVDREKRQATTFEGDN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAKVNGLQTEPEVKDDTLYTYFREWANGEDKTNKSATPRGRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKTGRQGDYESKVTEEKEGRQRLRYAAFERHETTFKDGSLEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFFEALRQREDGAKTGTTESKGKVRHERKTYREYEDEGQLSA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.080000042915344"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNDITGGDQTKEKKEGKSLDDEINNEVAKKLRQYIYEAKPRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEIRGGFTSQTVEEENTGRDEGTKFAAYRTKETAYTTKGSV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDRDVEYKDTQKQSEAPNAKAITAIEVDRIRKRGELGGRENA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.939999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKTLYGLEHESNTKQAKNIKKIVEEGLGDKVEKRASKWEVTV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.810000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDAEKEERTFSYYQERAVRVVVNVNDRKPTGTEGVKEEAGTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLRDGTVEERGGNGIPRERNAYGTEAERNLRSGAAVIYTTKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSASARWIKQDETVKNNKTAKKVVDQRGVEYANAKESEVTGDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNADVEKIVTTYVEKASGNKTQKVKVGDDEWKANGARAREQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDDGKFFQQDFDEEKSRSGSDYAHNKGFRKAKQKFTRDTPEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQAGFTERRSRREEDDQTEKNTNKEEDIGTAISAVSRSGSYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSADIRGFKDRYTVRDQKQGQEAGTTNWVKTLRQEAENVNVQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6100000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEAKGENAANLENQKRVDEGWDTNEEIQAGDFAEPRRRGEVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLATRTETTRQYTKTGRGTGNGWEASTVGAENIENTLYEEES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEQWTFNANKITGTKRKDKKEVGTEFVATKVNDTEGEAKGTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTETTDEKKWTRGINDEGAATVGKTGENNVKFQKEAKAKTFV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAHGGVAGALEQRTQDKRDEKVRNDKGVKTTDFGENNDVTQA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVTKEDAQKRARGKRGGTKPSKQGDDQVGQENTRTITREANE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.790000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAEVTGQANKITNTEFKDIQRNARREPVSEGDSTGRTVEGRI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIGATEQTGNADTPKQFIEEFGVRDRQEEKGAFAKKNNTRAV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRSAQVTRKEDKARTTENASNTFKYEGAEKGYTEITRIYWTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSWYTETNESQTSTTEFYAKTEIGNAAAKREKGGTYKVRIRRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEGRAEVEYREAGETNSESEANYQIIGRNTKREPGRGRGNV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8799999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPEGQRVSNIYNTRGIERGVKRGRASAGEAETEGRNEEYNGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKDSTWEAGTLSIARKQHARKENFVFDVGGTQNANVEAEQGT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVSADKKVQTNNAHKDTLFTQEGQRALGDYVTSYVKKGEDTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSETESRRTEVRERTENAKERNERGWIKNDNGGVEVYADETSA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRAVTSTDWQTVLKSWEVTEDTYENQERGKNKSTGEFGAKQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYDERAIDFKGTADEDQTSQNTEQNLGPRSRKRDGTKTQEEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDKAEVIPEVGAWLERNHRGEQTDEENRRSKFGGAEEGNHRP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSADQKEETVANRLREGKFGRVEKIDVTAGNTKTGTKEAEYTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSARLSVAAHYVQQGESKKPSKLVTEGIGKNEERSNGNTKFTQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTKENSTYQQKNNESELSRGPKGFVHVAIKAAKTLSEVGGQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVDEYKITQKGRQQQAHDTGTRPAQREGATVSETLSTKTIDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTIKSGDTTQVHDIGRRVSATQLRATTGPQGEKTEYQKDEQA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.169999957084655"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNTKEVKVNEDKKTSAQNEGTTEAQREGKTGERKEVYKYAKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAEVEEKKGTESKYDRKQYTNNEEQNEAKKKAVKTRETGGTV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQEEADNPTRTYGKKNQGQRVAKGAETLTKSFWKWASDQVET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPGLRQNEGFAEGKNQQEERTEPVFAERVGRNSDTKTRVKVV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAQIKGEVENKTKKEDSQGDNGARSSFVKQATKTEVNVTGYV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKQADGLQRQWTGRSERQITKLGETVIVTSDERDAREWTGKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDEVEGTIRHTDGNTYRDVEKGVSRWAVREYRQEATTAEAEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLYAENASERKTKDAGGRLDIKEFKNQQDSEGNVTEGAKYIT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNKVNGAHNTASAIEQRDNEKLKKQGVLRTTEEDTGDGEFQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKQKNTVKAAERQSGNAINGVLNHGRETKFQEDDDEGRETL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSWQVQAEGHREKAEKFKYIRRGGQQNIIKEPDEKANTIKGRY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVDATFQGEKQKGDTARQEVRETAEYNVRQGKRYVEDVTGKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNGEAAFRDKPITTSKSTSHNGFWEYATEIRTERGKRETEQV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTPQGFDYRVRAYKEETGETKVEEEAGYRRTTTGENRQYSA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAKGYVTADQGNESKADEAKQKITKVAGQQVNTDWRKEDGRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKRSWKPVTQRYEGPKAEREQDVNRGSGEEDFAEQNNEKGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVNGKQVPRYGSNRNGTKLPEEGTEQENVKITQEGVKARVTL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEETTQGPVNNVKKQVETVLPAGKLETSIGQVNYNEGRRGKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGQAEVKGDRTRAFKTRGYDDVKETNKGHTERQTPLQGTAYF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYRTVVEKATEKQGQGTRFTQFGPKEHTGGDRRDDYATKLAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDDAEGVYTQDHEHDHYGQDETSARVKDYRGDSGNGKKAEAF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEGRDGYRQKRWSDTEYAKYGATKEATRSEETKVTEQQKNY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNGTAWANGERKPRTRTEFRDQVEVAEKEATTKEGVSVTRSD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEHALQREDTFNETRTAGKRKIAYGKLRTTKVTEQSNVDTNG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKKWTESPTRDRAKEGYRVTEAGTNRVINRAQAEEIEVNGQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDGGSAKKNQLKITEADEGTQQTERFAKYPRESRTEYDTYEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEKRQIVSLSMKIETRGNTSDQEHAKRNTGADVTYGAEEKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.9599999785423272"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQSASGTVSNTRWEKDRDVQRAARDWGGEQANEKAERIYIEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQNQKEQIAGRVTRERDAWEANGIASSWRVGAKTEEEYRSDD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVTARSVHDKRYGTSRNTVTEAIEEGPAEEATADDINVQGSP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTENEVEGAAGPDDTTTKASYVHVATDREPVSRNAQESGIRI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEYARKEGRYERGDEAHEWEEGVERRIADRGTRKVSHASAQV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRVAAVSRSEKDWTEAEYQKEREERIGRRRGHEEAHGADGYV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSATVQTGTDRQNASSEDEAREYAQRRAGKSYTQENGTWKVQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEENGRDTYVVTYQKTEEQSWSRASAKGREAQQQGAATTRDN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEQENGTKAIYVYETLNQQSFARQKNKAAATKGKDETKVGER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYEGDGDGKNQKIPTARRFIETHITKKTAEYEKNVNELRGEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.870000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNEGYNVKEEETAGKKGESAHEDPRETKVHGRYQFENRKWRL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSESGREAERELRNTERDSGDKVFKESLVNSGDNSATQIRIDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKRITIADRDWRFERSDENTNGQDGGYREDVTKEVETIEGTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDADFERKGGVIKENRASEVTITYEDTNIETRTDQGRDREGW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFKGTSPIAENRALRAKSVIDQVGQREQPKWNETRTKINGQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKNAWRGGANGATETKPFEESRLVQQRKINKPTSDRQVQIEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIDGKQRASEEKIDKTKDATHFVTDGPAQKGKSKAQHAEYNT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRRADTEGESEKVVRFERVVDKAEKTGATQASADVSRPTGNA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSARTVKYWDNEGAEKTYEVGEGGVGPSKNENKAEHKRRMQRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVQWDAIREQVKRAYTKFSTEGQNRAEPNEREQTGSYATNSQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSASAETVYKNTHGKTDNRWEQVGEKISVTSWTTEASDAKAKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSATTAERFEQDVYRGGTAEFGYKEDFEPPLTNENKRVTATAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTGTNKPNYRNAGTFESPRREGTDEVDGEAYRKRVTAEVEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEAEPYKDASYEANAGRPRNVTTTKVETTFGRGTEERVRDN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQTFRADGTDGKVGRDRLNTKGRENADADEFTKRGKNYRAEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRGDEGANGDRTKKKDAVFRYQGELRGTNDAVRDRKFTNTAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTNTRSSDRETERREEVEDHGAFLDRNNARKATGQEVQTSAS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFKVKVREKKPEVLTNYTRRKEGDRAGGERREKKGTDAEEDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVITEGEGNTQKAKVEGEIKDTYSQTVADTSYWERRAARRKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEEYKETGPRRATQFRDATGDGNTQDQEDRTTENYRTFIQTQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSHRIETIQETAEAKRKEKFRDKGQEQGGTRFRTTASEVEAKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8600000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSARGRKVKNYKNPDDTEDFERGVTRGAAEDWKQENVRAEKNS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSWAQETRGRKEREDRTANGPGNSVVDYAKFNKEVARDDNKKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVNITNGREKGRAVQAEEAIYETGQRNTVQNEDTQAEPQPTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEIQNQVQGRETPTTPEVTDAQYNVERERGKNGNAQAEAITN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRAERVEEWVGQRKNAGPGTQNGKETDEANKDWEGYEVHTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSARIQRFDKRTQVDEKEEPKEAGRTFAGENASVKIHKGQTTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREIYRVVGAVINIAVGEEDVRATREQVGPKRQTETQEREAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQALGDVKSAAEGTRNVTREEKEIYLEEAKENVAAFKNQRGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGELEWVRTQSKGSYASQLQEAAREKGLRRNSHKAEHVKVDN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSWYNTGNPFAEEKEEVARSRTSYVPTTREETVRQRQWRGEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNKWEVKIEYRNPNVGVLKAYGNTKRAGRIEGAEENQRERVL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEIKGGKKEVKVKRHTHVYEVGNRPLAGQADISAEEITFEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.870000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGHQVERTRKIIETEFALGVKKVVGTKEEAPNGESYDKAGHI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8799999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRETTSKNAKTVREYNTAETADFGYRKEAKRVEGARGFEGLD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTDATKLGGEERPTREEDAKKRGYKIGAITVEESLKKAEWRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYIERKGTEDKWAKTLPEAVGDKESKTAETEEGRRIGLTKRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.829999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAGKVRFENIAKTSEEREKSEQDRGDVNARVTGRGEGHEKKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRENPFEAVKQFKPQALYYEGETIKTVTKKETTPGDNGDRH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGSFEEASRNERGKDKQTARDLAKTDVPKYVKIRITTARGEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVNVERWEKTEKLSTTSTGTEGAENEAVTSAKKKGYTARWTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSATIRARLRSSEIEEGYRVEEAGDRGIVTTANAEVTRVRPDN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPEGRKSVKTRQVNKYQEAERIGKSFDATKANTRETEARVKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFPKKSAEEKSRYGATTNVNIQTKENVAAEERRDVRQKTRKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERANGNFETWDVKRVKTKQDGNRRGTLERNTNSAKEPQADP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNTAVGPVNEKNGQRKDGRNRPTDEAKLNEAKRSDRWTQTEF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKKVHGIQRTVDVFEYRANEDGKTGAAVNELDEKGTDGRVEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNDARVNFFRANREDVTQGSKQPRYFGVTSGTKKEFEAEADL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKLTANRDRTEQPWGWKTGEEEAELQNTTDDGTERLVSRAFK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFNINGTARDGRGPQQNETKYITEQRTGNERKDDTPEEKDRL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEETTGRATNTYVKDGKEGKSYAESTFAKRWRSTEVEIDWKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRASYQKRETTEDETVAGKQGYWERSVAEVDGVSHVTKEAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTLEEVEDSKYAERTQEGSSTAKERVFHNAESEYGKGRNNV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRREAGHTEESETYTVASVGASKDSKRLEQNGREKNYFEVNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAELRINLTKSQLETKEHGKYVIDEGIAEKATQTGHDIDGTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIESTKTYLILEGEEGGDLHHRKETTDGNQTIGKVAADKQAI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRQDTTVETSAKKEGDFVRKGGNGQNVRTKWEGKFQEAQASD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEAYGSKKERKADRAQHFKEWVERRPPTEERQSANSQKFRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGATNDAKERRGRKGKETKDVKIETVPVVDETGVLESRGRGT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFNVRLVQIKKDYENFQARSPAQVEGGVKERHEGNKRKNGAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIYGEAEIEDRTVKNRNTGKQGEYNVIVREKQTTEIRKKGTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEGEQAKDTEKRNKRARSGGGYTEEHLVSAVTKSDQVETRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIVYRTESENTAGTIRKKKVERIESVYWTDIEENNGAQHAAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGQAQGRANEENFWNVETAIKRGPHQQQGNVEEEVRYARGRF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSARHQINNAEREFRWAEYRNQVEVNGQGPTGEQFERQVKAGG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVEFQRRANEREAKERKTAEKVGQNVIASRGDTKSGQVNAEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQAVKNTKESAEEQESREEQTVKARVRNKVFRGNDGAAIRGA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVSIEAERRTEEINDLTRGSNGARRIWANTAQQNEKEARVNP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNTGAIQNIENRSERGPNWAADKRATEVNSAETIRLEVRQRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSETSDAEYKAGAAVGLTAKRNQKIEVKTTNINQVDKKPGTEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRPNYESRTPTGRNAEADRDTVGGSEEKVEETEVKDTYTRIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGHGKNNVHKLSGVTESQRKYPKDQQAVRRGTNTATEQRGEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNSARWIEIVAYRYERAAKRTTEKSSGNGEDTWELEEKIDGG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAEGGEDKEEKVRRRTEYGTAVVTENNKLRDIKGFEKRRGG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPQVRRGNEETKGGNEADRANKEAQKDGKPYTKTGNQSEVQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSANGEQVDNQNRVGRNPDKPKKTGRKEAQGYTEEAEKRTGQS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNVTVKRGQGTSDNQYKAEQAGKNGEREEDPGKRRQKETAPN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGTLKAKVKNTKADEGNYVARRVSNTTTFSEQQEGEDGNGEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTERVTNGQNVAGEFKRSEEYKVDKTGKNTSGALNQAQEGDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVRATGEANDEESTSYNKGTEIFKKRVWQDATDEGREVYAQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAVKFDTRRVGYTEWGEQEKSYDEGERAQNAKNTSEVKDITA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVEGNEEAKKEVQVGDASARKNVDKEKETVKGDETGQISEKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKLNFAFTKEFETKTTGKWKADDGSSPTADKTQKFKKRGERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEFSDGTSTDAYRNKQEVNYGPKNKVGSDISDKAKKVTAKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGDVVTTRKTEAWGQDEAYKAERQVLDRNSNQELGKSRAKRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSESAAVKKQGVTESRGTERKVIDQAEVQRKDEIYEARDTRGT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKEVERYGKSDEGTRADEFGNHIVQKDGIEANEEGTDLKPRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEGGREKEITKREGAEDSKFGTVELDYHRGIQAENGVNKDPD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKWENFSTDKEGRSNTTVTTGAEERLATKIKARLRRVEWEM, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVRGGAAEKFNIKDEEWGETVEMTRRSSTWLRTKAKTTENRL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIQIEDNGQEVTGEESKDVRNVVTRNGAKQASEDADQWRANK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVSNNRAREAQDRDNKGTDIKNKWEVEVQEQTADGEVSQIGA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKTSVDLQENTEGGVAETDNYNAFKEGKARGKEQVAEKWKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLYVAGSEENRNENGDEERRTGNTVAREESQGIARRKVEREE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSATGYAGDEQYEGDDRYPQTEFNQKAVATYKDRRVRTGNYEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSENARAEGEEIREFEDENAKNTVTDKIGRKLEQKKGKVQVKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRVQSNAETQDATDVKSWKEGPRKTVGNKAEDDFYELTEKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSETARTINKDNKPADVGEDLKEEAHKEKFTKRNRGEKARGRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7300000190734861"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAPEAAARRGGDTDHKRDNKKERFKKKGNERIGVTKEELNTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.179999947547912"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSENATEATRREQETSDRESKTLGRTVGIERNYEKVDTIEGKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIREELRTRASSDGYVEGTTNENKVEEGDERETISQTKRKTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGTVKKANEDQEGPKREGGTRFARKNWLKTAQDSADRLKKEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPRVTQGEITKQVKQINTLNEVVKEVGADDAYANGEDVDASE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAGEVYQKEVADNESSGKEEHHERTQRTRRESRAGAFGWSND, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVRWKSTLQRETFEQERKLKKGATEEGGTNANSRYARFENEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFTLNADYFDVNGDQENRAEERGTRAVLSTEEHKFTDATTKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVTARETVSERNKEGKTPAGNKIDKAGAFLEKETLLSVNSKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAEGQGNLQRERVGSDTRGTNKITENPVQEASYDVEQVKARA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVPQTAEQGVGENVDQSEYAERTSNLRVRATGNRIGEQADKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEIRFGRTKDEEQDTEYLRKDARKAGFEETETNGRNWKFDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTGEGYKTNALRKNRTEFFDEAQRWGEDFRGRATDKDIEEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKAAYKLTVGREAANYNVGEEHSAEKGKGKVHTTVQDEKTTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKPEAYGKKDQVRTTKDWRTGISSQFGEDLDQQKLEATATA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAVTEEREKTRSAGQHPGLPKRGLVATVQDYNVEKFDKDYGQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8999999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRGVVESTNGKAIDNAGTEGQIKRQTKRVTDAKAISREKDFK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRSWRDANKTQKVVTRTRGQEVAQSQGGQDLTERADDGQFEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGDAAQNQVFYTTKKGDGTRNKEEEYAEEENDWYPKTEAVRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAFGKSNHPVRNDGRNAERQETDQYHANFGSTGQVKDTEETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.100000023841858"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRVYWAHETRKGPRIEKALENGLEEEKVDGQNKVKTVDAHP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGDEVGAEDRKEVTKLTNGGYPHAQNVEEVKIWLHRKPAEKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSETIRTANEYKTGKKDKTGKQGLERAVANEDEKSIDTTRFTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKTNLYIDNAKTTVKGETESRTATFRIDQEDEEKKTGRKAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSWRPKPTADRGHATEQDGEEAIYDFARGNEDKTRLLKIQGTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRKYDTKKTPAEGLDERFPWTGAQRRNIRALDEDHGATEIQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKKDELAKVDREEKQVDATTTDYKEAKGREDVKVKGYEAGGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.870000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVKTENTLYPGGREDAENVDTTEKGSALGHEKKRAIETNYNG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.9200000166893"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTREVENEERPKNRTGRAAEKPKVSEYFTQAGGLGNVKGEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSARVEEASNTVKLAESQTGKNGPRHAAGETFRSERGTVDQED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEVTKDEKTQSSTTGAVDGTDVKRDVYTGRVIEAAKYKTGSA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGSNENRKIKRRKYSTRGTEKSNDTSNSAERLVVERYYAENL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKKAQGGRQYKTVAEDTQYTDGIENEFANKRTTDATDGYVRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYFAKTTTERNYVGGKAIDTAQKETAKGQTVDRREDGQDGNY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTNWRFGTEHVTGDTKKEIERVGQKGAGEDVKQEAVRVTLKF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSHWLVTKKEAKTGQIGVGGREGAFDVTKVVDRTEERKTFNEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKAEGASDTKRQTENYEGRREADDKGLVSVTETGKYVEVSI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREVKYVRASDAGEAEKGYEDSGVNGTRIKKDTTVEGSTLEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPTTAKRIIREKKDVEVEETNQKDRSHKKATAEDIGRRQTGG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTQRREAQEGKREQRKRNDEEVLVGFRNAEFEGVIAETNVYP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGNPTETHEKTKDKSVNKIVKERPEKDGRKANTTEWNGKENA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSETANERFEDSTERDIDRKVEKLGRNKVAAVRRTADEGEPEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEDNPKAITGYLNDFRTVYTEAQTIGVQTTYKQGESKTGRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIKVRAEVQNSKNGQGREFPDEGAYKRTLNENEQVAQERGKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAQQPGNGERAKKEVEQTKRLVNKNLGEQEFNARYSGRIVED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSETAKVTAQEREATRVTYGFNRAGENDDVEGKRQGNEVEAET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKGANEREGVNEVRGTEFVTAAEGDTAEQRKVNTAQERTDY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREEESARRERNGGRGKRGTERVEEYIVDDVTKYAQKTKDEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERVRIGEETAEVKNYRKGKTYAEEELGKEVEKNAKKAKFRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFYNAKGKLEETRVKRPAGKDTSDQQPKIKTDENEQSPQGTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTQVRETGEQQERTKGNKNAKNGVKESDLEFERTADRGHVRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSARVETEWDRRSGQTEEYADEGAQRDGVEEVEVSVTKITGRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEAYGRDESEKEAETKERNRLRHRVTARFKNGEQRQYQRQVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGNSTKKGEERKPKTETTWEEELEQKVAREATREAGQFRPRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKVAEFQEATWPEEAQERETGLERKKKGSGNTEGERKTTRPR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLDANVDFEREKHETGNEGGQKAKKEWEPNLHKYTVTGNFKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGQTVEHSKAERWNEAEDLNFPKEVKGHTNKNDKLETKGYGF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEEPRKNRFAEETAGKKDERGSLGKGYDRNLSWEAENRYEAS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRARLEVEKSKGRTEEIEHKGYEEGFVRSKKRDAESATGNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSARGDIALFDGTFVNRTAKNDGKETIGPKTAEQEKVDANGED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRKGTATFSTNRAGKTKVKQDGNNTAEPNDKDDYWRTVEAEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKRPERVEQTITAATGTEGGEKSLKNLNGVVKKRVEDATVKP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEIPAKQAGVVRTNETKTKEPNTEKVGLRKDALRGSVEVGKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNEFRKQARNFRVDRSDEEEDPRDGITAEEFRGDVNEADVTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDNRDEERKAANQRRDERGAVEESPTFVANEIFVDTDFRDGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.470000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTESTVGNYKFSSSDPNAKREAKEKAGATRSQRDGNTETSQP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDTTFAEQSAETTTASGDKRPKNEVAGQKKYSRPENSRSNG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRAKLELDETDRDESYDWTYKGKELALRTEESQGNQARIDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGFEWVNDQRYDKIRGQEEGQGAKAKQVYRVRRRAIEEAETR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPRVHINGEERETDDPETEAKEYAREQNAEWRKDGEHIEVQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRRVRVGTETVTGDSPEIREKLKKKYNANQETTKNGQTELRP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGTKRQETTRATIPYLRVPRKENTLKRETNNVGEKVKDSQGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNEFEEVRRVNSEKAARSRGVEEEGAEGAIPVTRGAISVQVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERGNRARNETRGHYAKNAEEDLRSEGAPTTQYRTISGDTHG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSADYLGWAEKKEYDGNEDENPAKATTKQYETKALKGVQKVSK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQRVEKGTQQRRLIENNYAERKGQNEGVKEPYRKAETFEAEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKKPEAKKNVYETQQEQTAFRRERNGQERNRYAEEGGILKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDDIKGEVESRKATRTTEATTAFTSKAGEEGEFTITQVKVER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.4299999475479122"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTAVEREIEEFVKEKASDTITTSEQRKETGVAKGTRTGTFDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRDGSVEENNRNPTDINRAKYSGTKTAFREWTEKVESATSQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVDKQSRGEVAWEAESFDRNNENENYPRRSEATSTTTKKTGI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRLQAEARRIGVVRNTTDGTNKEVFATAEKAKGYKNEKDSKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEQRSNDDEEARQRYRASRVRQGSGQGYPAPNETKDAFFTPT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRSVDKNTKEAKAETIEKGAETEGKEKWGKADRNVSDVEVRY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVNGERAERNKYWDRETRWQKGWRREVAQEARRDGDTARDNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEVRAKGERTETREESDFKRSGEHEGVIRSSNRDGNLEGKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGKETRGRDRSEVRENGETGATIRSKFLHEVDGSENKETRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYNLQRGTEYTEVEKNETAETRAETAGANKIRATGNQVRVER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTERNTRNGKTRGAAEEERQEREAYQVAGNTYTIEANVKTVL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQEAYGNIESTRGSNTTDFSRELTTPLATYENVQTGELEVNA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDRFEVWTTRGTPKERRNEDRGTTRAAGSEGNRQRISTEWYA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLEDTASSHYYYAEAIRTERNGQDGPNNPRNEGKKITRNVAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSESAETVKKKKEVTNDRKISRGFETYKRWEADEKGDQGRATR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKVRKEEKEEDKREKTDFVRRWTKSGNAYRQTGKAATSGID, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAKLEGVGATEKLSEQETVTRFVKYQALRRQQENKGEDEGRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVTGWDIKEARQASRKGTTVGNQVRNAKEVPSESEWTLKKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.870000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVKWQEEIDSDEGENTKNVTEVGEREAAEKGRARAYRVKLDN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAIVKYADTVKDEERWGNEEDVKGANVRRREAELSTENQKGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTDAEGFQYTGTLQQQTNVSEEAHTIVRGQEEKEFKKGKVYD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVITYTLYDTKQGEREAEEQEQVGTQKQAEDKHNVSFTKFGG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.210000038146972"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYREHEDNPNEKFEELAEGEKVLRTQEGGTRLSRRAGNRNGY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.680000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKTGAGSTRATTVGQYDRLKTNRNIDREASVEEAEFQGEDRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKEGKVQGNQEKASRTEKVEYAIRYDLPQTITAQVERGEANV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKAQQAKQTAVQGYTEVLRYGRKEKSGIVEEVEPDRNITNA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEEIKGRGQEPQRRKGYDFTQDGQKSGAGTANKTITTVSVTV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIEFKANAREDVEREGHADKPFTESVGRRRASARKRETFNQS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEVDIARRQGEPQKLRAGTSAYSQNGPDETDTTVKNVRVTF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVKDQTATYNEGSAARTQDRIRGNGVQDRPGLTKTFPEVESV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEADTLGRQDRVRTETSVETAFSRGVEGDGSDRPYRATTEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTDTSETQRDGRTRGLIGPRVSYTSAAGAEDTEVFRREVDES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTGVPWRASGKEEEAQDGINTREQDKRRRREKFQTVTRLWAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGDPTEVRNKATAYENNSGTKRATREWGTKVSTEEAEDQIQN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKWTQARRTLYVVRGEKAWNEGAETKTNKPNKKARHGKIEP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSETAGSVPTAEVRETATTAGYNSTEKDRVDGEQVIWRENKSK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTDKQNQKALIKRDDTGESDKAVRKDNIGRGAESARRTDQYE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVEGSDFDTIQTAEFKNAQGRTSPKGTVKSATEQQTYVSGRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPEARGRASEENFETARRVRTQPKKFFARSGTEEFHTGQATV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEPASVEVRQEETTHPKARRTSQFGGTGAFRRNTEARAEFFK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAEQDLPKRKGSPFTTENTDTASSSGNGRQENSEARTKEFRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTENTAGNDRGEAKKRPTPARGFNQSFESRKAESEDLQTTSS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSANGQSRGAEPELKVTRQVGVTTTENNTFDADWKHKYQKPE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIEVRRAAYKTDVETTESVERPITQGIGDEARKNLETADGKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLTGREGNEEKEARREENGDEYARYEWADSVQRRVKSITEKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.790000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKRGRNTHGKPEKNLGVESEEVFYPGKRADAKSAKNVKTQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQRNKAEQVGEVREETEVSPGKAKNAYVRGDKKQATDWEQVY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQRATNFEKEGDAPNLHDGVKTEVRYQKKNIQRNKGRGTAEW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVVNQPRAGAEDYTVAGGDDAGRGEKQEEVEEPSRKRTATTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPNAKWVSTEATTQQGERAQRKGDDAVPDTADNTGTQFTISF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPDAVDDRAFATSNGTTATRQWDGIKQEPVTQFGQTTAKNSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEWTKASEEEKGGTNGREVDRSVQKKVKEGETKASEPEWKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKTKAKNPSSGETEGVKEEGWKWEVREETGREQEKSKKVDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDKAQFVYDREEGTNGERYAENRLKKVDGHNTEKKIQAQGET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKNKTGGYKRKAETQFLEDQEAVQEAENRTERKGGVIDYDNH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKGGLEATHGAISSTEFTDKRKEHYRISEAEFKADQTAFNRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKGTYATDRANRSNDQNIEERGKDEFTRSVQNQAEKKTFQH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAHQGTTRAVEAQADITNSKKESGEATDYRWREWSFRTEARG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAAIYRLEDGEEEVKQGREQETGSRTTRGAKTHEGPTVNEGV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKPQAVDEEKNEANTSTATRFGYRQVIRTESYRTGKERVEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEESPARTVEWKPIAKVDGYKVRSVEKGARLNDKDRGRTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSETAYAARDQKQGRQETKGTYGVSTEVAENYTRTWTSTRGSV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQSTAVSRTDGKGVRAVATGSAEYQEREGTKTTREWQNTYYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKEVEDANNEVTQRRGDKVGQTEAERTGRRIQESVSQIDATK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNETGEVRKDVVERAGIRRVETQIKNQDQSAETETDSGRQKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYYGRATVTKITATRNSPSTTVNEEAGGKDTDEDANYKRTDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTDGTDGGENATETKAENSRAADGTYKPYVIYRKDTSTVRNT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEKRAQERAVGNQVKGGTEVGARTQNKGEEDDSRPVRVAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYQVDSNGEHYQASSESEVRQIAKDAGASTSEKRGTEFEVHT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRAGSEYEYHKKDSHEFVETQQGTQGVNDAAARSSSVSEITE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSETAEVVKQRSTIKERSQIEEGWDTKFVQRGEETARTAKGKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNTGQEATTKKYGESVTYLERVATKILATDPSRQLTKLDGEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERGNIYAEKQHGEQGVYEGQKKGDEKVRKAKRDNAKRQVTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQIEREKRVGEQTKEYVKYKKNNGGGAQKREGRVHQAAADKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTSVDIKAKEEYAGEQDVLTEIKTSPAVTDGNNTRGKTRLQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIEGQAKIERGSERTQNDGRKTARDQAVEDREERIRSGKVRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRKEKRRGDIKIDQQGTRAENSGEVEIRVREARAEQGSEDTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNDGEGTRRKADIVQNKISEEVESVVEAEKGKNDKVRAQARD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKRKKKEVRNKVGREEADGAISANDRVIGDSAEVQEQTDVEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKRVTTDEDWTEPDVEGGNIRDTRYARTAQDVPRAFVNKIND, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRDKVTVDVTRTEAEWTVKVEDETTIGKTGEIEATVTKAQGD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRYIQSAEEKSTVHQRTKWSDGANTSALYTADEKGTEGRETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDQGQQGTERYRARKVATKGKRDVREEAPTARQDGEELNVTW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNKWKEKVETETVRYSRELRQAVEKVAARKVEEEKGDGQATG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKVERKETEEAAKKVATVGYKNKGDWEQLSETQGEAVVRRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKRKGNLKYRDPEETDKATREIREAFPTSQERKGAKGTAQA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.930000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYDGSLAKQTEERQNRAETKIRKAKGEPEARFGKRAPTDGTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKYLNEVTAKKTIREDERGRKSAQTAVGDDGSERWDEARING, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGQGKEPDTETEAQTEQTGKEAPDSRLWYSVKSERFRANEHV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFRQEATQDATQNGFSTKRRAQGSTAVGNKLTRTKDDEQVQD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKSVKGGDEEEREFNGTTVWTNAPNKARFLPEKRQAELQAKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.980000019073486"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQNPKTGKENTFELRALWASRKEAVEKEFQGVGEPADKATRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKGEIVTPTVKGENDTDRHEAKRWGVGQKERTRLRDIEADL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTNEVRDILIGGRETKTKKRQEGFEEREPAARETPNKAKSNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSANWKDKAKSTNATTREQGTKGASKDVVTTIKFSGSQVNPDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAKIRAGSETVEWETNTEVSKGARTPKVVELRETNPYGRVTQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKGVRETTVAGTEKKITGVPRAVRYSETLVETAPWSERNQNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQKPELLKREDQNEEATEGVQTVRTRNGEYLTKTVDKLHAQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6100000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEVKKDAEREQAYRKSNWETGVDESVVDSAQGQAHKINVDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIELEASGNNETIAKGKHGADEVVERERGTFKKNYPKVYAQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVLRGAKEATSNSDEARHVVDTRKGKRTVVAEEEKAVVDTRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFPAREGNGGRKTKESLKTKEQTEDIRNEEALGEQPVRQKTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.299999952316284"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVRDEAATFAAKKNEGNSQWKEGSSRRRARSITTTRQSGFGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRELVEQQGHTNGSRTREEKEKYVRGIDGIREAAAQQEKDTL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKRATHAGSGVNDVAWEAVSGKTESEDEENYVREARAQITTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEVKRASKRETITDINDGQEVPRSEAGQNVEARVREADVRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTVYTSETRAEDRRQEVERTWQKAREEAGKENPGRPFEGTEW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQKLEGVGRTSQWKQVWQEAERELRRDGGNDERQGYNGKVDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREQREEDVEGNWLQVQEQNGGRGRSKKTDDGYLGEQWVKAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYRKDVGRYEDEAVEDEEGRTGASTRFATTAQQTGDEIQITW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDATGETQEFEDVEEYQYTGAWDARIIRGREGKQTTATRVSD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTVTLGEETVRPGRGERNAERAFEREGLQVTGHWQEVEVEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSETARVTVQQVRHEFEARGEGLGAERTGEETWNRPELGVREV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNEYEEIYRTAGEAREKDAGEATGLNTEYRTRRKRIKSAVSD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGGVEEPRKADNDIEDTEDNYGVENRRAPYNNKTTTRQFKRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKWYYAKTSDRGHQTTTIETFGQEIAVDSSETRGRRIQAEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFKATEEPYEHKPAYVESNGENRIRKNKEPYETYDANVQVRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSASFSERTNLDKQAGNWKGAKGKENETQEKKRVKTNGETRRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSATVTLDGKRTNESYREKDVKERGHKKAESVDKEGDETEPRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKGSTRYDTENAKHSKVRVEDKTEEEEVVRARLKEDGGKPTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKARIGNEEHNAYRTETGRKTADKGIGNYAETTKFEVQLTI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.289999961853027"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAIKNAGRITRLHEEDNYTFTGTAEGITATKYEGKRQVNKET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTVNAEGTEEEAPDYKGRTKIRQDFDGKSERDHADDAEFNA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRVEGEGKEKTHNTGTNAVKERVTNQDFEFNSEAYRIRADV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREARGIAKTRIKRGDEASYKKRVEEVARNETIGTDALSEDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGYVEWVKNRDNGQVERLQNRGTQKGGEAYETKYEGEYYGSA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGYQGRSGQVEYKYEDGRAKTGYRGNTKLEEGNVWQANVEYE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKPEEAESTNSAGRPNRVGEEEWRRQAVQQTNKTGKQYLYG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRYRNKLTQQEAEDNVAEGDVRIEVSLAGRNNENRTRGEGVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRNASFRQKRQEVTTAKDGWRKTGNTDVVKAKEELETGYGTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGARRDIVEAKQPFQIKDWTQTNTNEDGDTVFEVLRRGDKAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGQVTIRAKEENVTNKENGRDKETTGVATRVREEKERFTLTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFGERRLEKENTDETNVEVARKTNTGVATKVKIRTRAQGETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNEREGKFFNDEYGEATSKDARGDRTKQPWEKESKGYTKKAA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSARATLNTYRKTGDRTSRVTESANDRVVQRGSDKAYQLEIQI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSATVEGEGEERNVREPHKPHKVLKEALAEDGHYDLRTIKASR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.870000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRIEQRIDFTLPRHGDKAATSETQGAEQESEAGWDKEVLTVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKQKREIAGRKRERDSYGEETNRVEANNPNGANRKLDEQYE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRNGEAEVDNESGKKAREKVHNKVENQKDDAEYKTVENYVQL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTGTVNKGWGLHPRGKKEREAEVDHTANNAIEWTRRGRKAP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKDVNVRLNTEDNTEVTKEGERFGSRVEANEKDEATKITPRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSASKVFTKDDNELTNEENEGNKTDVRKVPRTGREIVEERATG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKTKKRDGTRWRVEDRQNVQEGANTSWATRVSRHEYKAEFSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDNKRDRQAVKAKREENVESTHEYGAWRTFTTKQSVSEWGRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRVSRRARNENGDEVREAGRYGVEREALRVETKGTETTGRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTDREGVANKATRSTVVEGRREVREGRYTGEGRRNAEGLVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYTVRVDGEDRTGPNAIKKASEEAKQNNKQFTKSGDKQEVQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSATRKQVYGDDATKGEQGNQETPKKADNQVGERKNVEIKFSS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRKDTTKIDRLTAKFQVGKTSTAEEGNAENNKVQNDFANFRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSADFTTLKEQLERQRNRDAREFGDEAGPSDGDERPTRVQFSA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSASVTDVRKERTGFETQAPRYAGKQRAAEELKGNISSARDEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEGRARAIGEDDTKGGVGETKDNERTALTITEREADQFKDAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDQAQLKAETTDPIKSKGGNEAFKKVILKEGKQEARNADGEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVADKSAKQFQTEDLPAGENEVKGGGITKLIAEKQNREKAKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSADIEVFTEREYVQEGGERGNRELENIAGAPKKSVRKPRVDP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREEQRIVVAELRPENRRKSVEGPFAYEKGKAIENPTDVDGG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSATKENWDHEKQVSKPTSGLDRKVTEHAGEVQTDVRNPYGKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNVLTAVWTVDDKGPQDEERYHREAQPKVTNTKKEGGKHSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPTAEVDVGRGHKDTVERIREDAKRAGINDVEKKEIEFELQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.910000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLQVGEEWEYKDSPEWQRSVRKVGKAADNHGEGTAARERRQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKFEIIRGADGQRHSEEVAERRSVNRGKKDKAKQETEFKTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREATIPTYTYTAKSKQKGNKVGNDRVAGQYYESAEEPKETI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTAKVEAKTVNEKESEEGQKAIEEFGITDVKKKNGDGEVRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIAFEKNEELQNDSKKEQKQINTGAFKTGNTRFRVLAEQGDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVDWTWAQQEADGDNWFQKGKTGPRTNTQDVREQITSLEGKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKEGTKADQWWTKQPQAVDETGGRQQTNVRWLENFTGSADDI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAQIDEEGERKQVREVTNLFNRAIRNYRAETYDQAKRGNGKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQRNKANERGRTKQADYRVVAGDNIERKELIFEGYRQENATG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTAESVSKEEEARRKSTGEEGGNRYVWRNVYTHAREAEEKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEGAAINTEEQYKTKVNRSREADKKQIRYHEARVNTTKTNGD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSESANTAYDEGKATKIKEAKQNADNQFGTEGEQRAKDIKINV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEAQKKSIQAFEKKKANGDDNETAKNGVEYEAGRQTTINIDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQKAKRKFNRETKDSVNENVEEEAEERQGNAREKGKKVSGTQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNDVTEGLGLTRSWYVEKDNSKTIKVYTKGKGKYEKAEVAAY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTVKDGRRTGRTESADTAGRTKVEKNEVKPEENLNKWEADI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGGASEWETTVVRENLPERKDRERADVKTAENRTKTDGKKNI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLSGSGNINEYHRDTSRTGYNGITEEVARKERREQVSQNWTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNTTHGTYVAEERETGLNSEQSVGINGSTNRDIQEKSYWRRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKASGVPKRRGDQNVTRFGYNKQKVEVGADEDVQLFTPQQAP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPKPREGRWESRAVTGHNDGQKGVQYYAGTFKEEAKKVEVQS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRELTEVETKATETNLEKGGRRIARETAGHLKDNRLKVEGDD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.769999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRPSQAEFGQGTQEKFDTGKARSVDWAHVVENGRDRKGKKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNSEIASERQGGTYWKSEKFTRRRLNTLILESEARKEQGDRH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREAQVNFARFKVLKDRNDDDGKERPDGNKDETEAEEVRGEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGVGEQGDEDPRDQRGRTAQAVETGREWDDATRFRTNSDATV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGTVTEWGNRGQESYKESADRRPKNELANSAEKQGRSVSETF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNGREESSSGGKRAVGEWTTTDSVAAEKQQLKNNPFREYRSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKRFREPDLRKQIEEDTSGRNAARRQGGSTVTEEEKRFEWQA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERPFTRASEGQNEAKRTRVKDEGKREWILEDQTSQRAFGER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTDNKQTADNAETVKGNDSVRKSVKEEGTTVRQEGEEGEAKP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEGSKQGSKETFYKKREFRKAVERESVGKVQTKNAQWTESD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRKATGTIEDLIKDTREAVESVANTQVGRKDENSTGEENPRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSLTKESEPNTQVQGGEWKAAQGNAKATRTKYSEDPTKVLEF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRKEATERGVNEAEVQASWKVKVQEEDKEGRKERRIRVASGA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRNIRFLRERGRVARYTPETRADTEGEGEREEKKGKELNFED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEDDQQENKATRTRNEATTGTGGNRELATTWYDRDRRGYATF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKTAEAGFTKKDGGRRTAKREGNETVVIEEDTKTRGRKKFRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFFKKKEEVGKEDGIGGATDGTRVRTGRRKKKETTANRTREA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNTFTIAEEELDGPKLTKARKGEKGTIARRFTRRTGEDNVTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8600000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAKNLREEEKRGGIFTNDGEGKLTTTRDGARETFAPITVRKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPRGRGATTQANGTEDKVRNSATTAFNWKQDQEQAITTEFEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNGGQEAREDGEVSNATYTFERTKKYAKAELVTKKEAQKLR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRGKEKIGTISRDSTNSEKERSEAQKKNKSNYDGYGTTEAYH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDKTYWTLENKEAGNGEEGGSEYVRKRPKDVKQKAKEIEGEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKEVTVGAYEFEGGKDEQVTKAKNNAIAERNRTQEPTGYIET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKISKGRDEAVAADKVTAARITEVRETYEGRQYEFSTTQSSG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQNGENKVREQNPGYGKEGAQKEGRYNVGRWQYETVDATDKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNYGAEGGYRTKNRQPDKGVNKRGVEAGAEQKEQYVETWDNQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.190000057220459"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKDINVVKATLKVNRVKRQGQSGLNHEGGKVDEKGRDAEIEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSHELQNQKIKDERKVAGVVSEKINENKGVAGGGDRVKTDARL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYTVRQGTTEETTTDAQTEAERRAREQNGKVETRGKEVRVQL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQNGEEVETQERETYVETKATERVTQDTARGRKRLRQVTATG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGQANQATTGVGQRAQSVDKVAVEKYAYKKTTTEDRKVNIRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFNEKSRGDSDKARDSEKFESDERYAGGQETTNTATKTRGYG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGQTSTSDDNFRSKEYAADTKRGYGETGSRTKGDNEAKFREE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPEARNGKREDTGPTNEEFETAIERTKRLEGERDKVSWQAYV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEGEEWETKVNQKSAGATGKSAHVTNRREVTTYDKETGKKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQHGRGGRKTIDALQSEGEEEFQQKKVGNEHDRKANSVRGTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTELKWENITVRRNSTDQARKEAKSLGARKSQSDGNTEEFRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKTIQGENVNARERTDDRAERSLTTGLFQSKKSEWNRKEGSA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRRSSGLRTWKGEFTDEATKGQQINNEESRSNEARDKVLAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLKVRQVRNSTEGKQEDEPTNWAQKAAVKTVTAKGYKLQGDD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKKVTELTAGAWVTRPVEKVDRLAQKKGSENNAQDGYQQKTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEQRAENKARSQTQGGAKRQIPENNDNTKREVKGFVEDYVNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.059999942779541"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQRVQGAYRSEDNAQTTELNKAVDEGVINEAQTSEIQGTIRI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFRFDAGENKRNAGNERTPEQGVNEPKIHRKKESHLRAKFEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.810000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQESASKGGEDRKQEGLEKDDKEQQYDESDRRRVQQDARATR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNRNNEGQEAKERFGYKRDIKKRKVGATRAEDIYGEYEVDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPRAELYVSDFNFNEKDKIQKGVTNGPATRGQQRAESAEVTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNNKVTNARRKKFGFAGESSRAYQKKTKEEALETFFEPERKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKLRKATSNREAKDGKRWDSQGTKEFAEQPNENYVELTGER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRGKGPKEYLSVRKEAQTNREADFNAKLTWNEGRKQSEEETD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEFKFEGKRKEKEYFNRAQDEARKAAGEERTTKATNVEWNG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNRKGWKEAAEDTEAAEEKKAYRQRGKEGTTKERFENVFNTF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVKATLGRNREYVDKATRPPTEPQTSYGYVKEHEGREEQVRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKESYAKQFNTIRKFKFADNKEGSRTEDKGENEGQQVKPRQA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "2.109999895095825"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEQARDGEKYTRADTENRLRKDATENEVQRINTEANQGRVSY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQEQTKTGDTRENNRARELDEYDERNISAYNVQVREATAKRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.850000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDKGYADIQSDRVEHGKTTSKPTESAAGEQTYTKRLEFKGNN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKIDNFEEPGLRTNSRALVEELQKTEGQSVLDDRRAQKGRVH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDQERVAQTESRPRTEANSGKEKGKEKGKVADETVEQGRLNF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKQGKVTAESKTERDHRTLDRWGKTALGTESKYTVETATIET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIATQGKDATTTKHTESLTEGWTAKVTEDSYLGEKTKRRVRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIQGEEGNDKKKEKTIREVVRKVTNYSEERLKLSANDGRARV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNVNRYELKAGRNKDEKTVVIKTSGEEQKIKGLVEERSRRAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNPKSLRGETRGSGGIEETEKTAEADQRRLTETRVTGTRSVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGTGKPVGKDTNETDVDYATKWVTERAVQEAYETTFKGTGQV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIQPNVGNKGQRAGAYAYTNKLTETNPRDKTTQSAGVREDEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYSKQNEATREIRAKGGDRDDVTATEGTASVTENTGVNTVRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEEEESNFYTERGRQKEKGRTTVEQRAVRRTNREDAHGRAES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKKEEWGVGIQASTGPKGQREFEAQSQTAQENTRQGEEFNHK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSARVEEAVETESVEDQKKGNRPVEKKVGDYSRASAEKLKGKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEVKKATEAGGVAQKKEDVVVREKYSDPNSGSRREEAKKLEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFKATVKASRQTAYNGRNVGQEASSIETYNADASDPDVRFEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVKTAQTEARDVAPDFSIYQNSADGYSGRKSAVNREETNFAV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERASAEVREDRIKRNREGDTIGKEVAANKGSYQAEKLKVTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAPRGQEEDPKIEGAARFAQQERKIGDGVRRPREVDTKNIET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.829999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKNGGVKEEPKKGIATVVTQNRIRRTELGLETKENKAAKVI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYNFRITGSKERAYEGRKGKEPGTKAFIEDSDNEAKRVNADF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPRAEALTEKYRLKEFEYIETKPDREGGFSAETTVRSVSGRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEQFRGKRRTESKNETRVSLTGALHDTRETKEGKWGTEVKKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRAEPRGTSKQAKNETTIKDIWYEQAVEYQNTTKAEVQGKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNKPEVVGRRAEIYESDQGTEQTKTWTGTVAYEKAQAIKKNQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKKNHQLDSRRAGQQPEELDDRGNEKVGQARDKIQEGKGRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQVKHEEDRSRDIRAADQLEKKQQGAKDNGNKRGGPEGERQL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTYVTVAFTYKSGKTDKEGEEGGEQWVAERAEQKAKTAKVTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQVWTRKVGEKKTKAEARGKGFTDEVETTQGAYASEAEVKYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKNASIEFNEARVGSVEDRARQPGEDGTFNETRYGERQQLEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEKLETTKFRDATGKEKAYQTFSLVPGWIASKEDSPTKKNG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRKEDAKGGDVEAENDVAVQLGFRRGTRTSGPVLNEGRNRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGQVDPEAKRIKAQKLNTGTKAGNSVIAEDVEKTEGKFDFTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTQRPNEANTREAVRRGKAQADETKFGSETRVNTVQEGVIWE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRQFEVRAERARGPEGKKNWENTFDKERAQQNNRAQEGEVKF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGPKRGTNQDKLYGARRERVGRRETPDKGEREDEEAVEEERV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGTPTAKADEVERKNGTTKVRNNVDKKQITGQERITEGNFNG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNDEGKKNTEGAANRTKGVGQIVRTVTEPFGTNENKKRQIDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.419999957084655"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVKAKDGRSQRTWYEKTEANEIAKSSGGWEIDKTKVKGTANG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKKADQKGNEDVWSGTKEATNRKWIYGIGEVAAEKSRKTTSG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSARIRGFERERTGETHYSGTTNATKAVAKREEREKPRARFES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFTEDQRDGTKFTKFTITGNARGEVRPGGENKPESQNYKVAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKLAETEEQVRRRFWTKEAVWHANTGFENGEKITESNGRQDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKANGSGTEERRKYGEYNKLAQNGSEAVERDTEEVDKKPSI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQRVTVRGRREDAERKTTGEEAGKTKVAETKRKEGYNLRWDF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEQYRRAFQRGTEEQASEGEFKTRKTDSVKGAVEEESYSFK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVTFKGFDHDPDAKSEKLTYTPKTETELNRREKQGQKKRGSK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTVQKKPFKEETSETTQYLDGKDRRKANEKGTKGPSDFRKHL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKEGYWKVQEVKFKNNTTAKNKADQFAVRNERTEEKEAKATG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNAFEEANKEAETAKKNVQTAKTVGQKKYRDTRNKGEKEFVW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNTPRTGTTNKEWRKGEEAEEWASYGAVEKGNSTTAKIRDQA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSWDTGTSQDYAKGGKNWATKKIETRTIAAREDREVKKLKETA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSWKADGLNKTYQLGNHANEGGKTVREKPFSTQTTGKKKEPQA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVDGTLGTATKTSREATNGTNAVRKIAFRYRKEEPNEVEWKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRRVTYKAGAVNIDGKYDGGKEATQQSTSREEKRPNKNEFIT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8799999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKAEIYGEYSEATNEKRATSKATKGVVHEKRTQIQDADGQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAASVTTHGAKETEVEREGKSENIDKQAQTYKQTDYIGKRTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSWSATEATRKDEVGRPKTVQYAPNQTIGNQVDYDRGDPDATW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVASRYADWDPTNWQKKTAETTATVYDPQDQRGGENRIDPGV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRRVTAEMHENNDGKVQEAGKTVVQKYNETAEEYLNRVDVRW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQDPKGFYVGRVGTKEKHENREYAQSLRASDNEPTFDNKARA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAQTRGPPQTGQANRTSVKTAIQQIDDGESYNKKWERGTVKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDRFEGQAENRRPARGTENAQKAGNESLRTLKQEGTEKRVEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKGSRTHNTKGAQKLEARGEVERVNTAVGTTATVEAFHAQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKAKVAEIEGEYREADEIRNDPTSGIFEHKRNTVDEERVRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPKFNQDGDEKTATRRRTATEAVKNKGFENWEKTISDGQKQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRPQTETGKRTNTRAFDDKWKGFIVKERKASGADNQQKENTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIDFKKAEQEVKILRGRKGGEKGGTDERVTANNRVNEADVRL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKANRNLVRKGRVRQFKDAEAIGGVKNRTEDVDGIELGEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAGARSVREEGGSTARNTKELEVEAKLNRTSSFEEAGFSRKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKIEGFDENERVKRQTEAHYEAEEIVADKPTEKKNTVNAQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.52999997138977"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEEKFGNKTVSGTDPERSKRAKEWLKPKQYTDRNGERRYTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKTPVEADIYKKRDGVIQQNVTTGTKTATRGEDDDATVKEKF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLREENKEKQTGAYNVSEGRFRRFEEDRQRLENGRNGELATW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERARQGERQNNGEYEWKEGNTKVDQEGLEVRRETARRQAEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEGNFAEGEDKAATARGGKFTNFTRVNSTKQGETKTTQRQEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKYTESATQRTNTEVEYEGRTRADRSVGNVEDKGKRAKPEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSPNRATYEGKNDETEKEQTTASRVTAGEREGKKVGDERRVY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEGEEPSEERKPQTLKKAETAADRVVGREVRTSTAQVDANV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGAEKNRQEELTRTAATSEAVKEGPRAVKGVESRDEVDVTPQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRFKRGEDNLDAKKTTPETRFTNEGDWTRFEKEIHNFKLSA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKTESQEQDRTKGATFFNDYKANRVDEPEQKFEDRGFAGESV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIDRREAEKFEARDKVQRWDKVSQANASDTGDYGNKVEGRQS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLEGHWGKVHKTVNENRSFESALNNPGAYTRETKWSRAHVEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKDAEDGRSSFEFKKVKRGTNRGEQEGARSLEEKVPNGKETA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKEGRFKRHANGNAILDKEEPTNDQRGDQEQEFREVVHAEKI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTYRTAGREQKWQEEDSFKEAGQEDAGNREKTRWTEFKGYR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKKTEWWGAADYGENRTKYQTRSERTEFDFQGKETERAQRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKDGNTHLEKSDKERVKNGARNTGSKDRVEPDDTWQQAEVQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREKDDESEEKQVQLDATTDSGVDKTHWRNKNGQRPVNAGGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVYINGKGRTDNAARETTWERVAEDFGPTKGTETVRKQQAEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEESKRHIINAGRWTTKYQKGEIQGESQQNQTANRGEVAREY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSADFDSRGHTEEARRDRKFKTRFEETAATEERQNGTEGQART, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIRIEVTAETREHKYTNKVEKAGDKGVVQEIERDAKRGQADE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGGKGVRKLTKPTALTEATHDGVAVGKNDTKPQNQSQKREPT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEKRSPKRESEAPEGENQVNQSAEREGDEAKERQAREYLNG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.949999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVYAKVSVRRTEAGTRDSPDNEPNHVAAKREESYGRKGEVTI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNPKKEYRIAAVVAGRSHASRVVNEGEDTSTRGVEEYRKTDP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDTWYLEAKERSANERERVEEGGYDKWGKTGRRSTAEIQVRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSADLRERTYRQIAGENEEREKSKDKSRWVGVYAETTGVREGW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSARVKIGDQEKERPDEEQLAREAQKETANKVRSENGEIRSEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQEGSNQAKRLDVINPDQKEERKAETREVAIRGEGSREAEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQKANTAKRKVRGFRAKNEPSSHGNTNKVNTRETVDKQEGSG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRNEWGNGYTKSSNQVTQEKPTKKVVQREARDAAWSGKRKFT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEVKAKFKYTKLREFTNDLKEPARRVEVEVTRDAEEGRGNN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAKITEEPHAKYWENEHGTDEKDVGKTFSSVQKPEGERAERQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRSGNFGGKSKSPTDWTVKTTATKYAKADTTKDEYGKERLDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAATYTSETTKDNGTDDWLGKDFSTSTGPGKAVERTKKYRKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.220000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKAEKIRENTKRTTNDEGSEQGEQALIFRADTEGKKFKYRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAKKEKTNNEGEEETGGYGIQFAQRITKFGRSAKKTDERLDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKGEKEFDKLRPASPAREANKEAEKEKRQSNKNTGKWEVKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRAYFAVERKDEQTTYTKEDEKRAVTQQREGHDTKSSAAGD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEDESFSPQGAAERVESGVRFFVTYPRQKRKEKGNTGYGENN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTADNVTNRTQIDDDRKVTEIAEEAAGSKTQDTATKGKGRY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRFAANRPREKGKEGPLRTQEGIEKVRTSLKSGKGGEENSIT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAKGKLREKERDADETNRLERPVQYIGANEVYETQGDVEVEF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLKGLQPREYENEVEAQGREGKAYNVIEEFVRTARDEDDTVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIYARATARKEKDDRKTEPERNGKEKVGKNGEEDVETATINI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTPAENDATRDKTKRGAITRAVKEKKYEVIGNEDRENGKEIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRDYEERGHKQENEKKWNRGYNSLYRSAAEYEKEANQNKGEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTVIDKKPSWREAQASNEQRNFRGSEAEKGATGFTGKTEELK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVQAEGKLTYERFFKQERFDKTPTTIAKRTGREDAETGNANR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVKAYKTGSTEEARRDRKFYHSAQNGAATNLQVERAELEGEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPENRSNGTKYDATTEDKREEVRRQLGVRREEERGNEYRSEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSARWTEIARGTDTKLETTKVRDVVDEGGFNQDSNRGVGANKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGSFNKIKEQASVESTRNAKRVGDERAGTRAQKTEIEWKITE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFSGDIIKQETYATKEREVDNTFQKARGRKIKQQARRVEAEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQAKVTEIRQFGEFDIEERTRVNARDIYRKQATKKSKQEEGA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSESFEGRGHYYRVNSKSRFERAGREVAPPQVSNKAKEAEITG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAEKIQRETRGSSREEHEEYPGYVFGRSPNSKNAAFVAGKRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTGGEKGGRNREDQETDENRGRAVEVIRTKDAEKASIVEKDI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDNAEVNATELRAGKTKGKDEGTKEAVFKNGKEREARFKVEP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTVGNRTKVTFESLVEYEKGPGKTPLVGGRYHEAKKKALRAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKANFHVKTGQGQRKEDVETNGQTTAAETVTKELKKLSIRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGGTSEGDVKKSGGPIRTKQRTGDTIRNRYTVQAGKEHNDAV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVNGEETIKDKRDEKTDTGTEAAEYFGAKERYKNWRKAQNRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIYYAEEDGWKNTEFAKERDAGNRGTRKKRTNDVEQTEKKAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSENERAGEKKGDEENVTRLVTSTVETGAIRVNRNGRSARLQA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEGSTTGVNTKRERRNSEEGLLAGETNRKIQEDVVNRAARVA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSWDPRDAGTSEKAKEQYELSKVGKNGVIKKWSETKAYGTFTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDWGESAERTEEIAYKDAKVNSARRDWGSQRYGVRAQVQTET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGYRAERDVRNEEYVNRRAVHHSKNAGESKEQRLTLNDGFYE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRVDRATEKENGKNRAKSFERKVKERGEYGRTESPDAKEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEGKQIQLSTKIRQSRKVDKAIYNAAAKKNEKTLQSGNVEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYGEVASETKQVTRTEKIRYAEEKIGPTENTDNEGEARRTV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIQATNARTKAKWKHDRQGDEAGKTILLDTQEESVTQAQGKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIQAKELRESNTQQKETLAGDKQGVQWDIDTATHAAGKTQKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAEFENEADDYTGNDRTEGTSYPEEGVARKRSSRAEYRKGDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEVEFAYYGAAGAESAEKEYGRDDRNEKERTPDSNSDTRRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREEPGVQASEEWKETADKEEKILGKQGVAAPDKIQRRYDQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.829999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKGNVPGEDVRPYDHEGDRDARERVAIRRRTDTEANSNLRF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRATTSEIDADRKTASIGEDVQKRTVNDGRVVWASTATQKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNTDEVTFRSLKLQNTQEGTSRGEKVGVTKAEKQTFEGSASA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSANRRDKLAEKDGDKASDEYRNPDTQRREVGEGHQNQRIAPT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEPNFENKEETIGKQEQAKNAGKSKVLDQAENQVTEIRARI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFGNGTNPEAAEQIQISTEIAKKQRKLVEKNVEGRAQNKDEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQDVKAYARYREIVKQEYGTRFFQNELGKRKNDKGQEAQVEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGDQKEFEAVNRQVKKDTYKIYFRQYGQRKAEQGVALGREEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGDAKFAKKKTTPQDFESWRKVVERELIREGEDKGQSVQARE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERDKTRLNQAVPTIRTEAEEVAEFQGDRRLEEGKDHSTLNI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSWSAVSTVRNKDYGVAGQTDAGLNEDENHEETGKAAERTRKH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKATVTLNYKEPARPKHDVEYAGQESNGIMNNYGKEQEATF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDAGGENPDKEIFSRQPQKDLAQANETKTEQFSVKREKFNGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEHGNGGRADIKIIKEREIRDLTKTAIGRESRQSAERGDGQS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGGQRESAANIIEIKREGGDTIIDAREHRDGKESQRLKRSGT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQTADVGDKSREIQTTENERRATDDGQARRVQTKFTDADVRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRKSRNFDDDERVEGDAQTQKQAQAERRGVAIDTTTDGVRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.850000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLKAEGVQYNNRVIRVEKAAEERGEKEKPQVNKRAEEFTGTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGVKKRIGKEDATATKGGVPEEPTKDKIRTILDLQRYTATGS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNRREVAEVGEGTRKEDGETEQETSPRSRQSVNHAQGTIGNT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8799999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLQAKTVNKKTTGEEKQRPKRLGEDVGETRQEYSARSINAEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQRVKWNGQTSTGATEEARRKAEEKANPTTFRSDGEQITFHA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSWTFGAEKERGETTQAVATTQSNKTAKNQIHAREGSDERFPR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDNAYEARTKSKLDKGTEVREAGQRRVGETAEETASNWQVRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQEETNEANATRELTKGATWRQRKDVVGAGVRYSKEESDRAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYRLQGAKEEETWYESQEVTKGLYTAAGRTETQRNAKGNWEF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRYWSTEWYGQEENKTQKAKEGERRTTVEETNGGQLAYFLAA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEQGDGRWENQNAEDEQDVTYGVEQDARGQWRDRDGQARFKW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGNENGVIDKNRRAIEEQDWTREQIGKDVAYKEGPFKDARRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTAREDLNEIEERTVTNEARNVARKRTKEVTGKVQELEGDI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDDKFDREALGQAGTYEPNKNSGKLDTTNKVYQTKGKANTYA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSWEWRGAVNQGTATTKTGNSEASTAFRGQSWRQQQFEPKVNT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSANHKVRERDKIRAVTTPTNGFGSVDGTDTTIDADNQGHELV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRDATNSGSRRDFSERDRIQSWGKYEATQQIDREEVKGENDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEEDKRAESFYGRARNWEIDTQQRQNGEIDGDSSVEDTRSKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRNGDVDLTQKQGTQRKEGKSAGERRVVVDLETQFETASAEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVGERLQSVTRRDTTVDTAEQQEGQFKVGELRAAKGKKNESD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYTPRKAQEEIEDTRRTQLKKAGTTFAVKNLDEERWQGKGTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVATKSREKRDNHRTEERGQRSNGDVAIERGTNEYEKASDSK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.580000042915344"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDKVRKGKTEIDQKRIKTNAREGAEEQTERANENWENLEFDN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGNANEELDSKQEAQEDRIYRDGSKEPVKRLETNARSGRREG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYTTAKTEEVEPNTPGRRETYEKDKEAGDTTNEELTKFRTLD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDTVNARLEKITTTDRREAQNGLKEGAGTRVKTEKADWEVRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6100000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKVGKAAGEVDLDRRTGTVNERTAAEEKNIRQEKETTLRDW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.149999976158142"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVSGENGDQRNRATEERKGRYEGSNEIRAYGDKTEIDVEFKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRNFETDRGEITEEGGGVEKEYEGQERNRYASKDRDVKASNI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERVEEASKDRDRDKYDEGNEGARTNWGKRVRIEAKRIESEM, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSENKYEYLKAGLNNTTFVPEGEQTTVDRDTKTARDKQGVLAA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSETAKLGKFRLTFNKVKKVDRLANEEAPQSYQKEAEDGEGKP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRSVTIADTEAEGTKTEPEYKAKSEGDARSNNENVQRRTQED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKRERKIEGTTTERAVHGEKTQVDQTKEGKAIVQETGNADKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.240000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTYFQRGKETKNVTKRTEATESASTAFGKEKETQGQERNVEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.699999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSATYTTRVEDNNKSTPKHGWETGVTDRAVEGERREPRGEAEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRGGRVERPGTWEEDDTYNHRAVVRTPSNAKGTTEKEAEEGT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYELRNARIRHEAKKEDDGRKFARRIVGKTLSHSGEQITAEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIGKRGTKQHKYLRFIAVLQIAKNTDDGRASASREEEHERER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGREAEESVTGVEGEKNKNKSGSKELERIVKRQKGKRQGFRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGTNRINFEEGRDTNTTETSSRNKATREVEQEDKGERTDGEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRNLEKERNERVDERFDKREAEGGASEDLANTPYFLPAGRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.9599999785423272"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSANAQRGITRRNGGEIKEGVKNEGQKETPSYNEERASEELEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERARRARLKTKERSSKTVNTVIENEPDPRGERGGETEFQLA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTAQTELTTLEAKRKEEVDTQFKYTGDGDAQRKVEKITGRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIEDQKLVDQGQRETGKGTRTKFDTKETEERLVREKAAATYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.990000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTNVTNATFDARAKRKEEAENGGEKVFARKGNRRVEEIKVKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVKTAANGKNFNEAVGVRETKKIAKFRETDKNREVGRREEEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDDWREQISENEGDKNTRGKEVAKKAAIKSGKAQATDYKEQY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQFEATKKKQNLDGSEEDSRGIYKTTAEREGGTTVRNASAEW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDTRLETRSERDRNTITGEAGEKGKPTFREAKDKDDRSVKTP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVTAKLDLQTIEGQQTTQAETDVTQVVIKTGREHASKARGKP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKNATVAAKTIGSRSKGVNELEERGGTTEIVDDNTERNSKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQRWDVRGENVQFPHAEAEKRFSEFGAGRQGTDTARTGDIKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRQAEGGKFPKFHEDQVTKIGRRVARETAWGRGQESFTADND, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVQVEGRAKRAEIERRKDGREDFSKRAAKTIENEQWETKGSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.680000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKVREREREKGTAERRAVDAENGKRIISKATEEQQKDSEFW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTSVDVNGKEIKGDDRNAEEKARKEVGNNTEKEDGNRQEFRP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNKEDFKDKSEPRDRQETAGITGENKRENGVNNREVDAEKGV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEIETREAAESPVKTVTTNKGKQREYALYNKAKAGKKPVRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSARGEANPQEFSVGEKNEAHTEAKEVASYKPQTKDISRRLRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTDETSDGKEHNEKTTNFNADGTERERRHIKGVEAKANIIED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8399999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYVQAFEKTTKGDEGNRDAEQRARENNAKEERKIEKKRLDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERWHARFERTRAGENDEASKEPDEHFWKEERERAEHGTGRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDEERREEHWARAEGETERRAFAHEFPRWEHEDRKRGTGKNS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPEVHVDGIEIRSSSSDEATQRARDIGAQQEERRGNEVRLQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAELSIEAVNVSERERTEGQQDASQIGIDHSQRDGERVRGRP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEDIRGAEGEAVGQSEQRERARRGSTVSIQRLSPVDDQHENI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFPYGRIDLEERTESRQSAFETEAGHRDTNKKTTNKEGVATS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSATGTVGERDWEETRETSFTKRMTEAFAEKGTKSFNENYANA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVRDERKGNDNKIAEGARADSTIARTQLGKVTVSRDDAFDEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRAQLGGDNNRAERQTTGSTKINRALHPKGQDEVDDWTEEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKTSAKEEGSAVIADKRGNTNESWKEAGRTIKRLKAEANYDQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIRGTDNWSEDEKKKPDKAGNHQVNTQGVETTRTEAYGQAHQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKESEKTDNKAGQWVQGDTQEHGDEGIVNRRPATATNTHQYK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVQGDAEVNTKEVKKAQSAQEVISEDLAQRGDYTNKTPKWRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGDIYEQETDTGRVQEKADKTVWRQSQEVKNKVKAAPLNNAS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREKRAGYGRAQDNSQREATYVVEQNLANDREKKKLKFRGTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAFDGEEEKKVRETAKTVEEYREGNRIQAIATLPGRVKNPDV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPSVESGNTEYQYTSREEARRSAEEKFPKPFQEKNGKFRVSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRSTRPYNYNSTAPEEFFEKEEQSRPKREVFKEQVKGSSAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTQWEEQETGKTEDVRGKAARQDAGEELYDRGKYSNVRKERG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVQVDGAYKRENGRKDTTAEEAVNNKFGDHAETNQGTWRGRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERNKRGAYIFEREAEFPTGDKGKDGANFVKEEQREKYLPTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSHKGDKNWRTYTVTRETYVEDVAEKKAGESARNTGDEAEISK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEADHGGNRGEKDENEVTRKASRASYKITAYVKTWETEKVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIDVQAAELEGQVNDRRDIHHLRNPVEGQTHKRNIRTADPSG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEHRLITGGPNQAVRAQRGQIDSTRLNIDERAVDKPNDHEHV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTARIDATYDDQKKRRKFERVGEYLGGSKERSEAEDGRKEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSETATDGQKKKEVDEVEKAIERRVEEEGNKGREDRFKGEFTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEEAENTTEIVEKDRDGVKAGEGRREFGKVQKEEFDTREKKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVTGEDAEESREGRTNKRGNEVAERKFVRKPDHTDASARIEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8199999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIKGTTGGRTDNAGKVDERLQEKPNKRAAQPKREEPEARKRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAREEDKKEKTVKAEWRDHTVRDAIGKTGERSNKNEGAVRET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAKLKKGESERRRSKGYNFVRSVQNETDQEGSESVENPNDRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERIDSNGEKIDGTSPEQQEKAKRKYQARTTEDTNDEVRFRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRFNERIENGDITRPEDKDYVSEEQTAQQDKKTTRKAEGKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDTNKTRYDEISRGNAEQQGRFDRTQEDRKKKTKVPEAEIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDVRLQGRTATANTGKQQAKSFGKKTGGKLEEEKIKGNLKW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLGTEGGEAKKRGKALWQIDFSGKTKKSENKAGVQQKRTTNL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEEEAYKARIKEQHTKATLNKTWKESKSEGTQVQGDVGARRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKDGQGNVEHWKAGQKKRVRRLGETVADDDAEQDSIKAEGKF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRQIRGTEVKDNEARPTTEVRVKIAGWDRLRTEFSGEDNAYG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSARPKPVYRSEKARKGEKGKDWAQTGGINDSKEKSLNAKVRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEETTKRGDTQTKAEDTSTDPNEYADYREGGAVVQRSVQWR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVKSKVAEIEPEGASRKEVNRGNRDVIADTEKEKTVQEKGRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKVNSEVEVDKEDGGKIREVQKEGTERAKNVETAASRIRGPK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVTFRAGKTNVDTQTSEQIEDELEKFAATYIRTNFQKPSGRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTISFIKAFKLANQRGRATEGGTSTEVDEYRQDTFTENQKPV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGDARVTAQSVNVRRDKRLSEVVERAGPTRGNREARDIRAEH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSETARQNWEGVTRVDWKAARKADDRSAGTSGDEERYESTTDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPVTVENGQSDADNSPDSSELARESYKKQTETQDGNVRSKTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDAASLQETTVSESERQGETKDDKNSDNTNPKSQVVPGNSYR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKYEKSERDQRSRKEARDQEGTQNWAETRSIQGGRDEDADAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKANAPTYSGQVQRARFETKIETRGWFKTAETNKGTQEGEF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQRDRGAPAQTYRENNLVEGKERVDDKQPQFNKVEEVARDGN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEAQVQKSVGGTDRDEKKKIATTDNTKAAPGFNNKETELTED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEVEESQRNTEAYERARRAREKIETKAGKVTDSVKDGEAED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRVKVDEQESAGERVEGDTTERKENARIDEEKYAEARKATG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSENGKVVRQEYYGKRLEHGAKTKAQEEVNKQDNTVERIRVRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNADGNQVVKKHVRERRQKKYAEVERGEYTTVKIELAERGQN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIKINQPTTYGEGAELEKTAEKRVTKTSREKRTKGGNTKAEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSARESEGKKEQRTSEVYNAFHKGERFDGREEKEFDQGTARKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYTLEEGTTTETWPSSKRAEDEARNRGVKTFRSDGKRVESRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8799999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNGRSTTAWTETRKTEDKTLSREEGRDSRGEVPFSYVKERAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRKVDAASRSTRWTYTTEAETGFRSKIVDTGKTQGEEKRGDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLAEEEDFQQDRDHGKENKADKTAGGTGRRRPHKFEMAEGRF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYQVKAVGKKEEWAYVVKGFRTEPERNAQKGQDDVNTGQGQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVVVVTVGKQERTNQEAAKNDQEEKGDQYQRWPKKGAYRFGG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKRTFRADHNRENEEHRGDTTANREGAERKEDTGSTTKIRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTERKARRAIEEGEAGETDNGKTTSKDTGHRTFNDHRNETR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGSLNNTAETETPFSEEKVQKIARSRVAQRKHETEGKATGKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAKGAGTSEIRKWRGTRDEFPEEAKLVNEKGFSKTRDQENNG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFNERTVDGVQERGAQAVLKKTEPTGRQNTDDGQKTADKVER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKARRGQATFSKNTEGSEKNFSNGSFEDAAERYSELAARTTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAQINVGKQSITGVEGRQPAREVVNKKPGEATNTGTKYEFDF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLERKQRAGNAVYEKHVTVGTYPVNNGTRLTSEVNKNIESKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKAKFGGSRPEGKQERYAKKEFEDVGATEREQKNVREEWTV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKEREGVRQAVAKVSYQAETRKNEEGGTEEKKRFEGGKDWPF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRDGYLDGDNETGAEHRAVKNGKQRSQVKHAEKSIGKIRAEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSALRGIERKKDAKIHKNYHDGQVGESRDNKTRGQAASEIVGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLKFQANGDQREVKSTQTVKKQGTRGAWETKTRQEAEPTASN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRRGEEKLTEGRGVKGAKYPDKKVEERGADVHNNGERATEEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVVRETNKAAEGDAEKAGNKEYERRKEGEGGVPRHDKTRGLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKRPNVKLERKEFQETSTSQTARKRAEINSEREDGQEGDAEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGTVTEGVREYYVVDWSKDADKGGKNRGAHGTKERADPEPNA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAGEETKTIRNTRQATKGKQYVATLEVGKLSSDGARDTNQED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEGEGEWRKRSNGEKELQDAYTRAEYGVDLKDQGKTKKLTL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVRIRKGESNQKKKRGYRGKEAGREEDAEEVSVNRAEAKVQI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRRVQQKYEGESVEVKRGVERIEAGEKKKREKNAGASDANRI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6100000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEVYGRAESEDTETRNKGDKAANRTGVTEGETNDFRIRVRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKNGETVRIEFQNVREGDEYDGATGTTKRANVRDATEESRRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGVREGTTRQVAERTHPKQKNGRETAVKEQRVENWDTTGFE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNARGVKEQREPGEATEAVKENGEYKEVKLTQKVARGRWRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEVQQTKITAREDNGGPESKADVNVKRREDFEGPNATNQIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDPHNKGEYKRGVERTKVKDTARREIFEQFTDEEATKRGKP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGTGNAQVKKVDIKEDERAQNFPKNAAVRDATERDATGSIKF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQRAVQEVPLKQDKQIGIAANQRTGAGKHRNRKSREDETNEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKEVKIGNTRETRWDVSDANRGANKAPLQTEERYKEKGSLDH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNAQTDSVEKVKKLEARRNTREEGAYKLSDRHKGGDITENWP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGTVSTEVNDREVREAKYAWSNDPNREPGKAKFTGRNGKTTV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYEKSTTEETRTDVKPKNRAPGVERTWKFSAGGVRVNADNGN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDDVETEGRQSEGERRTKIKDAKYEVIANSERRKEGKLRAYD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGTVAVKENGTQEHRSVAQEADRQENFGEATVTTKQPENEKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTVQIGKTEDDDIATWGHKRSETATAGDAVYQDRRTVEEKKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRREGEYNWAGIEYESERNEVVAGTAYRREPKNRGRQDKRGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAKARVVHEDKKLQYSEKGKSPPESGAANSTDTSGTEADIEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRAAEQKPQEPSFGWDEGRGYVNRNKRELEDDERKQSKDHV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGSGKGVARSLVNTNLRTPAEEVYHTSKVQAKETAERVKPNG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTVVEGQYEKAELVGLETNPPVRKRSSNAHTTKRNAAVGGSK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIQFYIKVKDAEVRKTHAQENGKYERSGNDETKNSGTPKAEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAKYEQKEHKIVDKEKNGARANEIEGYPQFETDGVTSTNRKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEELNNGRRTTETSTATDAFEQGDKSDRENTKKELTEIKGRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.769999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVSGTKKIRTQQVGNWERLKHAAREGAGRKAKNQWEHPEGEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRKWANRAEVGAVEETQKQPLIGSQGGNKERREHETKGAHWK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSWTLNDARKETEVNTTEKGKNSGSEEGGPQARSEQFYGRRTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFKAKGDAHRSDAYEEEYAYQTVKEKVGQTVTTQNADSRGTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGLEKAREGFNTKVGGAENLVAPETENRNRYKANEKIERGIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKHARLEATYHEGRTRETATRKASDFIGNRLYDEAKEGEVEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.939999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVKGAETYANAEGLELRIEKEFREEYGTTTHSDRREHKDAAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREIQRGHNDERREEAGYEVKRYGSNQAVTAKRRAEEADDEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERQENQDGGAGRDRADKSETENIERHAVKEERAYARYREVG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSETAQIKGKTNEALRTKRIESAAKEGPADKAEQEVGRGQWTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEESARPTTAAKLATKTIEKGQQAQKKGVGAEDIETERWNRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFVVSAAKEKGEWWRVYNSVGQSTNLKEWSRLDETTGEDRKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERAQGRGDTARAENDDGQTTADEVKQLERDETKLRYQEIHF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFQKTTEVNNERTAGQERGSEGREVRKSQEGGATETNTWWTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVNAGASKIKEDKKRGESRLTEVSNENTDEKKYINEGYRRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYTGTVFESDKEAANQRELRKVIKKAGGNTERKRTGQAEAEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSLIEAGFDERNQKLAVKQTYERGAVAKGTTGTNEKEREAKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDEATGEVRKVKARYTQDATKVIKEGVLQDGQRQITEVTAHD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQAYDRGTEAVEVVTDIVIVTGRKRKDAGQQTHTQKALEEKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNEGNTGRVSLYAEEKEKGRTEAKDIGAKTNEKRFTELDAHI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRNGKEALENRELADIATNIAYDEGKTKTESFEGRVKTEHGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPEVKVDGEKRRFRSADEARKEAQKLGPKTITEDGEQLRVQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDLFPDERQAKKRSRRPIDAVAVEEGEVKGGEKQTQKRLETK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQNFEVRGQTEDRTTVTEAFRHVLKTGTENVDRNARTVKGDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVETKRFAVVRDDSVGAWSTRKGQPKPEEDQKQLNEQGEGKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSWRTEQITEEKEGRTVEEARKGGTQQVFENVDWSFDKATAKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYSARKFERRESAQNKEKGKEGLEENIANKERNDIYTASGTQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDRNGTISANERAVKVEVFATQIKDARGGVQDGRDKKRKATN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAEAQTVQRRYYMETKEEVEEDGKRGAPRNASKEANKIRVNG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSENTAKARGREEYEVRAEESDTMAPNNYKQKGVQIKAREVGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSINVREGEKDTYAQTADQAGQTGVTQTSAHENKRPDKGRPHK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPKTANNARRGKKAAVVDITGREDSTQTEGQKHEGQTPQYDH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSWERRNRGEKVRDENFRKGADRSAKENERQVEDSANTIRPKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKKFLTKIEATEEAYQHGTDGTDGTAKSNDGATESRLEKTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSENRQNEGNEAGNFVAFAIDRTDQTDVGQLREDNGEVEYGQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRGRGIYASETRVRKVISEEWNKATSPGAKNRYEIDLEAQVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGYANVFEDRGTGHTETRNTTPQEEVVGNSQYENRGQQEARG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTANTGTNNDRRAWREEKTATGKNYLLTKTDVEQPKTLSEVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSINPRAGARKDTQERVKDGAKKGSEKLVNYAQTRIKEPRAHE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTYHQRVLRGEAKKKERGNEDPIERKTVGASAQRAIKKDNAP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERGEELSERGEISRTDRAERSAYRSIKTKTSKYAPEGDVNV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDTRRRAGKEYVDELGEYIKSAPRSSNSRAVEGKRTTESEIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKNFQAAYKTEKGSEQRSATSGADNIVFEYKEQTEGSYTLKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDRGRDVKNEEKVRRNGKTGAERIQDKVTEGNKNEATLTPRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRDTDVEDTKARAGKQLRGNRENRAKIKTNVPEGETRVNEGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPNWNRLEDKNEVVEGKKVGETRGRQEAKSAEYRNPKGKATR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRVRGDVTDNQISQPSKDSKAERKLPGKETYNTDGEANAEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFVVSTGTKNVERNEGERAKRQAEQEAIRREGANNIRTDETR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNTVNGADYDSQGIKRESHKNVETDARGQDSESRLNRGDGTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSHNARYDGNRGSDNKARQTGNDGVRSDTEVSEQETDSGIKLA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLKATREGEEKKLGQSNQANEAGYQTALTDIEKYRGREDPQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRYAQATYQNKQKKIEKESRLDPRENGLEGEGGTLAETQATD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.990000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSANAKPGGERNQKYDLRRGINRITEEQTELQTEDRPHFRGYA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKREGPENKNYQDINLLREREHRGYTAGQPREQTRIDATAGF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTIERERHRNSRERDKDKGEGNRVALTTRRGVIEATPFSETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIQANAWTREEDIRKEETVNQLVNSGRADYVRRKGEDVKAEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSESKAVDNTKAGKTEEEQASIERASVRKGKEIVYNGTGERNY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDRGQDGKTYTTPSKDTTEQKENNTLEFKKGSKDSGSRTVKF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNEGKRVEEDRSGAEGRHKPSEEARERVTEAKKQGTTETVEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGVRKEGSANEAAAQELRAVGAVPTQPNDETVENPFTRRWKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERAKTGISEQDNTNQTRGASYGVDQKVLEQTTSVEDEKGRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKQGTSDSQVTRQQTITNVTEEYGRDGDEEGESLVNRGAAKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKVTGGNDRPEQWEITRPEQAWTTIIATKVDNTGDKAEGKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIPGEKTETKNEWTTDQAKVVRVGDNRGTTAIDIEPTKGWAQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRKGEVEVEQEEGEREGRNGRTKVDRTALNANQEGNTFDAEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLRQHRAVNGDRDRKKVVFGEVTVDQINAVAQKDSGTTIKDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTSNKKASWRGARSKGERKTQLQGVDTVTAVAEQQRENGYAI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSWKTEILNENVVTYKPGFDLTGEKKALYKNRAKGAGPKKVQV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQHGNRFTNEVDIQQKNRANQWWQDSGNQEGENSPKEIYSDI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDRQQRDGGQEYKYVDRQAANTLVQRSEDTRVQELTQQDDFE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYTGELVRTSEKRRNQTKVGTTARYKDTDTDEDEVVEGHVKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNELGKERDTDTGHRTTLTKEVKEREYGTYTDVVDSAQVVKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYSSRENNSDQEGPNQAEEARQKAENKGKPVQTDGDHTEVKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.210000038146972"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKYRDHDNTSERPADEVEEGQTQVKKKGQGPQENASNSEADN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.889999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTSVGQDEEKTHQENPKAQKSGDERAGQANEYDDNEVSNPRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQHNKDTKANRKVVGVTIQEKGIKYEDELEARALHDRDTAGT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8199999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKQFYGAQKQGDADNRNFTETLESNGTWRDVERTAREARVRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRVSARYTTKEGYTRYWKTNQEEWDATERGSSTTAGNEQRDH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEEAKKAQDNERASERVTRQGFGPRYTGEGYTVPRTQQDKKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLAKNKGFRTVSQSEYLGAQNDTKVKKEKNGEKGPREAIHEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQEVKRFHTEEKVDSETNGETAGENRGWRRATQTKAYVKRSQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSATEEEDLQANTGDGGRNGNKQDHERYDGWVSNERKERRGT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.179999947547912"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEYARRIENERSAATPEDGGYQEWTRRNGERQRDEGRVKISL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEIIGENGDARGRWDETERQETAAQSRKRRNPERSRELYYGV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRQAKGKADKHRINRKQEFDTSAETGAFERASNQLTELTVEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEQSLKNARAGREKRHDTRAKQGSEEVKGDFQNTTEATLIFA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRYGYVPDRRETNRIRIYDKAKKGETEAVSVEKQGDDERLTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEPEALRKYKEITETKYGERTATELFGENIKKKTVSFTNHW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPNFKTEERKEGKTTTVYKEGTIISNGFERLWTKELEKAAHY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTDAEVEAIRNQLGEETETREGKTRLTFREKDKRAEYIEADG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.039999961853027"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRNTEFGKKTVEGARVYTKPQNKGNRQEFKNENEEGSEQAKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRRAESDGETNQYYKEKLKNETHANRKVVAGIRAVGEETKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVNQTGRGPNMEVSKWYERDRPTQEGRADTKKENGTSNRIEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.9200000166893"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNPMGQEQDNGRGIRNEERSDREVKTEGTNPAKTRVISYTKW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTSVRGIKARLKSRERNELYNKGDEIVATDKDKRARTAKGEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERNLLDSRARKAEETAEIVVEKYIARDDRKKTRKSNGTGKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEPDVVNREWKTTEQTTWRSRANSFGGTRFRRNKGTEQAEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKAFRNWAETTAQVPEFTSRTSQTNRKRNGEEREVDRGWTGG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYARKEENKEGETKGDLPGETHKRAAGTQYQNVIKQKLDNKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREFDGKAEETEGTTVNRVARTGFQTNEATERTEAKKVRGRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.889999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLVTEQKRVRETKTENVGDARGRGKVSQHEAGKPKGKEATER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGNIRKEGKEAQASNRDEAKKEVSDELKGNGEQRTFNVDNKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQKVDASVREETFKTGNQVVYKGNYNKRGEATEEEVKNQLRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTDFTKQSAEYNGDGKKRATKEEVVAQSNAWTAVANKKKNET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKEGKNFTETKTAGKEDTPSKGAYTTGAEEESRTSVRKEAQW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKKSKKETWNEGTTGSEGRTTARVAESQPGTTEYDKAFEKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAYVKVRGEYENIDTTKNLKRGGDEFLKAELTEDRGRREWSG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEFESDRGEDEARRKKGREKYGLIYVDETKTGRWLVNLNAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQRGRLGEVTGEGADQRVATQANSDGVFESRETRIVQARLRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIEKNDATRRRREEQESQKWGEGERREVGRTGARTNNGEELV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAKEGRAANDQTREEWAQAVVADEERGEVGEDNGETRSTRYV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVNKIRYNDGGDVKGDVSQTEAKQSTIRVKGADDEKANSERR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLEGELEAKEHNKNTKGKQPTKRVNKSVDGPTYRGREQRFNI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYRETRGREVLKDKATRGIRDTHEEEAEDTRIKVGAGRKERD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEVDRGTETRHGQDEWKKVHKEAKKKGGTTKKHGNTFKFEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDSVTAVGDEGKIGKRRVEREGERFILGNEAEKERPKVRAYL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDVFASGRTRLEVGEIRPDERAGNIEYLGEKEVRKRKGAKEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGTGSWPEEKYKGGKVVKEARKFVREVALRIKQRAYNGNLRM, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLDVKRGYEDERATSVDRGETIASKAVPANGNHKGEEPDIEP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEKVRTADPKRYHDKADGSNEGGEAVEATEIIDRNSPLEVP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKEKNEFRKSGLFGDTTELRQPEDETVARRLTDNTGEARGQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRNPERWNQLGTQEVGTEVDAAERVEKEQGKEAENAGRARFY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAHVTAKTNRPTIQSKDVVKEAGREDVYPTDEGIRKLDKTEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNEAEHGTKNEEAEKAVERIGNKGTREARQGETDEANFQFKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVTEKKANGRREEFAKGAQANNIHEREQETGANTTEGEEKFD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRYEKGGEERETPKSRNVTNYVKEYGPGEQTNEELNNTKRKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNQEERDVVNRRDRAVETTRAPNPATGWKGTEERKEGSEKNQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.080000042915344"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKPTAFKRNDTQSSTKDFEDMASYAGIEETRRTRVDKEGEF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTPESFYEQKRTTRSNRDFDESFKEATDKMEAGADTVGKGRI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKSVDALEYRRDAEESKKAKHAIEHKGGSELRTSNGTVEQKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEIRSEKSKEKDGKEGHTAAGNRRAKEQDEVASSHVGLYKTL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAYFKGNLEKNRATNARRIDKGVNEIGPDTEEKERATAEQRY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYNVYEAKYQTQAHKTKTGRTTVQRSLPREKEDEAEKANGRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNKKATTEYETQRTYGQQESRGHAAPERGNKLYDVRKVATEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVDPRVRIREWEVEEERGDENVKNTAFGARPKKDDADGRGEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRVTDERKRAKGTRGENEPEKRADQEIEEATNKGKTVRIDV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQKEENDSGTEEKKGYGTARWDSYGNSADHRATKRGLRRDTV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEVREYGKRLEPAEELKRDVDKAKTDAPNGEDKKGERTINQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDAEQKRKGGEPRPKAEDLVLNVTKEGKEAEYDKERRGTDIN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTQLTAVEKTREAGEGNRTVQNKVNNVGGTTRYDANTSEPQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERQVEGTTEANQDTVGNLGKRGNTVYGKNTARPSATEQVTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTDTNSVKTSKQYATSTEGGSRGKRSQEENVSWDVESWQTKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEWQQSVGTYEDKTKRARTGSSETVSSKWNDGQETKGTVSNS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSARYEENRTWVDAVRDQIQKAQWNKTDQERTERGNPTGVPQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGDFRGEVNRYRGLQTKRDYSPEREKEAQTTERKGKYNEAEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAKAKKTGEAGKKAANTQEQDYIIISIDTWRVATEKREGTKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGVVRKAKQYDDDTKEEGAAGNDRGDFIRTQARVGERRETND, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQRPEKARNHEEVFNKKEVRNRANTGAAQEGRETPERGDAQV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQRGEGNPEYANFRSFQSGKESADTDAGRKQNQTWEEQTVQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDGGQDVWHKTIRSSEYQVEKGKVREPAKASNNTAEVTRGKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVKADQANTEYRKDNFNTGWERTGEEENKEAERTHYQFNVKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEWHFTKTKAFGQEKEAYERDNKNERVEQGNEDQTVNRATNY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVDWERKADEERGDETTTVYDIASSNLGQQVEKRATRGRARV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTIDRRTASWLEADRQVEVTGVAKGRTVQEDSNYAREKERGD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQDGQAEIKKTTGTNRKKIKKRIEDRKFYSVEQEGEEAHVSI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRPVFNQVEHQTAGEQHAPTDGTNIGKRKTTSSYRVEDESQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTIQSGDQTVDGGDEQADEEARENANARTVTTDGNTKTFSG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRDSKDGTNQNETFEADDTVAGGQDTGVETETIQTAASRTGN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDENETARSEREGGRTPEEVRRKGKTNVDDGETRARTAKVEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVEAEPGDEGKEANKTRREVRRGEGRNTEDTRDAGVRETKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEQAKEVNRERDDETGKQGHEDARSSPGYKVKVTISTARTDS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERYEHVGERIIRGPEGRVRQKEGENAREGEATENAETTKKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSFEVNEGKETGDPADAQPVSTKVEREYLTNVDNDAQKFRARA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNQRGAESGATADNDVKDLKFEPNKADVQREVEFATTPREVY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNKFDFQNQNQYVRNDKEASREFEDSAGKTASRTAKKGEFRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGQYSNKSRETNQNGQEEKAFSFFRFRADDNTAKKADKEGRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGQAKGRAYKSRATEKNRWEQAWRDVVGDEWTRTVEEVEVES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.810000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKAAKASKDNIEWFDGHITAKAAIGGTLERKVTGDQERENDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNKAKTEDHDIGEEQHVKVTSVTYGARNFWTKTTATAFGEDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVYGTGGQNHGDESKKSEVDTSVETKVGRNDRQEVSEAKARV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVKDGADENEKEVGRDRYHEGTVVNSAQGETRQSTSGKSVVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRRGSRVNAHKELTSINNKVHYAGNEENEEEEQYRARGNFNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQTGEDARQYNKGNENVKRGAEEFSKQAREPKRYLEQDRNQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAEATDGEQQRNVNEANRGSRSVKRDGLQYGKEEARDPHPTV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEGVVSRQQRNTEDREKKAPRKGQTGPTANEAVTVQSTDAGA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEQGYEAERSRTGVEFAHQGRSEPNEDAVTRRKTWNTGSGKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVENKNYESSTSFGGQVADTEHTGRRPGNRQKGAETRWEAER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGYGKARVREEEGADATRVVRKRPNHEGVEMKENIEQGNVKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRANREVEEEEGGNHEGKGRARITVPQKMYNGDEVAGKVKRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGTLNGLEEERRIAKIEKGANEAGRDNEINPYKRGRNFRVET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPKNEVTGGYNATREKKKEATPGNRPGVTRTFERAVDEIFAQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSENGKEANKDDQTAIETGVDRTKYERKNAQKGKVFVKKEEVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKTVEVKLRREKAHEKIREVGQQAQNTFDEGQREKGNGKATV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKVKQREGNQVVDLATTKFRQERTKEEGEGRAKHGEKVAIQN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNYIKATGTKINAGKIDEEGQNKGKEEQAKKQYQFRNVEGTP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIVIQDQTTGKRTENFGRQNSEGEKFTETQRYAGWKKPKDKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEDFKIQAYDRRVDNKTKLTEIASRELGEHFKENPKRAEGQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTGEKEQKADDDPSEKEEAHRNKRGLITQRFFNAIGKVREYL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNEGSVEGRTGQAHYREKASQKFDNIAIDKEENDAKKKRGKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVGENKKQRAGDSKDNGKKTRRKHYEAFENDAIKAVEIQGSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKTDGFPEQTKLQRKQKDQTIADRIGGQKYENTAQQARVDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEPTVAKSDDQGPEVKRKVKQKGENAGEEANKDLREENLRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNPQREGKENKNAEDGKTVRSEEKQKEGLAKPLVDGRREDAV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNTGSKARRQDDADTQDDAEEGVDKAGIKQADGEIRSVRIRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAEARPGNDREQGQEKRGKNYVDKIAEAESKEREVRNFYGNV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSHTNTVRGGKTRETSTEKILEVVGGAAQRYAEKSKNIEKYTI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAEASKKVRTFKAPTFREDQHVGNTGFGTNPTTQAQDENLDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNQEATNFEQDVGVNTGPKTHTKDGFFRAEDTSTKLQPAARG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERADAAVVKVRPGREQRLEEVASDGAGSKGKERITKVRVQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVQEERAVGSGVLVDRGIAGKRPVQEKTESRAKGEADRAKRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKVNVRVESADKDQASTGDEEVDEKAVKRQEEKGTRIEGSA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRSVDVQRDVSIAEQTEDAKREKVEEVSKEAEKGKDNAGTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEIEENGQKETGTNAVEKASKRAEKKGADYTSSNGKLTIQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNEQGRKKNTTEEELISNTKEKSSGETDAYEKKAIAVGGAQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAREELGNGTPRVIERNNFTKAKKTPEGSRTEKDNINSERYK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGWFVGGDRDRFETRRNVNERETETAGQAGERKAGETDKTER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEEQRDVEKEEANKENEKKPGDKREAARYRITRRQTGTANY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTVRVLQEDDRNRNASKAPEQVATTAENFVTTREGTATGEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAEIRPTAYNAKFGRDTAEREVREAVEAQSKYDNNAKGHGEF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAQGTKRGKNEEVQNEEKRVYDRFQTKREKVKEQGQNLTGEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEGKKRGDRNFAEATKEVTRNRQEKEEVGNVQKKTQGQLYQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVQAETFRTRDSGDKRSRFQELGESRGRSTASSEWERASEQF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAFFRVREATKAETDSTEQSGRGQFDERSRLSSRESREGQW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSPTYQRGTQESTSSNAREAAERIRKTANAEVREDGNEVKVRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.059999942779541"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVESEEQKAVTREGARTSRPRYTTAVESQANNERDNAGERIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGQAEVAELDGTVREETRISNSVSSLGGTEQEYRAKRTEFRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKDQEAKSENESGKAKNIFKPEIRQKNVGGRRRERTARQKDV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIVKRDQRGDNTEEYVDTASGTEDNTNKQRGGEEEDAAKVHR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.120000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEEVRGEDRKEEEVKRQKFDDEGRQEAPQKKKYRATEWNARD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLQVNGDAKYAKPEQTKDITEVANTIVAKKLREQAKTQKGEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRGAAQTPAQKTNAKKLIQIDGNQVKVEVLKYDEKEKEGTAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKELHDAERERTTKEIQTEARTDIKQTVGDVENEGQKARGED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLQDRQTRKKNIKVGREATEDERQHTIEGVKGAEATDEDTEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTVNLYIKEEEAQDSQKAKRGADSRTGKKNYTRANENKFDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKRARFKAKNGADVKQSTENDEKYNQKDETTLEIEGNAYRST, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEYNGKRKTKERSTTFVDVNVAALGFQAEGDATADSEQQGKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAEQYGQVQKERIRKRKTVTTRANKDGGSDARDHLTEPTARI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAYQRKLIETNRQEGGLLVLGEQQQGPHGQRAITSRKKLATT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRQLGYYGRTDREEDRERDVVKGTTQPGVDLVNNTPEEKEED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEAEGRGQRNTGDRRSADYEVVYEGAAQNKEHTVTTVDLEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTGKFVNEEQRVRRLKEGVYRYADEEIVTGSENKGYAQAKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREVKLEEGAARRQNNREQTGDLGDHQKDEEFDVNNTNGATK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSATVRRIHNKNSGARAREQGEQHGYEKPVQGENEPYSGTIRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEKVRYAPEDNATERKGHQVRGRGIQGAYSNQIHRPESNGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.850000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKFTAGKTRVNVDYKTGQKDFETKEIGTKEDDRQGNGYGKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYKFKDVNKYDEAIEGGTVQTKAGGGRKKGEETFDRTKQDTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVTVNGFNREKEGHESRTAPQLAKEQTDGSWNNYRITAQARE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSVIRSYPSAYRKERGAWKEETGARVEATEDSIELRSNKKGTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNEGRERIEATIIGRQENETIYPYGIAKTGKIRPKTVEGRVA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKPSKVQRKYNAKEVNQKGTDVGQNKAGDVDREAKSPNFSA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQRQSDTKGEAFVKNDGYPVKANAQGPVGDENKKAKRNSKVS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKKGKGGATDYERTNWQTEVRQEVKSKAFEVKEKQLDGEATY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERTKGTKHRESKENIQGTGNDSENQRYQYAAQFDANVRTDI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYEVRSAGEQTSAERRSKGEEAADTFGWTTVTERVEKARLQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREEASEVGKSEEERRGTVFYWAATDAGQRTTKVRLAEQTGS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKTPETVTDRKKAERGRPASEQWKDRFAYTISYSVTDGEGQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRQKDAPGDFTAGGWERSTTSYEAVDVGTIKPRKKREYQSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.699999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSLTGKAGIEDGEVSQTDPTESLRREAIKDEGRQEVANGKARG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGQGKVQKEQAKVETEERIETAATKAPIRKWTDSDAEWKWNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSIEESDKTKTEIAKRDQWGEKWNAGVEKKTRKAPQQAEVAWT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAKAQGRGETYTRTEKTSGEKNWQEAGVKKDSREAGDLDVTF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSHTKQGYVKEIRIKKGRKDGTREANEEYKDFNNKQFSGEARA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEYELNKQATTSTRAGRRDVEDVRNYTGEKEETGGRETAVAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTVEKRAREKYGESTERVKDAVKDEAASRGNSEGNEIRWRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEESKERTRSKREAEGTEANYAGWGRRREKTVSDENVVKAID, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRYKERGTEDESIRKLEKEAYKIAERLRVDDDRVEKHIEGN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERLDKHEDRVYYAIEERSRVIDGREKKKKENEIDATELRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEYRTDVDQEQSKDEGRYTIEKTDETFNKDEEVKRQKLEKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKDTTETKQTKYEKKRDNDERFTREEVVSYKEQEQELGDDI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERDGRRKEGRNDNDREYENDVTEGDEQIRSRRFEYERVDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEEDRTNQEEEGKSINNRVKHTIKKESEKKRTAEFYGTER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRRNTETEVEYKTWEDVIITEGRGKEVDKKEEERERQAVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSNDITFERRDTRRQFHTRIEEDLEKVEKESNGEEGQVRRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKNTVEVSKKIENVTKRKERTDEYGDRNVIRTEEHRNPRGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKQKEFRQYTKVRTSNTTLKYKVDTAKVEREGGEQEPTRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYKVRDQEETKKKVRQYTTTLFGKENEKKRVGRTTPQEAES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.790000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEKREADTKTTVNEVENTGEYQGRRLKHTDRLKELQFREE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEERESDDQKTVNTQLKDEKETTLGWINEGQTRTFKVQSRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKYTEGRERQNVENVEEYAKTEGWLVDGSRTRIQKRIKDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAHDDKEGQVKRTYVRWNQVNAKKRDYWGTVEQKTDTKEDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKTKDARDKERGDEIYENIKKERNTGRIEQKKVQVEVREV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRDEGAVKKQGKTYDRIEETIEERVINEKVQKNEKVERDRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSFEIKKEELDDKEKTRTDESYLQDKEKGTDKTDTGTIVTDN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKSQNTVREETDVTNVLEEVKKNGAQFEWRDKEFELRGRAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRGSEKKRQAFVFNTDREEVGVTLVAQNTWRKDNEEKEDLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVEELETWNTETRSEERKRGQFLKTVRDVKRDLSERRLAGT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.870000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKYKSAKEQERFQNVHREFDEKLEEGYTTESDAQQTGKRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKGDAKTTERTKTEKVEDIREAEIVNELKEGREKVKKWEYE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEERRTTREERKDANTSTLNGRTNEVERVIRDYLDGLENR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDERQYVENTTRVEKVKTRATETINNLTGETKVKNGDITKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTETIDVTTRQTSENVYQEGDESEDRESQNKRELRIEIRTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHAEEETWRQEEDRKSETSKEKHDLRRVRQGEVQGLENVGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETKNDVEKQKKGRELNTKLEDRLKQVEREEHGQQAEVTYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAEKRETQGEETKKRKQLKDQLEDGNEVLNQTTHVVEEKYR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRDRLEAETNTKVTEGRRNLERKFVDVKLERSGEELTIEVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVLVEELTRDREAESKRKEEVINEVDRLNTEGKTTRGTRFL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKSTDDGDQERKKDEVSDEGQQRVYKVKVTEQAKDSEVTWR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDRQLEVTRSREFSNLEYEVSDKGLRGEEEQDELNTTLQET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNTVNDETRKRDLQEESEALYLWKTGQVQKYERGTEVTAQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.090000033378601"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKEDVTEERRVVVHDETTGRIVNGVRHEKAQRRREENHEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTSNYFERERDVTEGRKKVRTKFEDVTGRTTVEQKEVKAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8399999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKDTEELREQERAQYFDEKVETKGNTLKVRRQVNRERVDGQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEAFQERKWEVNEIYITTDGLETTEDEQSTRRNGVDKEQET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEKEQIRRKTEDKEGRDDFKSEGKVGRTREYPVEVKWTLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRPLRTKDGFKEERGKIEDKRTKEEQSVTKTEWVRDEEGYV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSRKLRGEREEEEDEGENKISDDWGKVTTSDEKVQIKLERW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGSQEGREWEEIVERGNIKLWETRSKTLRDKEEVKSDEKDD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDRRNTNQIETVTEVTRYANKNVERIEVTGNRVEPEGSEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSHRDRVEEERREDEGKEYWSETVDTGRVRETNVKRQLDGA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.450000047683715"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTDEWKIPRRKAVVHDGRVYTEEREWEKEGSSAEDTTVREQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7300000190734861"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGKFVDYRTEGRVEAEREKTKNVEERKRIKERESVLTKTKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEEKDVKQKDEVEELRSNGEKNGRQPRNREEIVHERAYYR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDQREGEETTTIEQAESEFREKVYRLRHKETTLRGKVENT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETAEFIRVRLVEEEQTQEGETKRRKDKHEGSTNTLRETEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSFRTNEKKYRVTYEVLKAKEKERKVEKGQRREEGSPDEKEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREEKEGQKREDLRKVYKHVKYTIRNAEVNRKTVEEEGEKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEKQKNVEEKYEKHAYKGKRVRDRGRTEENVEILTERVKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTEDVKGEKRVNTQLTGRRLVYENAKVKNEVRNTEETPTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNRRIRTTEETEGKQVEQKGTERWGEITVRKTSASVELNTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSLDQETRTERYKDEVWPTKWTRDTSRNNIKEVTKSHEGTGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNWREQKNEVEDQQDREVRDKVGITTLGSVERKTRTTKEEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKREFEGKTRNRKDEGQERVTTDVKEVENERSTAELNVDWN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRTDSAQTYSKLRTVEKTIYTEKSFPDNEKKKGNEEVETT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNYGTIEITNREERKEVQEGTQTEETAIKTNVERKIKDESK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQLEVGPRTEERLEVRWKSRRHDTWRKTNQEQNADYETYKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNQREYGEDWTTVNNVKEEGNKKVVQVEPENRIDEGTGKEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVDGDKQYPNEVNGVTEENKTNVKEEWREKRGVVIGENEQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8799999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNRTFAEATRLEKTNDREHGKKTVTEWYDLQEEQGDEYERQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKETGELQEVEDPKRVEENLERRFTHANEDKSTGEARVRRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHESKVHNRFQANEEVSGNRYKLEETETHNEDRTREKLKVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.289999961853027"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRHEGEPDDKVFVFRKVRERHAYTEEEFRNRRIEKAEGRRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYETKEVENYESSKNGDRKIDTELGKERYDQKVQRNRAREG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQSEDRVRKHYVDETIKDNLSRKVTEGEVERTGREFDLRNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDENVTNLQIGTDTLVTEKSDKGQENITKLEFERAVKRTQD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQDKSDIRRTTEGRDVRTKLETRVANGTWEHDVQDVTVKIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTDGATDKVVDGTKHTQVNRDRREKDESIVWRVILTRQETR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNEEVKLTSQREADTLKKRVRKRIGNGKISKEELKFDFERD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRDRQLSRELKFISEEIGTNVRVKNKKKFERALDKEGKTED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKKKIKVESRRRFSEAKTRWRSEGDNVTGKEQWEEIKADNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.930000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETVVKGQNVRIKVEGDYGRRQVERERHQEDTTTRVAKKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQRTYEVEHSKKLQTGTNEAETQVKKVKVSTSFEKVNGNTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSESFEEGTVEQTSTQNKRTNKNSYEKVKLHVQVEKGKTTAV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETRSEAEQEDTRNDVHREGSREGDRVEQTTKVTTLEWRVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVNEEEGEKGVKTSISERIEIKIRKGRKTRTEEKRIARDES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYITEKTKREEVKGANVVVQKEEKVADDRRGNDKEKDEIED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7300000190734861"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKNKRFNRNDHARRVEYEVERTGEELQLDREEGYLSVTES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYEKERHTYRVVESFQEERDVETTELLERLADRNKGNGSRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSENKIEVENVKKVERPTTKGTEKGERAEIRERRVKIQVKNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTGNVKEVIEKPKNVREKERKGIRQNRTIEEVETEKVKEAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKETVRVRDDKKKTRVKEDGERNGLTISEKKEEAELTIRVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSENTAINERVGKEDLERVRPHGETIEVVTERNKSRDLRETL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTETRVQKAQQVETGSSELEDSGTYVKRRTTVERVSPEFN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRQVGETQVAYTSNVTTRSQRETTEESVERVDGSKLFRPKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKENRYIEESEEVNKGWKTADDRGQQLRVNTDRLKAEVSTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETTQEGVYREPTEFVREITRNTVKRSVERTDEDDRARNEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTQQRIEDRKSLSTGETNVEEKVEEINVRKNAESVTGEYK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQKDKKLTKEETGQREVRRINEEWDRFEAREEATRLNGRRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTGNTENDAKIRWRQEREELLRERFERAVEKRKTEGRDKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKDGTAERHTRLDEVDKDVDESIVHITLKETGRNINIRER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREKSKARDTDEIKEFIQEVTDTALEGKGRRYTFDVKFQNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTILIKETKGNGKFQRFTRVFQKRAERSEDVEEETDKYADD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKEITVRRGTKITELSNDINERAESGKHESDINEPKVEKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRVTLKEFEVEETRGRKVRDTHNTRAEVEDNVEGEGTHEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETIGVKEERTRRETGIRLETTKEVISPSDQEGRAENLSRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYETKKGDDSELIRNLERHIKRYVAGYEFREDITSSEPKKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.350000023841858"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSPRGSINKYDDLEERAYFGIVEYEKDSKSETRITKHELERK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSLEEVELNQESTERSIKRKGSKRAEEVREQRDKGNVSGDEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKNVTLEQSEEAENVERQEGSDDSREEVGILKRKERSKEGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKERSNTEGQRLDKFTSRPTKTGEEIRYKNEAETVKVEER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRTLEVTTKSEGDHITRDARRELVEVEGTKSIKSVRFQEH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKRVEEDSTHVRTEEEIGDRRTHSLKLSIKVVQTRETGAF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRQEVQAEKEETGQTPASNVDRDLDEVDRNRTVIRVKGNRY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSGVDSKFDSVERYNDVLEQWVKHTRQEKETELKKGDTTAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEGYHEERKEFTSRYVRAEQNTKFSEATDSETTESLQNVGV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREEITVTEEHKGRKIDQKVERDVNEGEIKRRIGTIKAHKP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSIRKKETVAVVRPQNIEKTREIREEGGIRKTEKHDDIEHKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRVEVTEDLVGIRVEATEGERRKTELKKVNDERHRSFIKGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTRTEVSDRNNVERAKKEGREEWVEGEVDERGRTVDFTNY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTEGYSTREKTVKRVVDEVVRNDEERFWEAGETNKDRNGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVREEKDRVEVTETEKAQTEGRQVIKDRENFRQEVEGRYRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKQTSEGNKTNEWTRRKKKITRSGIEFHGNKEVKEASISTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSLVLDEEKKEREGERWRKKTTNEKKKTRRNGVVVETADINI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKDGRVTDVEKAGNKKKNEYDKQKKVRVTLEETDVTVYRQQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEKYKVEEKQEVEHGTRYLEKTIGEVDARKSVRRTRVRAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKKNLTEERGRNIRTAVEDFEKSPKRGTTEKKARQIEIEER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKKTEFDQETEGTQGFQRVTEYGKKVKAQEKADDLNVRRF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVKEVAREREGRQTDQEKTVTVKRNEDFNVKGELRKEEGYH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQERVDATERREKKKGNTDIDREVGYNKKKTSRIKIKLEVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVEKKDGRERVTGKKKERIVKTTESKEIKYIRDNQTDLNAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETRAEVEDQTEKRRVEEEFTTKGNELREESRKGKLSVTQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQQSEVEVKRVEGKFKEEEEETLRTNRRKEKGETLADTSTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKEAKVSDETKGETGDKRLKEDVLRGTIEDRLETIRVSEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEVERQTTARRLTDEINGLGDQKKLKNKDTVKIIDRETNLR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.769999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVRFTNFEKHERSEVEDVETRNKVQKKVEGGRKTKSKAQYL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEEVRGDKEKEARTTKKDVEYSVPRLTLENRGIEYEAEET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.990000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNIVTTELGERKARRRRERTEDVQTRETVYVTLEGTIDTEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.440000057220459"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDYSHRGKEQESGENFEHRGTTELLTVHVENSAEQVRVDRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERKKRWREDEDLEYLYETGKERVTNGQEEEQRVNVDATRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQQRDRKYGLENNEYDLAKETTTRERKERDWERVEVVGEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEEVNLYHESEVNRFDETVTDNREPFDIKSSDAKKEGKRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTSEPKNEDASELNTFSKNWKKRFRTGKWQWSEGKFRNKLN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGKNETFRENDQSSKLNTFWWPKREKKRKANFNLKWTSSEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRQNEFITEEVYDDTVAEERTEDNTERRVETRKKRDGNRKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.990000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETDKRTRKDNYVNEGREEVTQRLVEGEVEHREFELTGDSK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQEDNKEEAENVKYEHVSERRGSTRQRTNEGRKVAERIGEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTKTNLNEEYTLTQGTTRGEDDAVKLEETRERVRLEVTRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNTTIEITTHKKGTEVEENARDEVKEFSERSRGDNVQVERT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.680000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQNETTSSRRATEVETVRTNEKVKHDEFTIRVENIGEEGDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETTATINEDSTVERLERTVRDRGKQVDVNRDEGRITVQED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETVIRDDRVEIGNDRGERAQELRVRENTDSTTQDVVTKET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNKEEKTTRDRRAHQGAEKIKDKIRDWEVDEESVYLTGNFK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKVKEEVAEQKVRKGTYRKKENEKRTIDREEVRDENTWVQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGEERQVYGDEETDIRKVKTVNREETKSGYETDQSRQNEAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKETTTGQQPKEGTRFHYKLTDKIGKAHVEREVKTFELRGV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGQQTRDHLFETYREIPGGHKTKEKKVTKKTAVLGVFETRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGRRTVTTKSEKEKKKSDKETVVKEYKNEEILVERGVKEAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDRENTFEERTELKEAEKRFDRNAESAKLEDNTTKVNWEFN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSDRNREVKRFERNTEFFAEEWKDETNKTKELNAEDELNAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTIWERTRLVAKNTREEVEQGLKLRERNDEKKYEESQRGNF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYRSKKLRYKEKATEVNSKVREHVDTGETEKEKGQEDVRKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.910000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYRIEQATKEGEEKEHWTSKREEEVSKRIRKERDKVGNVQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQEKAHRRGKRLYFKEKDQSLIVSGTESGVDKRKTKEDTFR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEFTIQFKETKRGEELEEEVTEEGVSAKDKKETAKGNVRKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.049999952316284"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTDRETYQESELEKLKETGKKEVTEIKVKSNGGESRATDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTERYRVENTEEVKSGEHRGENRFVRAELDKEINKGDGETI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSIVSERATKRVEEETNDERKGEEVREFARRFDDRQKEDWKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREELKVDSQETGDRIEKDITRELLRASEQEREITGEINER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKGSRDRLEREESLGETIERDNREEDQERTEQKEIILTAIV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNRREEVRNWDEGEEAGKEVQETVQRIRDKEETPDWSAKKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSANEDAWQRVQERREKRVNEEKRKTDEIEVEGWGKPDERTS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKSTTEGKESDKRQNVTKKIDTYVRKLTEQETSVTVTGTEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEVRTVDRTETEEDTDDARIEKKGVTRNKQVWTEEEEGDQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEERVEFDEKKNITRVTRDGTEHLAVGTLKSRGTTVKITET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKGTTIEENKLTHTRGAVEKKGEVRTDEDTLVTFERSVRI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.699999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNSDGTTSKATRIRKGEQQVKKTIEDYYEKENPSKKTFKRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8999999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRTERTLRRDERRSGRRKYNTLVVNRGVKVETAREEDEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQKEGTVTDEEEREYQRRRLTNTVLNGETQEDENTRQLTVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTKERLKKKEVVRKVTDEIHEDVSAVTGKYKGEKANGRNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKKEYEVKTIAEKKSAGKETVDKGVDKKVVRTNRLREGNEH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRETGSVKKTDQVESGKTRGQRNVDEADERDTQLEVELREF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEKNEVEKRDKGTQVKKSLKDEVAKVSVYRDDGYERLNNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNKDVEVDKEQSKELTKKGNVDYVEALEKRYGEKNKSVRRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.889999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRNRGEAERDEHVRKIEREWESHGLKVTIRSTEVEVKLKQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDEAHVQRKEKINKTVQGEKQWQNTEDKRRTYKRKEDGKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKNTITDIVNLKTSIEAEEEKVKAKRVIGRNSRKKKDRDEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERRFKGEDREEVQDVRENGTRRLVRLEIDTTTATLHVEKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNKRRHKTFEVDGLDTRREELEGLEQTEAVRQTERIRVVTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSLREETGKTKQDQVDESEERVETRFKNHRYAAKDKTIGERR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEREDTGKEEKNRNEVERNIRTEVYKIKREEEGDEGRVERV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNVETRTEDNKEREEKGVEVERRYRRKGEGEEIERINEKVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEETVREREIREPDKGGDQVKKEARTVTAEIRDVNIKIDNH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKDDFKGTTLENARNVAKRVEERGTNVEVQERGTEVSPRKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSASKVGNQGVKRVRTAPRRTFTEKVDDEVEVRTNEGEELKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTDINLRSRKSLETAKEEAKEGAVQNETEKDEWEIRGYIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREDRKIYEEWFKDGDESEEDRDRQDRRLRTEQDVIVTGNN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAEVKFRKTRRELETNKEKGANDDRKTTEKEHRWDENGVED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYNETDERITETAKKRDLTEVRQDKLTKIDGTTRQFQGVKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEGLGRERKNEKQTDEREVQRKLLKQSKTDAVFDTEKENIV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKYEIRRNDTREGTEGTKTFRDDVREAETKKEKLTKTVRSK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSENAFEETLREGSVEKYRRKTKDTTKRKKDGTVKRTRIDET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDTEQRKGERDGNTKDFSRTYEIKNTVLEKVFEKKSEETRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTSTVELDRNTEAKQFEHTVKETVQTIRVEERGKKGKIDRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRNEDKEGATTRVRRDERDGTEKITIREEVVEKKTLTEFNS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.070000052452087"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDKHRKVYNARAIETRNLRTEEGTKYETDTIVNESGTTESS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTKHRFTKEEEANYGVERLTEEWETVKVRTRGRQLDADVQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDETQNFRYEEKVERGETEAYNQFRKQEQTYTRVNNEGEDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVGKVTNGWNRNEREEDYVRESGQKKKDKRLTAREDVRQQV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEGRAHIKDKTEQQKGTDEFDRVGVKVSQTTEVETWTAEIT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRQIAEIDEHEGTVVTWEAGEQTQTKERDSTFTVVKKGTKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKDEAKGTTHREFKNVSEEGKEQVKEIDEKTDNIELRVTRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKRIELTKREDWQQVNTQLKDEGVRGTKEEDSVDAEVENE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.990000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTYTKDGEKDEQFTNLIRDVEKEGRNVNVNTTAHDWTARKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKWNVIENQKTKVHFERGDNDDRTTTTATEKYDNRLAVGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEEGTVKQTQDTSKGTDTAKTRAEEFTQEDRVKEVKINEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTKAEYGRTNDIETRGEADRNTEDVRERYKRVVKHTTEWS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGRNYEDENEEVETASGKTRGRTDFTKIKLNTEELRTKDTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRETETFQTEDEVRQVKNEFEEKVDTVRVTGEVREGRLRAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEVAVTVRRKNDREEGEVQETDELETQVETFERKFVGRTRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRINLAEEGRRKEKVETVDGYEDQHKDTREKKEDQNVGILR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.930000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKKEKKVNDRRTWTKKTREGTENITQVEGNERELTLEARYN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8999999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRILKRNKYLTTWENEAKNEDRTVTRTKGETKEREEQVGN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERRETKTEVQRELEGIGWNEVDYESRSELTRHRDKRSGRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.970000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNKYKQTEKVDDIDKFGRDPQTKIRTVEANKEKARGQGETL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSFRGTIATSRITKKEYKEEGNEEQDKKEKLNVTREGEIRRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDRERAEELETGNQPWQKVDEQIVQLRREDRGEQWYASVH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERKIEGKDKQNGKHVEDTVNDKVRTAKERNEVTYETIEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSENVKITVHRIVGEQTENEVKTGNREKEYDEKDEKDAETKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEESVQQKLAEREKKEEGSDDKYSQRDNYTQSGIDQVEQKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHNRRSLSQDENGRQVEHELESRFGNFEAEEKKVTVEIKYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNEVDEKFVIGSKRENQFRRETEENTSQVYRGKHAESLELH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRKVRPEDKKDVTKAKYTGTDEINIVEANEEKVETRGEVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDEEGAREEKYNVTGVRRPETRDKIKVVKVNTIEEAKTEDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRKGKIQETEQIDRVWEEGSKTIKEGEQNDDRAKVEWENA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKGGDNRRVEFVFTETKTRRKDLESRTEADAKLEWTPNERN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEVAYKQTREEYKEDEEEWRRRQREGHIRGKEGEEGVVIKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKNRNELNRRKLANEGLEKWESTVQRGTDDEEKVTLKVSEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEETVEVNDERQVNTAKDTFERRVGKLKENENFERIRGRTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRNGQLNDDEEGQTIEKKATERVFELHVDSEVTYDRVTKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGSKLRLRDRKFEDVVYEQKKTDGDTINQTNREHVVEATEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTRDETRTTDIVLRQRHDKGKTLTFEQYKPVFTGETEEER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNNKGTLKKEEYRHTAENTIKTDAQTVRSDESTLNEEVSDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKESKLIAKENQEVENRSRVTENTDTEANGYDTHSKDTLT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNTKEKGTEFTKVEKLRENVETTLGKIEVRNEGREPRVNKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNNVGKEAVGKVNEVTEFKLPEKGTEEREIRKLRTKETRNT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKREYEGEEERTIEQVEDYLRERVEDINGESTGERVKVRKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQGTKKSGIYERKEESKNAYGKTRVTITYTISGNGDREREE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKDVELRHSETITTVSDRGRNRGREVREEDSKIEIRARTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTKGLVGEERDNTEIKVRRRHETSRERRDESSIREDAVTI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAEIRKEIRDGTTVVTRKENVESNNTTQREQTDGLVKDTDY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEETYVERDEDGSELRRNGSKEAGNIKISNRTIEVTVEET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTERREVETRDEVNEVSKRGDKQVAEAEVERDGRRINGEKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRDTVTVKQKKDRRELREELKDRVFRFRVTDNSWKGTGESE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEVGRTETLETVNGKRVDTDEVRSRRFKRQDKKLWKSDEFR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETYTRNKRVREATRLGTKGKRELDEAEWNRREPRVKFTED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVETREVKGDERETREALGRNERPTRKFRNLARTEYDKWTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEENGRENKRKRVKTVKETTTREIQKGEARHEHVKIDLRET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGQTNRHTDELEEREGTVRRYRRQEEEARLGEAFQERKSRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNLLEETTVLARERGDRNERTRFEVETENQGRPVREKEEED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKFTENGQEIRLNREDDKKFENRLTTTKTKETNRVLEEHKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSFLGEVKTESVQTHTERDETRSAKGDKAPQTYFDQNRNGKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEGVAKLDEHLEDRYRKDAVTTNNWKKEGDQETRKKETNEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRRGNNELRDKIRDNDEKGDYETQETYTVRQDAVLKTTKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEYGNSTAVNGNETREEEVKRILRNKIVQRERVNEETRKER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEFAVKTKKRISEKEDHEQENTLGTVIGVEIKNEKKTGKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAKNDVIVSEDGVREGVIRTASQTYKKERRERERQHQLTEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSLLFRVTTGQDTRDETEKRKKIRLEEEFHIDRVRAGNNDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGTQNQESSAKEIKEAVGNLRRKQESEDETYERDNNHKLVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKDKKRVSRVRSVETVYEDITTTAEEGKPEKKGDEVTLEEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEERQQAKRTNTWRTVKRELKEEQERVEANEDNGRWTFDVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.200000047683715"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSIQVTSREGKEEELKEITKEIIVTVPKRERDENTRRADHGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVARKYVDVEEHTREVGHKKYSKTEETEVKGKDRTKEYQKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSLENKTTGRSDTEEYNGTVVQREKTKQHEVLEDDADTRRYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEIQVERRTVEIDEKGEKETHFAERRKVDNAETRKSHNATH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGERVEVREDKTAETALQEGKQTGVTVREEEEVTKGRIRRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTREVEPQFETEEFDTESKNVAKNKRGQIKGRHVTRTQNKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.699999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERRVDFENRSDVRDLEEQASTEGVEFDGTRKEVTGKGRTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRREHDVDTKTQAQRFATNGKQELLEVDETREFKKVEGDWQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRERETVRSKYKAEDLQRKFNNEGREIEGEQQRVDATFKKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRNESQVQQTDNAVEALEKEKREETKKRYKRGIDFEREGRF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVETKAKERRKKEYQTELNRSEKLHTNADTTVVWKDGEGVP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNRRETGRRRREVKDVETTFSETLETVNNTEYEAKKEGEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSKDEELYNERENTTETVRKEEVTRRRENAFKTGTEGKRVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSKEINGEQELTKNVRNQKEDKTWTGEAQRTLEYKRETATY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTGTRTVRGYWRLRNRYEVVREAETVEDETRELVEDNTETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTYPEQTRVRYERGPFNALSKRRKTEGSEETDTSKFEVNET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKEVEGKERETVRKGATTGEQEVVEIDAKTRLEKVRLTNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQLVKEAEYVKNKTDTYTTAKNSTTIREEITDPVKENKKGG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKKKGEATTKRKGREVKERVSNKVERLKGEREEIDVTITKI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEERREAEREEQVREGEDRGKENLRTIDISNKANRVDIEVQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTEGKHDEIQEIESPKEEAKKTFRELKVSRRVTRGNINKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRELTDKRKSFNKKEEETKQVREHTIIPENKSGIKAVREGT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGDEALEIDPVRVQEGNRRKVKTKTRTDEEFYRERAVENEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRRETYDNNYKGRKVWDTADDKWEDWEVTRTIQKANAEGQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRWDQADEKNYRGYVVNETRTERAWIDQRDTTKGKWKDNEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRRRTKNHERKGRKATERGEENAEEVEWETKVKDVKIKLT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNHGKNRTKVERKTGEVKKEVLTIERTERDEARKKWKEAER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREDENVENKDNTQQGKRRIKDQISELYETTESANGRVRST, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.790000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDRTLKGEKDKKERRARKEIETNFKTIEVRTETVTVTVNGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNDTDKTFVETNTAIKIVTRKRVGKRETLTRVEKEGREEKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.769999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKSDVELDERETKRTIQTRGTTELVEGSKEKNDINVDFETT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDEVLKGEVNSKIKGDTTRVEEEREKTQTDFTISLNDTRTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDREKELESGEERLGHDFNVVEGTAQRRRAKFITREEREER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRSEIHLRRNKKTRTIERDANETGIRGRVREEDVELEVETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGYRENELKTKTTLKEVYQDAEAGQRWNSKQTKEEEKKETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTDRATVKEERVKKNITENVRTDFGKLTEREEIEEVNLNGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNVEEILRKNKRLNEERTKTEVFEEDGEIGRRKDTATTVNV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEHEGEVEKKEEVKNVTNNFDKTIRKYKTERKRVTGKVEAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSFVNTNGTKENVEKTEAKERVRGVHKIKKKEYETERVDKEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQKQTHVETRRNVYEVEETGNRSGKTAEVRSEDVKNEVTKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSLNKGEERRRVIDTVKTDNRNYEAKREKEQEKTKRQGARIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.9599999785423272"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTNKEGRSYEKGDNQRTRLTYEDFDVSDQEKEFKAKLNRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKSSDRVTSETEVEEGDEKIYERGDQSKTEYRTVRANIHTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNNITKIKRQRAAKDVQRYGKEDRYEERTGETRDEREVGKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSRDFGEQQLDERTVTTEVENEAKGEEDHKRKKPTVRQVRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDKEAEWKSNTTAKTVNEELEDNRIKVTREHRTAKEQGYVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEINVTYKSWRRAQTEHAETTKEANKERNEEKVLGTDKDVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQKTVKVKNVTRVQDAETEWREKEEALQPDNHTGQFTPKTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEYEAQGQERRGAHRWVTNIRNRAREEKITDTTGRWEVQEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.949999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQGEGETRRNQTKQRIAADVWNRTAYVRVIERRWEEETHGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRKVDATEERKGRQLAENVDQTGNKITITEDNLTVEFKRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.810000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEKTHAREKQTGTEVKRKGSSQVREVRDKDSLQDLDVKHE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGEDVVRVKHLERSEDDELHKREQKTDSQRSKETGTAKQKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKNETEVETHRKETTGYQTIRDTTFDLKVNDSAKYERLEFK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGKIEAKREKVDKTEKTETFDYTGDQQKNVSKEKVDHRRYI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEVTGTRLHREERRGKFERSTETLRVSTVTRTIDEEYKHAV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7300000190734861"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREEFEERRERKADRIHNEIKTELVKGEGTDRTIRINVRAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRETEGARKRIRFEKEDILARRGVTEERRIHVTNEKNTIED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNVSGHRGEEKVRVLRRNDRVEKTLETLARERETSTEDKVS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRNEATIEKSETFERVKRKIDNELGQFRERKKSVDGEIELD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.299999952316284"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDKSFVEKVKRRLTEEEGRKRIIINEEQNLDFRGSAKDET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEQIKRQGEGEYRKAERINQTNDNEATLKDYKKTTNNETV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTGKKYGESEEEPFRFEEVRKGTKVKESRSRKALGSFNETT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRYRKDNENTQSRDSVKEEGEETKLEATETHKVDKESGERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVTGKVSRKTTTEKERAFIEVLERVQIKGLNRNEEEERRSD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEREAEVRTDTEDREIKKEVNQRTREVREKKYGENDSVREN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKHIRVDQNEEGRKGTEEGEEKAVVLHVKDHEATIQVNWE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETETRAQYERNGEEINDNGKHEFRSLRAEDDKVDIEVDKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEIHEVDFNNEKREKEEQDDTEAGREDRGRDIKVALYNES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRYEENKDTKNERAEVTHRQVVTRERDTSGATTFEEWWGDW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTDEGTRHEFNKGRRITREAEEELLKPKVTVRLHNVRVDES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKHPIAETELRRRFSVHRTLGEGTKNEDKNVEVERVTLDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETSTELDETKQLREVRHEVREYGSEARNRQDIKNGEGETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.02999997138977"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTSRQVKIEEAEKTRTESYGEERREENEHLGDLDEGRNVTQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETHLRVERKTRFKNVEKEATTRLVTGEEEKRLSEGEIKET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKSEAELDEESTVQKAEEELKERVNTGTVYRERFKVRGREE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEGTTFELDAVRKNETRVYRESRSQKVLKAEVKEEEREEGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNSSEEVENQERRTRWHQKVYENTENTDKREETGEVTIQRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKEIEGERHERLTTVAKEVKTTIEDAKEDEEVTHIHGTRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDTVKIEENQRFDEVERTLDETEKRAEFTDRLNRGRLRER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKETERIRERRRVRTGENRARNVADYIDGREDTVTVEGTEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETRDRARTRENGTVEGGNKAVETRERRIYTEEVRIDVERD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKFGKTNWREVEERVKKEKEQSTTFEDKDQTEREERGQLKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKTRQLTQRKQVDNGNTSVETRFGSVEETETVSTASLRSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSLQVTKREGETRNFVTTTKDESSEQERSTVESRVALGTSNQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKEAKVKNKKRGRRGDKSLTYEIVQVNKEQSKGEERVEDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGREDKKEVSVRLRKKEGNEKIDQVSGETAKKNQRKYVEER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRESREIHSRETSNEVREDGKRTITTVRGKEEVDKADWTYE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYQSKNRRKTSDVEKAGYEIENEVGTARVKRRTLDEDLETT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.139999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNEKETSLSRAAEREEENITDGRYVGKLRTDTVQRVDTYKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.02999997138977"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREERTDRERYNVDEGEEKVTKRVKKGKVTREEVRATLRFE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETATRFEKRDGNVKEREKEQGVEEKENPLSELSKREKTVV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDRTRVQNRQYRSQATKKVTETGTEQQDEDKEGDIDATIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQTRVNAKYRKRIETAGRDWQKEVETYKVREDIKEGEITSD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDYRQTVRERKLGNTAVKTARTDFKEGEDRQRNAEKNFYKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGRTAQERRAGYDTKNDVTFEQTKRAFREKVRYNNKKDLEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTNDVRIEEEHKRRRGERTLEETNSDTEYKETFNQVKINAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTETYDVSNDKADKVAKKIKDDNKGSFDRQKKNGKVEIHVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVDHVEITDEEKVHEVQRQGEKNIADGEVNERYGRKEARQQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEHNRVQIQERQIDAVAGQTEVGRVNDVRYKEDEEGKKEH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEGRDKRENTEKDDEVKKIGKSEAQNEKHSKFTKTNVRYDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTIRERKTENKKATKITNGGKYATDYYVDTNRKVLEKTKEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREEDRKETRRTLNEVYETADKKVNTGKGRSREVQTEVYAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYRSLEERTENKRAQERVAGRKKDETVYTRDTNEEGVTKDV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEVGIKRSTAGKVVEDGRNKVRDTKLTYREKSHEDRQSVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNKDAEFERREESRTLRTQFYERAVRVEDEEENFKGSGYVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEVFEEKETRRSDFADEDYYERVEARRVGGSTQFNELRNKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKVRVEQQLDNQVKKTGEDYRAEENYIDSSKDTKQERTTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8600000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRAEATRKLTDKYTTELVETEKGDEWYTQRVVRENNEGLR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKQDQKAEEDTQITKGDNDGKRRVERANFEKREWRVYVEGF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKRVAEFEEVNADKLNNKEEITTGRSEAVETPTRNGTRYD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHKDEEINETKQAEDALYEGTERVTRVELRKKEGTVRFKRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTERKKVKTEKTRRQGRKEGETNVHNARKSDTVTSFSLETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETSEKGRRYEKLDEAKETVEERVTTIKVYHEVEESRGYTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSRHAESREEVEEKELTYGKVRDVEEIDTRTGVTKYKTEYE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRLGTEEYVRNRGQGNTRKREETVLEDLTTTRAEGEVTSSV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNNRIRVENTDEFNEVKDTINETGTKLKGEKTLETAQVRNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNEEGVKTNRDDKNKAIIVEKTQFETKRTNNREGETVNLLT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEVNWRNEDTSTGTTAGERLKQEVTQFERDDKEIQGKIRTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSENDEEEGKEKITTDTWRISRLRQTDFKTRGQGNEQTAVVA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERHRKIRNTEEGTKLEQDGEKDVEDVRLTTKAYKVRVNKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGKKNKTLVIETKKEHGNQDELTDRDYREKERARVDVETRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSWYKQRVSKQTAKEVHSTASYKTYRYVRRQREGEETEGTEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQETTYSTKKTQQRKAVSWKVETEYVEEGGEYRRRSYRAQH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTTRELKKTKYVQEGGEKAKEKIVQGKDTEDLEEVRARVS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTVDIVGEEEANEKDQRDKRERAKKFDRTENLNVTREEYEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDEHEKGYRRSETYSVRENVTEWVVQATEEDKAKKRYGTGG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRREETAQEEETVNEFQEEVQRKADEGRFTRYVRNGDVKRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKKVTLESSTERETWTEKIRTKVGTIEEDTTGKRIELRDN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRTTVKVNIETGKESTKLTIEKRWTGSDLREKDREEEIET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.600000023841858"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRRDQLNKDTDVDSAFEELESNGTEVQVDRRKARGEVETY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRDDNREEDEQGQNVATKIYRTVESWRWEETRWNAQGHVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDEEFRVRDQDELEHVDERGRRRANRVQGQRRATQIEIETR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.049999952316284"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHRREQDIRNATREFDREEDERITRQAQEGVDRRVEQGLRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDETGKVTKRDTEREGEDNAERRVRTTETESTQWEIEVNNS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDETRESKNNVDATRGPTVVFWKKNIQYERLTEEEGERADT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRDKTRYEEKEIRHLTEEVEDNWGTGRAEKKAKKGKINTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEKNTQRTSDKIRHGEKEARNEVRKGKEEKNTLYIEIDET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKRKHVSEETYLEKGLRDAKEEVNDGKGNQRFDKVQAEEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQKEEVKGDQLDVVKFELEAGRENRKEKNHVKGREASTTDY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKREKEGNTYETNKEVRTTVTQRVIEGETREDTFKVRGKKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDYEETVTEETNKYKGESDVTKETNYTTQNRSVRRKRITDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERDVNIRKERRARTGKRKGDEKITDVREDNREVNFTVEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVVEFNRVKEARDKRRDTERDGIIKEENERVEETRKTNDGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRVKKDARTEEQTDEGRTTEDTDVTEVDEVLRKEITYRYWK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSKEKLEKKEETGDRASEIWYDEREVETKEKTNRVDEEFNN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTEEEVRRAETGRTVEKRVKENPGEGELERRTLNVEVNTI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSPGEVREIGGEERETREVTTRRTVLLVTKEERENNNREAKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKTRGEEIDTNTEEYTRVVRVTNVNTRDTKFEKAGIRTTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKRRTVESRETERNPTQEAEEKVAEGRDYDEYVRERVKFN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEDVRAEERERVHEAKRDLRDKLETIDGRTHFGYVEPRNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.990000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKREVDADYENEENEVTRDVDKRWRTVEGRNKAERREWEVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8799999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRDDAKAEETTDIKNVEKTIEEEGKTVTGRTTEITWRVKRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQTVVDKKKEEKTRTEREIITRVAWTDNIAETTEDRKGGTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKKFNNNQEDSVRRLERTARETVVRIEGDEKEGELSAEDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTLTLDLTSSQQDEEAEKARQKYDGTEETHTDGDTSEFRFG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEFEAEGKSEYTDKQGTDLSDQETFTRQRTHTLDEDSATGL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKKFETRESQAQFSSRETAGTGDTYLEGLEELTDTDDHQTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETKKLETGVRYTRVHVRDHQVEGKPYTDTQEKNAATTSEP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRETVEGKEGEEAREVVRRATKSFPEGTIDNEVRKVRVKLS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREEEVKRIVTAKGGRVEETKKDVENSVLRREPRFASEVTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKETFDEEKKTKIRNWVKEADKTVKNVELRTTAKDGRGRWT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSFKTAGREVEKWTKADEWNGERTKRDLIVTDVEKTKRTNKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERDVEARKEEHGKRWDRRVTTTVTRVEDTTRGEQAQVKIH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDKRTVVTDATRETATHWKIVERQVEHRRERGRDQVEKGTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNRTRRGREFEEVRRVNEHFHEDPKNVRAYEEQVEATGTTQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETVEHRVDVRETYQGEEETVTHNNPEAFQRANRFRKREGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRKEKADQDRKVTEIDRDGKESGRERRVETEFEYADIRWE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6100000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEVVKLADTEKERRLKVFEKRTDRTLGDEVVGEYETTRETN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKREEIRSYETGNRVKNRLREDIKKVRATTTIKEVKGEEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSENEENVSEEQRGREFERDAKRDFQRVEERDTRAEGTLDTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERRREREDSKTITEVNENGTTRAVSGRLYEELTRRTINIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTSEIRLITRIEESLAGYNNRKRREEGTETVVRNDERTER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAKDEDWNTKREIRTGRREGEETVGEVKVEKKVRDGQVERK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTRTDWQEEESLEKAVETLDRKAVRLKGNQNQVNDKLYGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRETRRLRRDEHVTRVKRHINEEFGDARGRQNEVELEAETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSLTETVKFQREGAEERRDENNEDRELVGIRHHRARVERRTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGEDVTNRPETKKNNRTLIEASIKRHKRREKTKQWYEGRED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKNFDHRITQEAEKEVTTKEGEDRQAFKLEVTREGVTFNKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKHRKEVDEQSRGQTIKSTGNKNVDELRAEEDVEQIEVQYG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDRGSRENGEGKADRNQVQIVQQEVKTDKEIHTEKYESLVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTKEEVTTKRKKSEDERERGIERRGYFINRKTPEAKVELK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETDKDAETESKLKNAREEFRKEVGQATIQYEQVKLHGRRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKKLEATQKGDKQANSGDIFETQELVHRTREEERARVGKEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRNTQRTEKIRETVVVKQEEKENGNRDKREGAERITVFGI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQRTATTEKKVSDVWFDELLEKGDREGIRKYGRERVRKKKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQETVKAEDDRQAREIKEQVRENEERVDGEDEVREYKINER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTGREREDGIVNNVEAVLREEVESKAVTQRLRKHKETKFTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKQDKKRNDEQGSEVTEEGRRYVTRVEAKRNANTQEIYQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYSSKHVTDYERSTTVNTTGEREVGKVEEKENVQQRDVEAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDVTGVEYDQEVKSEHTEVSNAETEERGRTTSKVRVRKQYN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTIRRRDTKNVFETGREIKGEVQVIHRNKSEEQANALKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.939999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRDNRANKKEYGKTAVTDGREELLRLTITKENFKTTVEVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTNKKIATREKAGLTGLENRTFVTVEETRNEVKDYLKKDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTERRTVTEDEKIYELETNANSQLDNLKGKKERLEVEGDRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNDTEYLNGKQEENEETKTRKEITVSERDVLKLDERAGNRL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSLRYREAEETRTVKRLEKEVERKGGNFSVKTEDGEAKWRDD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.9200000166893"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVTDAREFKDRSRTNELEWDEAVRLGEKKERKGYREGKETV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTDVDVDTEQEKRRVRRDAEETFDKGNIEQRTGEWRVRVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQVEDRERWDTVEDRTVVKGKANRTQDRGRETVDEERIRTF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEYVKGRRTDKVKDANENVDKEFKGVKIKEERAEEQPQLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAGVRSKERSRQREDNKSRDIIEKQINKDYESEIYQDGKGS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEYEKEQDSENATRFIRTLKETGEDVNKRTKTARETADVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKETRDAEEKNEGEKLDNYGEERVRRLEERTEEATFRFKRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRQREATEPRRFYERAQKVNQKGYKEERNTRQIDGEIRTS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSISERTKRFNPRTDTTYQEQEIARKYRREGGAQQEVRRNEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTQKLRFTKKETRSKVVTRVTTDFEDVDWRREGRELTAEGD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKQNTAKNINKFKDVEKTFTTYELNGTRDERVEDLTPETK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTRVKVTDIQTIKNGRETIETNIERVHVNKREGEPNASEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.450000047683715"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEHIRQKVEGTRNPTEIVKNNKGITATIETVVSRNREEED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSKVERVVSNRGKFDETKKREEVEEEVENDLNFLTATREGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.829999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRRTTEARNDGVDNVEIERRTEEGNTLYTEEEIKAERRIS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNKTVDGKKEKYLRQAEERVTDELRTGNTRSKIDQETVETK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNDKEISTTVTEEDRTEGLTRVTEYALERNKKGRKQVKDKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEDDKNGVEGETRQIVVGDKETVDREIKERREGATTDKKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKTYKVTETKFGQEGDEKAYQSGNRDRLNDKTVRLSARDV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.990000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKDKTTVKKVLNNVYDEGYFGEELTGTDRSAQRKRADSQRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSENPSTEREEHVVTNTEERTEQEKIRDKTAVIRRVGGITT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSSGKFNNRKLDDTEFQKDTETVQREKKETNREYALKAGDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEYIRGEKRKEIEDVHREAKQRVQKSEESNYRIKGRVRED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDTETFTSNEATKPVTFFDKENVRRYDEKTGERINKVAHRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSTDKEEEKRERGKEAVKKGEYYRLHSTRKYELKKVEADVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDNDTQVEKRRQWEKGEKTIRKELLDVQVDKQYVRGDAKES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNRTRYKEHKDTGYEEATKGQSELLNITARQREVNNELEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGRNQELREREREAKNNEEYAKDNVEQTTITHEYELGKTSL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNRKLTENNGAGEVVVKQTEKDRRTDERENEFKVEAYRTVG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSLYVRRHNGEAERTVEKEAETKKDVRVNKTSEQYIGQQETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDRELTLDELDEGTRIENQITNKFVEGTFRTKARRPNIESK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTERTLTKDKQFLIDTFVGRETNKNDRPRIAESNEGILERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSITAKKHQIKQDAEFNKEVRGTKQGTRVVNQEDKTLRYVRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKKKGEQGQEEEEHNLKANETTVVLKKRDDYELILYQELTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETEIETTKKSRVEKWETRGKRNLAEVELKKEKGNVEIETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.9200000166893"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTHEEKGDYERVEDVKEVKTNAYTRVKAGEDHERTRTKKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNERVNLRHKTEWEEVRKTATRKGVEVTANKETLDGQITSK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKEETANERETVKTGWRNLYEEVDKLETSTNRGTGHVEEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYTEREVRERDTIKEIKETGKKDFGKVKLEEEARRVRAKLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVETKAGKEKEEITGRRRDIDETRKERFKKLVAELYRKVEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSWRSGRIKNRTQKNTEATEEETDTRKENAREVGVVLYEEVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTRTFVQTSKRIKGDTDETKVWAGELEDKLYETKDTTENE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKKQERVDEKDQEKEGTRQVDETGIDTNRRHRIRNIRGYTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKIIRRDGDTQTRTRERRQDEITGKNHVEQDKEGRVNKEEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.939999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGKEIEVARERIEYKNVDEEDERRKNTFTSERNKDHGRTEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRSAQTALDRVNGEDTNETIQQQDERLLREGFEKRESLITD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.769999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKNKFTITRVDRLESIANKPHKELNTVNATESVKEKEGEGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREAAREKHGEDRREDKEEDVYGKEVTFKEKRWTFKENIRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRTSNNERDRSIKKASKNVDTELKRVEIKERKGYVTGKET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVKRSTVTDKQEVEQGENRVKEKGGQLYLSTDVRDVEAQLR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKKRKRLDSNYEGNRWREQAKENGTDGQEEEKIEEVKVTKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGKKETVKIKWEDEGLRKRQTGENDKESEQLNNYAEVRERK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNAKSLDIQLEDDTTGVKEVVNEEEQLGSRKQVEQRDQTRY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRDNRKLNKKKDTKYINETGEEEKGRAEATEKRISQDIEVF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVTNEGSRLEINDTKFEIREAKTEDKEQKRAKRKNYIDEKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYRSKEVDDDENVKEYKNQFKRRREDGTARTERVEAEVEIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNYEQETDRVRVTDREEKRKYDVSEDIAEVKGNKEREAERF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEQSQTGTERYVAKRWNKTGKEDVREVQEKNNAHRVRIETQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQIEKAVTNAESKVQYTQERERRKVKVTGRWRHGDQENETN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEDVQAENDQRWEQLQTKANTTIRNVKGKREKGKVQVTTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSIQDNKATVQTKEEQVEVREKKWDNQGERVKLTTKQTANRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRETEQTEKDTVKSVEETVKRKGKDLRGREKAYEFEVDER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.699999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETETEKNSNRNEARDKVEGYDKGKAVTLKEEEKYHYVETK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEETRKVEEDENVDETAQEAKNYPYGTEGRDKRGNREFNYI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSENTEEVQTKKGVDSAEHTVEKSVRTWRLKRKGEELKGKLV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKTEDKEREREGYSGETRGREQIETVTVETDFRELRARYA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGERTAETLVFRKRDEQRGRERYEEEYTIRTESGVDTRKEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSTREEKDQEERLENFKRDGSDRVSTSNKRKKEATGEVYET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNVTFSIQDDTDIKRGYTKTQKTGKTKTARNEVRRAELSIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSENTVSLSKKEEARKWEQEADETGQTLKEKRTELDGKVNYG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKTLSANDENQKKEKASEQTEELGGRTKDEWKGVYVETLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEVTGNRVVRIDEELERREQRRREEVKATQGTNDVFTESRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDAQQRQTEKGEVEKDSAEREEVQVEQEQNVYKRLDGKERY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRSEKANRKHDVYEELEDFNTEGTTGKLNEHEGKAKIQKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHDEKLEAFNITRTYGLLANEEGETKKSRDQHEGNKKKKEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEREKEQTNTGQFVTKDNETAKENKEFRPVGNKEESRQIA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSQRRHEETEKNLKTVDEEATEKIKQGREREDRWNGYAKRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEKRKREAKNYIKERTRWERARVENLDDGTEQEKEQGHTS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKTWDVSDDREEEKASREAKKLNGQWTIQRKGPRVEIRVG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNAIWEEWTGQTGKGRQRSVIKDDAKTKPSEELVRVEDRRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETRRELYDETVSREKKKDVAKGVVVEKRTAVEGNNTEETR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERNPTAKEEEEKRTFYKSASDENKGGESKYSVFSTRFRVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKFNSSYFTKKATRRTNGTRREKGAEESYVESVSDEFPKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQQWEGGLQKREEQTERDDSVDTGERNTRERFNSKFETEAS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.110000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKERTTNLRRGGTRIKQTERLIEEPDVEWRREAVKRTEND, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHKSYKLTREDEGQEARDRGKRRVLNGETEDEELKRRLQVN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSGAEVELRGERKNVEKERRDTDLRNYRDQHERLETKQGLK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTDEQATDPKNLDREENQVKRNKNSVEGRQEIKTGTVNNL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKERTTVTRTEKLTKVRYRVNTRVRRIQGYETASEDEGEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTDEKTKEAEDGTRGERTPYEEFTEVNVRRRRVELNIERT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTEETRDETLGKRKETVREENPNFVGRTDRAEERRETIYV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTETVTIRREHEWTDATREGQTNVVELEIDKREARGSVKVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERTINEEKRTDANEVTTKGEEELSKFKGKKRTVNLTLDET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQQNETVRQNERLEKGRTDIEDTGKKVKFKETAEDDYARRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEEDRDTRRDNKQTRKEGKVNEAKLQGGVFEDQTIAKEYR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEVTNVNGQETTEAGEEVRRTHTVDFKINRNEAEDRRRKVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGVKRKEEKIFRENKRTTLVTLNEKDLYEEEVLEEGAERTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYERVRVYETEDVNRVETTGKTEGREAKVRNESVKQKVDNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYVEVYKTRRNTVSATQVDRKTKVRNERKEENVEDEVGEEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERGSETHEEGRDFRTVTAQVRYNEARGTNELEITKEERKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEETTELKQTKAVKRVKERVRTRLEEGQLEKKLDEGRIKKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKQEKTKKRLEKIKTVERLVEDRQVLLREETEEGETKGARK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYRQKNVEKDNRGTQETQKLTEYVLEGKNETTNAKEELTWR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSETIELSTIRRGTRVETEGTDEVVKAKPKTTVKTGRFNVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEKKSANTKETVSDVESRVEKTVATGRGYRSFTKVDGEIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTVTTDYEERSTVFGAEDAKSRKVVRVREGTSKISNKKGEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRYTEKRTTERETRDGTVVNGGDQVKRYVIDEETQKTERQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSADEGNVDTVAESVTKREEHRELEYKTNERGIVKDQEVGIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKNEEIRKTTDLTKVNKRATQEGETFTLDRENVEGDAREQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.350000023841858"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAVQELENRNNELFTAREETKGDGITTEDRTKKKTRRQVDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEGEAVRDDDYERKEEVYNAETRTWKDLLTGTEETFVRDKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDTGERHLDVEERNRKGLKEASTELEKANRREEDREFTSKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAEERERNKVKVRNKTVGKKIEVKETTAQGRRSKEHYTDED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKDVRTQENEDTFEERGDTTLSAVDNTQGVRTTTENRFVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKNGELSRIERVTRWTREATTEVAQPRTTKKDWDGEVKLN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRGIDEREKEEWQRQVSTATNTKKVYPQVVKKERDDTTDGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEDDNAERRESKKDEKNRVVEQKGEVVITRRRTLEEFKGV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRNGIKRVGIKVTETEVDYENVEVARNENTDETEKRKDKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDKARAQKESEVKEGTRRGREQLFTLRQTENVGELTGDVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKELRLQDQGLTENVTDETQVGRAGRFEAEKVGSETEEKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.159999966621399"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEVAGDTFVRKEEEERRTTRDEERVLQQETGTRELKEVSYN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETKVDFKERRGETKFDTTLEEEPRAAKNRRHLSSATGTEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVEESQAKGPETAEHFNDRAEERKGTELKTSLKFTDRRRTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRQKENKKQGHNTEIILDDDDGIRKVRDYETAQAEERNEVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRRSNREERRVKSHEAEEGFSEKEEKVNDTNDAGNKNVKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYSLTREGENRTGEEKEDTVDANNNFKRRNDKATRVEKEDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYETKEEEKSERLTRLQTYASKKAEEITDEYRRFKTNADGN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNVDARDRDKRKGTKQTFTADREVREEDITQQTFGFRTRTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKGIVRDRASEEVWESTEINKEIFGEKTNNRRVAEDSKER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRNNDFERTDTAQEIKQEGEREIENITGKKERGKVNAKEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTEAEGTKDTQFDELWEKRKKTAREWNQENTRLQASGDTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAWEEKKTKTRFDNLARTGQLWQGGTTTEQEKDDERASNTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKNKREGTEEERAKTIEQTVEDTLEQVTTTRNRVEGRGEEW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTERTKANTEHQATYGNDDVRREVTQFTVEDETWEGQFKDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTTEQVFEFARNADETHTTDGKVRNEDEYTQGKWTDVQRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEYRAEVSYTKRFKELTDDATKEGEREEGKEKKVEDDIDKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.990000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKKEEDTEREEKADRDEVKTSKLADEYYGFVGIREKREDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDLKQIEGIQKEKDEEDVQSERSVQRTTRGAKEIERKKEQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTREQQGQYRDDLEDIEESVENHAVRVRAKETVPTGEVNTQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRDREAEKTQTWRRGDTEVDRTVTEVTADTNVNSVTGRVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8399999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKQETEIEKWNEPTNVGTQVTKKIDNVTATEEVRRGTAREK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTQEKPRRTETGITKNWNAVEGETVVETDAKKREIETVNKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTNEVQGEEKQFLRRATESLEDNVREFRGSQDDLTGKATTF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSFREDLTRENRRKETTLGEGAAESTFGDSDEQQNQVVLKFT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.680000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETTDREEQTREVKRGRTQARNTVKQAEVEDEAGYYTIRPR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVAEETIRAVDRRTRYQTEKEGDPVTRAEEYGERNKTQRQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEKREVYSEEKGYRVRDQGENDVRTTQNKRNAHRFSIKEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQREIYSEYKTVNGEVNVSRRDKEEERGQKFDKQNARTHER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKTRREEEKRTANNVKNYAKRSWTKIKGDRKEGEVEVKTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAKEETKRRKITRKKWTVEGNKVKVTAEESTEKGDYENNRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSFTDNTRREKETAEGKREKTREKEGTYDVVTKQYEDAEFTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYDETRADNEDKGNNLRRHIERKAKEFSLKKTEGRVHIDRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKLTGEFTEEKERTASTRFSHFVAKEFYTQSDAKTEDAKGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.680000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDKKDKVKYTTEGTNFREKAREEGRKVRVENRGSTAEVNEF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6100000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERSTKEENNKNTVTDGFRKDGKVETKAREVKVGAEREYFR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETKKEWDKKRTVYEAGHYVTEKENRVKATDTVQNEEFKVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEVNRGKFNKKHETWTEEDKRDQVATTVKTKVAVRYYEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNRVRDLSVDRTEETTEGAGFEKLTILIEDRKGEVDNETRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDSRKARTKEQGTKGNERAKETIERFKFNEQDVDARVNRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSERFTGKDEEDIKFEENAANKKQRVGTERAQRRTKDVENR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRRVTGQTDRDATDFSKQGNTHVLRIETENSDVKVEGKAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKKRTGSLRRNVDERTHVTEKGSQVQDDGDANTTEKIAEVF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDTTKKVRTSTEVRTLGETARKTLDRGEAYTKVHEVEGKKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEKTERDRIEFDIEAKEGSVEPRKALQESFKGNKKTTKDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKENKTTKRNDGKRGRETGERRIVQLNIEDTEFEAKGERV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGTKVRDEKEIEGLNKNEVKERTDKTNFRRQRGTEGIREAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKATFTWKTTDTRDYFDNSNDTEVTDGKQETKEVEIRATLR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.9200000166893"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSTTEEGQQEYRAKEADNQGQDTVRELKDRDRGKTDELNTV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERELDRNNEKRVEYGEHRAEKRITTITWQRKKVTGEFDKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.049999952316284"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEFETKTEWNKVIGRRQEEHTLEEYGDRTRAKIREVKDKRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQQNGREKELVDVDERGERRETIEKEVHRKANFQKETYTNT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEKQSTDIEKVKKKGEFTATGHWDTTIINEDTEEAREKVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERRYTFREEKNAENGQKNGDKYVGTVEDQEEATEREIERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETRDQREKRRTVNEADNEFENGVEKQEIAEEEREYYGKTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRLERNVQKQKKRETTVNELNTNKKTEEKVGYERENGYDED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRSTEEKHEKKTARDFDKEFTENGRELEYYTRVEEDTAYIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYKVDRERKDLKANDYITFEEHREAETRSTETEFETGYREK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEERTQRVLRRRIEVTRREERFGAENRTTELDKGNRFDREA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDTQRNLYVEDEVEDKVTDERARNKKLRSEKTDRRNQGRGI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRDTRQGQENEKLNELKKELTKDKVEVEDYHRTVQREAYAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERAEGEERIRTRDGSVRKERRTHTKREAVSSRDVGGEWDV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKKVRLKEEKDFEELNETGKKRVNSGYETRRTLKAEFRED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRETTEAEKTTEVRHLRKTLDKFVVEGDASETGSDVKGEVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKKTATVKTKKRWTRVEETLDSRILTGETDEEEVNGRVREE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRGTTVELTEVRETKTEKNALREKKRVEIRTGVETDEKDWS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKKREIRVNYDGQNATRERREEETAGAEKVENLIENDTRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTHRTQERKEDATEGYREAEEEIVEETGTREVKKGKFSSG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRTKATKKESETEKAYHERRQEFEEERDGRGESTIEGGVV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHENARTERGIEVVGTVERELRRTEKIERENYKTRVDSKKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.090000033378601"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSARKKEVWDEKEVTTLENEVYTRWEKGDGETRELRPRGEGW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.889999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKPREWEERWRDERGVGTNAERVLKWGYTVEDKEETGTELK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTEKELTRENRAKTGRTSGEENLREVTEEKKITDIKGRKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREKIGEVVVKKNTYDVRKTRREAAYGEEEENKNVKTKSDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEEARGRDRRNFEHGTKKVRRDVFEAREEKTAYYKEGRVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQRAEGEEERVERNSQVEETLERKRGDKRRVVKEREDEAKI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERHETATRDYRVKEILEEATKEVEKGNKTRNGEEVRLRQS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETQIDDERTERWKKGGTRAKREATEVEKEQTEAKVDFKEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.870000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKAEEERRFVRETIKEVAHTRGEANGKWQDQRKDDKEEERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSWQRKEDAKESEDDTERKTKREWNDTGTVNLKVESEFANTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.810000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVEKPTAREKFEENDRKQATNGRNTENNVTRTEERTVPDNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRTLNTDRPEEFTEGTDRASNRIGKAKENYELREFEFREE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSFERYETNREARTKTDENAELEERFRSKERFGNITRDLGPE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSATTREEGSQEKSTDEEIFTKLIGHRDYKAKNTRTSTLQRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRERSTEKDETEGNSLEEKVKTTFQEARIYKRKAYGDLREE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSESGRRNATTDDELYTEEGEVEAKERKRRIQEKFKYKELST, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSFDGKKKAATRIEGELDLNRQERERVREYNDVVDTESIETN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDYKERTEYEKGKDTNTDDIQKEQAERGNEQSERTARRFEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKDGSVKEDSDTQTGRKELRTAGFEEDEQKDWQKARGRVA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQTESRAKPRGDRFQVPEKYNTETAEKEQKEHVEGNREREL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRQEGDVRKNERVDEGRKKIREKVREATVERETISADIDKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTNGNEESIEKITNAERRLTEEVPQGRRRLKRLEIEVRRY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYRTSTGTEHRNLTRADERVTEKLRTWQDEEEARKGKVEYE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSLEFQKKRTDEVRDNWSDDTGKREKTEGVTIVSTKKGLSSK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEEEEREKKQYVEELDYDGNRTFAEAERHEKRGTDRVYFT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.230000019073486"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYDTRKKNEHVGEVEQYDEEFREALRGETYEDEAKERRFTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7300000190734861"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEVEELNVKEEGRTVEISNLTKQNEYKFKRKGKRRRTYAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKNENREEEVVTRSLRTETAQEEKTDGQKKEGWEEKRLERV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREDITRSDRTEGEEVRNKARTEFVEGTLRRRVERFKAELK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEDESTVLITDLRRGVSKNTESRNRGKTVEYEKKWGNNEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSFETDKHDEPLAKNTKVLNETHRSLGANDKVRRVQGDENRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDRTSEKEQKVEYEAKYKRWTVRVETEITTIGTETANHKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRQKRIEDEKEVERGEKRVTERAKNVTVETTSGRATFEVY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVTGVTTRREEYFVEATRSETKKNGAEREERVIKQDKTERV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYIYNEKVDKDRERRRDLLTKTTEKVREEKTVTDTINIHKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRKVSATKEEKGERFEEKVENDGKRVDIRERVERITGDDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEFIEERENKVVDEVSIGVAKTGARRKRDETKERDGDREKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGGSSEIETNEERKNDQFAEEVQTRKFKTVENDKRTKANED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEDNTEFTLQATKRRRPDETEEFRRIKRKVRTGGDRSANT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYREETKENSRTARDLTKEAENEFDNGEEKQTVEKIKGKET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTREKGAEVRNLTKHLTQRTEGEEETIETTEERKDEKADAF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNKNNSVNSQREVERITDRVYKEGRDARGTEEEVEVKLREE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHITVEFKREKKYKRATEEFDERVQDFRKEENTARAEVDGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSDSTKLKTESDGYDGTSNLHTRLRQIREQTEVDKGEVEKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSKGNLSVSGEEVLLDERQRGTHTDKEQARKDTTITYSDEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKNEDYVREERKGDRWEEKLHSDLQTVEVERNDGEVEAETR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDERESDDETRAGEVDEWHETYEVQNEVRRRLKNLKVEGKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREEIEVYEESGDREIRKKGRSEASAEEERRTVVRAEGNPS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVGIPARDEEYEKREEVSEVRNSEGAREIKREETGSEARRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.139999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEAKKRWSQQTTTRNGEEVFDTGIVEAREDSTEGTARVEKH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRNRQWRTAKTVFEGTDEDVEQVEKSTIEAAGRKSTEGEHT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDETDNAEDERKVNRAGNEVSREVTRFQFKRDNGNVDADET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGKASREFNRQDRNNEVDERDEVVEKADANDRTTDNGFEVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEETSEEEGEKFERVSRARRRVGEIVRIRTKEEDDKGARR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSKEGEGKDTETSRKAETTAQNEWGTRRETEKGVEVRIRKH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTERTSVQEKEHENRGERDVNEKGEEFERYDQKIDRELKRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.699999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDTKRELYKDRTEKINEFERGRNGEDRNHSQQEEKEEVRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKTTSLEKRKEIKQVEDKAKNSGNRVQHETDKGRVELEED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEKEEAYDERRANEVVETGKHNVREWKGEKENAKVEFKKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEYEETRNAREVDRGTEQVRDKRKSFEAKEENPTVQIKNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVKVPEERGRFEERYTERNAAEDTERVKKDQNITQEKETSN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKARGNDRGQKRAWHADYRVTSQKVVKTIRYKDSTDHQEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAWREKRKDQQNVKTNKATDNKVVDEEKVRRTEFERKEGEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDENEIRKEQEAKEEVTNLTERVREGTGNYKKVRATVTRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVKETGAVINARTTTEQYEEDLKVVEERNETNKERGRREKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDNTFKEESDTHKQAIKEERVTQNRAKVEFDRKNRRRRGKW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQKNETVHTKEQVKYATERVEREYTERYNEERAEDKEGTAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTVEVAGRVEYYATEATREENNHKDKTKETQYEEREKETQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEETTHEERHTRTETVKYRIKYRGERADQTKTIEKGEIKKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDEEKGEITDAENGERITKVERRWVEVVTKGARKEEDRERG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.9599999785423272"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYEDRKVSKVQSQLNPTDTTYNYEEATDEGTIKIKKKTSAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERRSKTLTKVEREDKGKRIQTKVEEREENAEKIKRSFFGS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.269999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQNEEEENRKREVERAYTQLDRTGKEGKTRRKVYKNKAENR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.850000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAENTKGRERKYENVQVKKEEEKRNTYARNDGTRERKRQEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVVQETAGTEYESEERGGRTLKDTKVERKTRERRQWWRKVA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEEATGTRRQNGEHIEKRWENNISRAEVEERDVKAEVEKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.149999976158142"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNVEWAEQHVEGDRVERAESNRKEEERIKEKRITTEENGAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSPQATTVVAKEGNRDGREDRKDNYKKNKLETREIKVEVTEF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHVATRTERRSTGEEVQRGGTTNTRSYTRTDLPEWEYEELK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKQEIRTTHDTKVNKAANDGNTEVGTFKLKDKVRTLTIEVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGEETDKAGIKREEEVERRVATNFKESTKKQTVQDNHVRKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTDRATVDRRTVERTWEHEVNTKALEVHGERDKVRGDIEIS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKESKTVEREKDAKHGHKNFDDTVLNVELESQVDSGTGSLY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTTARLSETKNVREGTKEAERTVFEIRGTNDEGSVTVQLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSLAKETTLQDEVGSTNEERETEGTISFVRRTNTVREGKVRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTYNGDASQNRELETVGKYVTQRITKLEIRETVDSRQAEET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTNTYVNYSQELERQKRGLTTIKITVREGESREVADADTEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.169999957084655"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQVVEGDRRFRFKKDNERKADGEVQDVRTKEDERTTKESTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERETEGTNQKDVKKVKENFESRVSELRSERTEIYGEANTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSSFQEEKTRETEGKEVRAKNTVEVGEERYKSIDRNENLTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTKEKGEYNDRWDHLGTQVQEDLADASVNKERVTVNVNED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTSRRESHNPEEIRTGRSYVKKTVAEGKERGSDVRGTLTIV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRETVRFREKEDVRNVRTKGETQLVDLDIKSTSGHIRAEDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKHKNETRQRKEVTKITEDATEELTTIRGRRRFGEITGEDS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7300000190734861"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYETKDLKQNKDVEEFGDTANRDFADADVTTSKLNVSLTGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDGRLKGTVDDYNDANKKTVNKLFQEATDVELFKSASDTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTQEQEIDEESDVHSVNEKGRERANTDELERTTGRFEETRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.299999952316284"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNRFINKQTDESEEVAGREDGEEDRRVTRNETSEEQTHETL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSQENKATDNENIRTLYERGRQTLGTLTVKEDVDSLKLEEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSLTKEELTARNGDLVLTDNYRESKGLVKGEQQDTRTSEINE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEERQEVRDYETVRTRRNKAEQKLRELRARHETGEWTGKER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQKTWTRRKVHGRETEKEQRLYVDELAERRAERGEEENRRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNDTRYGEREREVKEAKREAHNTIVIAEDETESGKGQGQRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDRDVDLTKKDSGSRASEKGTEEVVTLRDTRQVETLTATTQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNERGFKEDRDERVKKASTDVEETNDVRKVRGTDEIREEGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEQEEANERHFTTAGDDGEKDREVEFKLRSTYLRLRWERT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKDQEYGREERQVEKVLDKGRETVAEVHLEERARTERVYAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYRQVYLVEEEQRKDEEKEGGLEHRRTADVKVTAAVTREER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDKTSRGQNAKNVTRFNEKPKETFEEVTVKTKKITVYGTKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETTRKTGKFQEKANKFRYKITVTENVEKPVGDKKNTVTES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDQEIKVENKREANTGSRKLDTQGRTLKEKETWTTVEFQRH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRIRGDAVVYNSETEERYGKDKEATNEENVKKKKKTSAEKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSDERQATTRNRAEDGRTKGKQEVIKVTEENYRGEFEVEDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDDRRDGEKTERIKNVRETVETEGERAYIRTEEVNTNVTTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKQEEAQRERYFYDLVENAETQVTSVEGSEEVRKGDIETR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEGGRDVRTGERDETTEIEQAKSSTEIKTQKNARRDTETK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETKYNTEEGRRAETVETTFKEKIPTGKDERRRLRLTFERN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTERERLNPRGTAKGKTFTFEYERVRKEKNLITRETEERTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8999999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKRREATREEEIREATNKGDERVRKVNFREESASIEGKWD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKNEEGRSSEDKVAENTRKRAEERRAWVRKEDIEGETREIF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETEVNLEEETSFTQVAREVEDTANEANVTERVRKGKVDRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.039999961853027"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTLTETEREFEATKEENVVVRDRGVERVNSEQDEKATANVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEKGEATNKTKLEDGDQEIKRKFIEWRVKEEEAKGSGRRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREEENRYERQTVDEATHRFKNQVRDARVEVETVRGRGRTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTIRFDVSNDEEEKARKKIKKIKPSRTEEETDGTQTEFRIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVRQTARFKNQTNEDKIQEEKTKIDKRLGSTDAVEGVRERQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETKKTVSQETRKTTAETELDRRIKNGERKKNKGEENGYNF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7300000190734861"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEQNITFKREKTTTGYRTGEEKLVKRSTEKRNEAEESVTVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKNRQRRVNTAEKYEETKSRKEIGFTTEELTVETEGKTSV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSQKDTGDRKEDRYSLQNEVETTVVVGKDYKRTPTEKAERK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSNTEKDTSTVPGTARKQQRDKRDKGEEVEYRVVTEDKKYL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERKGTAEEKQKIEKVRREGTKRVRTVQVRDDIKEITVTVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKRDYFEAREPEGTKEEPFVDETKRKRNQAFQWTEIKTGS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETYKRKTETKARRETRLQVDRRSFFGAYEEERGESTDTNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRWTEGEATTISRLARTEEYVVTVEDERTSENNGNRTSHTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQETINVKDDKEGKRAETRGTDELWEGEVSSTEVRLEVQTI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSVLTRGETEDLKEGNKWVDVARGTDTKVIEESEQETIEQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHDRERGDEHKVANELYTTGNTKLVDVNFRERGETRTAKQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTTLKTYLEEGDKRVHHARVTEAETNGERFKNQERDGNVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQQKETFEQNQRASEVTNKLSDEASTWEGKTRYGEVETRDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAYGLKERQFSTTNEQVSWNEERQAGEEKQTEVDTSREKTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKDTRAKSYEDVTELKKEVETRGDRVNEKTTWKYGRVQKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGQRHNEALTTDHVLQETDSHETTFDKQEGYNRVWGWEKKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAEVEHVRKAIRTQRTEEEKNFDRATEVGGKEKHTIDEKTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.810000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSPDTTDHRRAEKLESKFSKGIQKIQVVTTGRDTKGKEQWTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEHYGRVRQEQTITDVTENVTRDALQLRVSRRRGERNIEEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQTLGQRNLVEEYTGIVERTRDQERSRRTIEEDAHVNRVRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDIEVKKEETERVQEAKTWDKAQADTRGENKLRKDHGLLKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNQKLERSEFKFTTQITTKAKYAPGLINPRKTEGQISLEIS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTSPKIPYGTGNFRETIIEAQRKLSQILLSKKTNTFAEEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTENQEVNESTVKTSIDNTWEREAEGGTRDKKGERLYARRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSATKTNRRKIREEVLRDNEENQERRTGGWAKSTEDSYGETV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERAFGLFTGTETRADVTVETRTIKNTKNGIQESKRNEEVS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTVNAVTRRSEGEGFSDEEGIETVRTRIEEANEKEKRKTER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSIQTETNRRKKTTDKEAERGVKGGNIAEVEREETKTTFLHE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRYESDQTNEKEASEVDRTVTEKVNGIEVEQNASKGEPRKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERRERKATNVNTREDITRRLEDGKREREQDTRLETLTEGY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETTKTVERTKKLRKGVTDVSNTGFQFTVEEEEAKGRARQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQRSEKAKESEYGRKLEDRLRTEGEYVEVHTRQVEERLKDN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRENEEQREKKLSVREEDETYHRVDESRVRGTQLLKYAKGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSTNVEQQRTEKIKSIDKRAEDTAVEGEVEKNRIRGRLKIN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKERTRVTDYRQLTNEVREWNDQVKQGRFTRDEGDARIETQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEEERKDRTRITELKAEGEDESEANTVTRTKAKYKEELFK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDNREDPERVREVQEFNNQVTEERTDFQATRHKAKGDVEAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEKRNATKKETGYTVKTNLTKEGVEVRGKDSVRKLEIEKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKVGYVGKNKGETIEKTKETKAKKNELDEKETLRVSRETRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKNNYRRRDEEEAKKAEKKVSSQGNKYRSEKRGDELEVEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRSKNESKNKEEVERGNYDAEERLEKSDQEYRVKEGKARKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGREKEKVKESEEREAKNRENDRRLDSGEEYQNASEYKKKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYDKRTVNSEEDGTTWERDVTEKVRKLKVQETVARGTGDRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGVEGEQTIIKVRAVRVETPHSRKEKQRKTGNEVEEEAEED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSENKRKDTLTTTEETEYEHDDGRTRGQPRVETIRATAVSRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDFDVEGKRDTRFKEVNYYANEALAKVTTNREDPERRVTGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRTGTVEEDDKGDEVREELRTELGEVRSEKSISRARVTVN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVTESRVNSEKRVLRREETEKEISGETAGDDVVDGRETTRL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRRIRGDEEKIVETIETQGKERFGEVHIENKRARATAHVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHAREGEKRITIVRTEVENVEGEGQFTIEKARRIDHRAKRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.049999952316284"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRETERIEKQTHVEEGLNRARKTVSELKAQDHGTEVEFRKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRIAREVNRADKESKTKRVVEHTEVTPNERGRKGHRIEIER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYARREENVENTDNRKKGTIRTKFRRRTEVRERIEVLEETK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTIKGTTEARVRTRGHNYQREEWEEVGRIRKDTKTEERED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSTSDHAKREREFERIEYEGREDAVKINVRTEGEERKGTRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYVARIRKKEDYYRKKGLRDDQDKRKTTSFALKEWTDQTTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTFTAKVEQQRGYNRVDDKADREPRVEKSKQRATEFQGTIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQANQFTEFEPRAVKVSIRAKTDGGRVDYKRKDKRQEETTQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKERSTVRKTRQNEEIYTTVRTTGSTVDIKEELEEGRWKRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTREVVTETVISESKDTREETRTKKTKQLYEEWGRIDRGNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTFNNRETAERRDQKEDKFLRKLYDENPRVTREEGNKEIKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDEEKRRNTEYEVNKARTSGERRGVIFTATERKGKGRINET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKFQVEAFTKETWVYRQTNKTRHGGEEKNDERRQETAQRKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDEEITVRRRRRKDRFTEKAQTEIEGWTGRRDAKNVEIEPE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEYSATLDHEHNWDRIKESFRTRGERLEESNELTSREGTRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTNRETGPNNTNPETGTRAFFEHTQASKVEVPRNFFEDETK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERQRKNENNERAERGEETGYNDLLTIRVRTTTASVRFNEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGERRNSRNTRTLEAEDQTNERTEVYALTNKIEGVEREFRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRSEKQVHKYNTVENLAETGYERAKRIEEEEKDVTGEFRDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEEVATTSNEFRYGQKADKHNREKRREYVEDEETIRVEGL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTDNERDHTRHKFETIAETGKKEVRYVKVTKEGKNAKIEKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHAIDTEKEFKYKEGTRVRRKKTKAHKVVEERGTENTNKID, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKLNTRKKDKELRVTKFEEQEGGKKEKKQATINNSSRQNVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSTELDIQDTDKKRTGQSTVSTRGLEWKEREDTVTVKINST, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETADIEERFRKYGNRVVGTARKTKETKRVTKTHGREEKYE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKTFDGDTKKTETEFEKRLQKVHKEASKKSQATQIRFDVS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRNKIEVEQRRDGTDIDESVKTRVEEFRSKERTATVEGSVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTLRWKNRHEKHERQKYEEEGVIKEVVGEAKEIVRTEDAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSESLRVRQKQNEEDVQDQVQQTIKEFDDERESIRGDGTRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQREQDRNKSGREDRQVDSGFIEGEKDEVQDTQSTLRIVEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.399999976158142"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETKEKGKRRERIEEVQNTVTERIVDGRWREEARRARVTGG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTGGERRRKVRRGWAQRRVEEEDAIGVEKTRETTEERINVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETERSVSRKYERKDLSKTVTTKVGDVEIRRKGKSFEGTET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVGTRFKTSKISTRVKKYRTLREVETVDEESGTDERKKGES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSTDLEVTDEDEIRQGLKKGEKRVTYFNRTSRTLKAEAYTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSENDEYGESEREIREVFKSVEEEGQRNEATQSWRNARINKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVEIRDTGKEIRNENATKKVFKTEKKNITTAGTTRERVRDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKKVEADEEKTAKTLIHQVKETIKNGSIRNTRFEVNGTDQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTGTINVDHEEQLKATEKDKFAEIVTSREKKGVNTKERNIQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQDEKSWRKKKQFETVEDRFQRDGTTLEAENYARTGELTEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKKKAKTNEFVSWELRDARQERGQEYELTTDDTFKRGQETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDERERAREKRQGKDGEERVDEEVRKANFSTDLRNLEAYEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVSRNLTVEDNYRREAKGFEKAQEDRDERRKEERGLAEKED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNRRTEITEEKRVEEGHTRLNYKITTFQAEREEGDATFQAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKAGKIKNRLKAFDNFVTTENRTKKDKQEQIKGKSEVKVPE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVKPEEKQDKEVIERKGKHLRVNTATNLSIEHEGKRENLKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEVEQFARELRKKGVKNGGTNATKKTTEDEEREHWTEDIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKDDRKVTRTKSLTRGEKKGTEDVKTARTTEELKKVTVSVY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTERELTLLHVTDTRFEGSREKFIAQEAVETSRRQEEGES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEYTEARKYEEATEVRRDVHKEGTDWQLTRKVREYSGRTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTREYEAKEKTREAYGRTTRKQVVRDVYLRKSTDEENHEGW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEHVKVKNDEEVKKFEQNGSKRLKTLKDEEEEGTARIRRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.699999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDNIGVEVRKTVEDEQKEKKTLKANEEHRESEREGKFLRKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVRKITTTGEERIRARVANNEDHLVTRLREPNTETTEAKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSQKDKATERKTVEKGKQQVKTQGQEEQIERNISEITLKNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDYKGWKERRIKQEQETETETRKIVNADRRFAVDEEGKTDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNYNTRTKSKTKVDKVIENLSDKAGQGDATTTEVETELKYD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKRLELTEETNLDEIKERANEEGRTVTRENEKVTWTGKTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSLRREQRETERFETGKVSEEDGRRREEVRQNDQKYATANLN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEEEEARNERQGEEIARKVRHTVKSFTIESTKGRAQWKDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRGTREESTEKAEEFVEQWIKKEDTHESRRAINTGREAKQV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDYDKRVRTRHKLSEIEREAKTEVQRGEGNEDIERKQVTKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSIEDRAKTHKKERETRRGTRNYSKVQEDEVEEKREIDQVLG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTTTRVEKERTGETLERQGNKRNLNFKRNKEEVEDYVKRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVTNKKENRTRELTGENDTYVVERTEKFRKTRRTQKGENLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSENREEAETQRERKEVQDYVRDTGAYETDKQDEGSKSGQRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRQYERFEKNTKARNGEESLKESILRVDAEKQEVHGDLTTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDSTEEREVWAGQLKTGTVRTDVKNRRKRSSEKSEPEDRAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRKTRGEETDNWQRGTRKVQKNLWRARTREEGENVEVTVG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSARTLRTEVQGKRREGRNGEVVREWKNDKNRWTRETEQTGV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNRRRKGREEDSITEGNREWQTKATEWEFRTDTAEVETRQN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSANREVRRERGTWDNETTDTTTRGIQKEEERKREQFEANSW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8399999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDKQDRVRRSEEERRFEKSGTREVKTGDEKERAEEFELERT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEREERRKDKVDETTRGRFGFVADERSERSEQREELTKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEQTDTQKKNTKEERWRRRVDENVKDFQVHTETVRGRGDWK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEPQTRQLKWDGDFDTKDEKREAERKVVGYSERYEEAVYN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTQTYEHRRQDLDELKNNAREKFIDPTGETEVVRLRGSNT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8799999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRSRTEREPSEVENAQSSLDKTLVKVKGELYDLEGRVKRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSIEKIRRENATRRLNREDKVRELNEYRNRERTGQEEEVKTV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDKRQNVTNLKKGEEAESSFRTEPKEFREHYDEVEGKANKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEHVDGEEKETIEEAKREVERQGHRVEKTESIRDITAKVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVEEGEEGDEVTEKAERKAEITQKRIEVIHERTKHRKEVSD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKKGEVNNERTFETAGTTETDRWEHVKANQEDINVKWENE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.070000052452087"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHVRWVGKNWEARETNEDTTFKKADTEERNGQEVTKNEIEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGTGDARTREAEDRNFEVKYKRQGKTGRENRERIVEETEIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAEKFNVEEVDRGERADERVKDKGRKANTEKEFRRFEPKRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSFHDEHKTNHKENGDKRQNIEAFERTTYERGRATEDFRLRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQEKQDARNAKYVDEGVTTVETHPEEGNATKDEVKLQVRVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRESLRIERNTEFEEIEKRGSSKGVDVSAKKKVGRVKGKED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEAKSKGVQEWNKYVERNEDDTVGTVRRDERTAQREIKYNT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSAERTRRTNVQKNWHQQNVGEEVRTALKTELEVSRGKDRTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRDERREKEERVRNAESEIGEEAERGEDLKNTEKTGYTVH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERKREAEELTEVDRVDRQPNRDFVSLRGHVNNGYVDKQVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVEKRNGRNDTEPLEVDQKLVQRSREYRAVTNVRHGDDVEF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.699999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYDDKEVERERRANRVDDKARKQGKRVEGNKTTVNEYIYEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDTEEEFKEPRRRETNGEYETRDKKLAREFNRGAEISVETK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRETRENNRGEGVYDTEFKEVERVNETETEVKALQQRVETK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSENDSLQKRTKVQDGNEKVRDEFEEAYLDTETGSVQIRTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.450000047683715"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYEKDNIDRREIVETGSDEVSEQIGEREKKERRATAYAEED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDSYTLERRSRGRRLSEDLEESGFEVRKRKNEAQVTGTEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSLKSVQTGYRLLSEEEETEDSRFRVGEAVRGNDSRKETRRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTEDRGEERKTVSRLTNKVSDTVREAEVEEHIEKIRGETN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.600000023841858"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSENVVELIRKDRNEGEDERRKESEASKIVTKEVTETGHTTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSEKETLKTEETGKTPTNEVYTNIQVGEKRRKRATRDINQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDAKTTENSQKREVQRGEIFSRWVETTQHEKRKDLEYDNGL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDIKRAVEHYVKNKQKVKERTLEEEIGTEAEGRTIENKEDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRDAEFEEQRYTREKRTFETQFDTDTHARNEKLTGYRFAGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKRSYLDQTQKLSRLGKQAEKDGTQLQYTQEVEKWTVEDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEQEDAQSEENLRTVETKGDRKGEDGRRSQTDWRVNFDYL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSTGDYRLSDGDNEAWKDVEERQDRQTRRLKTENEFVGEKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSIRTKDEDAEEWGLDTRDQENDLEREEVVGQQQRRKRNLRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRDTERAGERERPRKVTTEVDKTGNRAEVEEEEIEVKVRKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSADREGEGRTRVPRNETEEEATERKVKVTKVEDKRIEEVRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTETISREFPLVKKTKDKIKNATGKTEKRKREKVDEKLSNT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.9599999785423272"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTDKEKDEIEQNKHETATANEDGETKVQRRTTRYTREKFP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTTEVTEEKKKKGEDNTALEYTLERADEEYKVGEQVRTKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSVYDRKTQTEERTVEEEAEAFVTEKERKQKRDKHGGVRVVS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.070000052452087"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTRKEVYQEKKTRDITTEAEDKFEKVDNETRITQLRGNVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.790000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNKAEGIAKKTLRRVLDTTEVETTGTEVRSREEEVNTRKRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKKGSAKEVREVTEVNENVERNFTRVTAEKEPKQFKVSSR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSQNKRKSETVGKNTNSVEERVTFFPATREKVVREKEAKEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSRDTEREQANNLQNNPETVERTVDRGEVRTKAESGRIEEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNSDEENNEEVRGLQRRVRTEVTETSTNKIQRAPGDREQEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSFVVVEDRNAEGQDRHETRVETRHFTRRETKRRDEEGTEAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSYQTEIKDNRTARKLDTEIQEKALDREKTREGTRGEVRVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.889999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEETVKGDTREYTSTVRQRGTKTWEKVKEDDKIERQRADQH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRKFRARRTDEITNANRTLEEKTEQFDNEEQFTDGQLEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNGRFVEVREEENDRYRTAEERVEITKKTETKGAVRERTHE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTNEDEEEERKKVRQAKDRATRNGERWKYKTRTISLRGNKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSINNNRERKDKRKEKRREKTGETREKKTLRTASGEWAVDYQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQRKRRIETKEYFHSVSKKVRKNATELSEDTEGDKVNGEKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGDTQEAKKEKTFYHITDTLVKKNRERESGRKNVSSVKERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRERRGTEKSTAEEVETELNRTIEYGRGDNTVVDLKFETR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRRGREVFEKVEERTKGDVTNENEITGLTASTDTEYTRLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTKARIEDEKTEEHIKRRVETRGDEVRTRDEKVNGKFERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDQYRKAVSRAKKEKEEAEGKVKQGTIQEKRVETYKKNGNEEF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6100000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSNLREALNKASEDLSEEQFELADVRGKEDQKFTEFESIGKKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.870000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEEQERAAKEAEKKQTTVRVGTYEYSPSTDELQKRIEEIKRKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKYETKQYVSREQKRGERLITKIYAPKRASEEAETKEETPEDQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EESWKGIKAAENNEYKYNSRALETDGYGQRYNDKNTVERQKNI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.949999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AAYGNKQETRAEKEDNNIWKERRGLYNNETSDVKIQNEYYKSG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence FKDTQRGFDDLVEKERRPEKEVKQASAEEKQWEEIARTEKRTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKREKDSAFELEFDQPKEWGETDAEQAQVRRITRKRVKTKENE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDKEKIKEKAKKSTDLRVEGNNEYRVGRELSPEQIERLVEKAV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VDQRELETRPEKKNSVKGNLKDKREPIYELKVKRAESAIEEGV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEVLPETSIVNALRKKDPERGRVKKKEKQEERKADVYGEILES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AQKATEPNEEVERKNTEPKAKVNKVSLEEVNAKKTGDETDYRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence STQEDARRLLENRDTVELTFGTKSVRVNKNNPEELKKLEKLIL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KFDRKKDEEKAIEKEDKKYSVENTLERYETETPRKNGKAERIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TRSNLAYNFLEAAQRRREAEESLEVKGATKQRVKELEDNGNTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEETKEEKEREKRGGTYRVDYGGVEVELGSPSLAEKEAKKILY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8399999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEYKYREEEKTRSLGKESGSEAILEGELVKVKGGYETVDEPAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKGSLTGSRGEYIKTSAKEKYERYAEGREKEEVVEDLLEPKGV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QEESNKQAWEGRQEGRYKRYEGDYWEWAENTGKTKAKEADNRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EQNWEYNKAANETYTWRGWAEEDGSKKYRRGQDEEKGAKREDQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TEAKDERVTSTEFVTGAKRERRRDARKEWFKFEAAEDDNEEQN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KVDKTRGKNLEYEPSREEQAKRRENELYRWKAPYELATLEREE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEEEKVEKEIRKDPTKTITLPGGYTYSASNEEDRRQLKEVARR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKRDGEYELNSEKSTVQRRPIKAKTRDSRTEEETGIELVYAPE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.939999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REEKWRKGIEEADTEYEGELWEVKIQVLKKKSKKVENAEKKRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEKTERLLKKARKNGDQKVQSGNYTFEVRTDDSYEELERRYKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKRKTSFLDEVYRKGKDTGNYLQNRPRAYREDTSEEGEKKQEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DYTATSGRKKRKYGNPGVERKRQKLLQEEKSVTRYEFDLEDEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDSEEKARRARKDGQTFRVKNKYEVTVSTDEDAERYREALDRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RTKREEGSRVQDEAKRASGYKKTYLNAEDRTDVREDSEAFDRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRYEKKLVKRTTRYVAEDENADRQGRFSTEEDVDDSKAREGSA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PPEKIAEKVLKDGLDTYTLGNKITFDRRLDPDQLRKLARKFKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AFDRVLDKGLTRLPDKEEALNTGKIKKRLQLTDPRKIPNKFDY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQKEGRSYLGREPRAELWETTIWNKATESLTDNPKFTRVERKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VSKRNSSNESTTEEEKSRTGQVDDKFQIQSNEVREEWAKRHAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VYKEEKKRDPKSRIEIKVEEGTADIQLDRRKKASNIAQVERTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LEQLEKEIKTRAEERSSVKTLVVEGRDAEKKALSKLIKGITKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETIQLVKEEKGLEREAKLVKLIGRTSVKKEIATLSEASKKRDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDKEEKAERLRKEREQFTLNNRVEIRKNDDQAEEDAKQFLKDQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRKEEEIKEAQNNERQLKLKESAELDDRQDTVKEDANQFFRKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTQALEDEKISEDDNRQDKFLDLNRQVKQFEKNAREAEKEERR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RTQENRAVQEITTKSEKLKEDFEYGSAKQPEVKKAVQEGKDKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAIATIDKAEIILKRNSTKVEEGDGESVKRKNEERRGPRYRGN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRSEKSDAGRLGADRRKLTEPVKEVEDTEVVPQNDPEIHESNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQTKNPGERVNGTNVRIQREQHETTQKAEEHEIERVRVEAALD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKTTAQKGDENLEKLEEAYLEIEKAHKVRRRGKRGFEKPETQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDDKQDNYEGKKNEVAKWDTIQAKWTVKDVKKLNRGEKLDNEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEKEQREVLNNWIDLLERAEALGKRVTASKVRPKEEGKDGRKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EELEEAIRLPRRKLATDNKWKKDQKVKGLERSEGRVVNDAGKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GTSENKNPHEEPEELNEYKRQGEVKFTETNAQKAEKIIDRAWS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTAPHSAIPYLEWETEFTEAEKGENRSNDEGVNIENREKKKQQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEEKARREADKLLNTTTKLKVGNYEFESPDPEEARELFRKLYG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NYNKVETTPKELLERKTSAEFLRREPRDAEGYELKELGDEAKF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SLGKVESIQTGKVVTYEDLAEEKSQEKNLERRDKLEITKSRDS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7300000190734861"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EVLAAEEESRVSKRVSDNRGQRETRAQVEQTRQERDGRKNAED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKDKGNEAEEPVRNSRRARWKAKKEKKEDVYITELSEPARDQN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDKLVEDTEEAYQNEAENEEPKRLRGAKKRSASNVPIKDRWRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKDEKSEGTEVAEKKYRFSYLGPSVRVARIQGETAKDTREYNA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VEIKDWRLAEEEYQKKEKNSLEWRKRRESAEIYNPQNDKAERG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEEKKIEKKVRKTAQTTLNIKGQVTVKNGDEDAIKRAVEIIKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GNKKDATEEVQRKVDTEIRVEGKIKPQKIKKKIIEKVATALTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IKGERNIAVKLEPKGIVVKDTIKNAKQEKDEVAKQKITRTKTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GTTYRERTELKDEKERWKIEYKFESAKRNEEPKVRTRESRAER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TKEKSEKENDREETAPRRLRKFYETRTAGREEEREKSYIRWVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEKKEETTADRFFRLNSVTSLGARLKKEETEWGATRSGVKREE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NKEEATVAQYWGEKDRRWSDARTDLEGKTTNVKTALDKAESRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQEKNSRQKEQVGEKEYVNANAEEPSESRIKWEEEFENARYKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEVQKRFEEAKRKNIDTVTVRNQLNFKVKSEEDKRRAEKEAKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RTFENDVSKVKRRKAKRANFREKVSLEAEKEKQEQTIDEKVNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence WEFTPDDREAITPTRRVTNNTKGEETRRAGLYLTAQEKDGVRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VEENRGVRKAADEQTEISPKREWKPQASEAQLYTVVNREEKYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SVYNVEARNKLREYIAESVQRTDTQTEKPAAVKEWEPGQREEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence WTVYRTISRGIEYELELRVAPLEGTKPADARKPLKELDQKEKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SVDEKELRRLYTKPKLAIPWRALKILEAYRGVEEDTTTPKQEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PAEQKERDIQNKTEPQVTVRRDGIEVHVTSKELAKRIITELKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.110000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AIQKSQRTVEEKKRPSLEIEKDVVEVTGERDTIIHTAPQNLKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QDEKVRAKPEETKTIVAHKIRIVLESNGPKRRTTSQLEDVEQI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKREEREEQAKTSRTRWRVTGVVVNIKTAEEGEPKNKPRRTAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRVWKTFEQAAKQTLSPGKQEDYRLKEASDSDTRFAELPQYKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESEKDPDELKKKDKRTAGEQEKSKVLTDITAKEARFVQNTDQL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QENERRRQKKGVSNVRRVEIDIDDVKGKTDKEKTRAEEEAEHN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEQTKKGLYSAITKKDDLSPYAFEAETRESNLENVATQKKKNT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AARLLTKESLEQDDNGKAIAYKNSPTNSVKEEQKTEYFKTTKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PQDEQEKAKEISKKKQTYKHGTKKINGEDPEQAKEWLEEQNRY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ISEEKTKWRQAEHEKKDTKKPNEQGKANDGYEPKQLIQQEEYK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DPHIGQQETTEKKREENYSQKEWIKKAENDEALKQKKQKPEYG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERESRKAIKDWATKPEAEQYPEETASGIYKNLERGYKTGKEYK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.009999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKGRKRKATIYYEITEYWKPSEEADRKEKANETKLGPSYGEAQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YSETEYAAKNGSRDLEKAQDFHNTATGQEEKPQTFLKYKKDRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AETGGGEQESKDSIKVRYEAAERLEAASTEAQKLLKGRSTFRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDKEKIIRKALELNKPYTQTKNNKETLSVTDPEKAKELLKKLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ELKKRQSNLKTDEDAAEITLEYLIKTKKKKNEKKNLPVLTPPE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YDKKESKRIKRNIEPAAKGKVKEDVQLQANSNKPIKTDEERVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEDSERKAQAFENGQRFTQDGREQVDGSDEDTYKELQKEQKKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6100000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QDYTREKGSAFQKAQEGKERGKNELEFKQTDDEERVDQSQDES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDKEGYNSEQERGKDKLKRDGTKQAQEQESEFVEATQDDQRSF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QEEEKKVEENARKKPTYKNNNQVTVSGTSEEEIKKAKQFWRDQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEQNYQWKNKAKRQVSEQSETEGEPDFEKNKRVKTAENVIKKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDVNKERIFEGNENRAQKKEATSVTEENPEKQKQYKKWTKVQS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEQNSQAPKTAFRYNGADARETLRKLSIREAEVQEALYTPKQD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence WEKESIIKRADLRRETEEENDKSRTLISKAREKGADVAKEGKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EQNPQEFLVKIVNRADKWIEIEVKNKNFATKETKNTPRLADGY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEQHTDEVEQEIERNEKIKAGENEAKIETSSYDRKYKKFARKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEGEYIKIFRREKKENTQKTRKKDVQIYHSANSAAEDEKAEES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKENDKGTDAERSAKVGRVRLEFKKIKADYWKYLERPTEPAKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEREKEKQLAEKHTGYYTLTSSSGRTFKVYNPEFAKKLEKEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TPFSNERDSKEKDTNKVETLVRAAKPRGATEGTKEEYRKDSRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8399999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DDDEETLESKLNTTEAEVQTKLQSIELEKKKRAQSGWQIASYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERTTWKTEKTSKVTSSLQEDQGESNEDILLDELYKAQAIKAEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SYEKKTGIEKANKTEKRVEAANGEITKAKTNAKKGENQVSKDW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YNVETGIKSTKKEAKETWVSGAEKNKEKTDRAAAGNKENQKIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.9200000166893"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEDEVWNEVRKRKADKQKEEEVSINDGSAAADDLDGSRKQKIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ASQREEEEIDDKIQDETNAKVKGLQVDRGNQDLRKNALKPDKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SERKRVASEAEEENKKATAYEQEHENPKNLKDLSYILSLLKQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence HDEEEKAKKAKKNKQEYKEGNYSFRLEGSEEAARRLSEYLKKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEEKSDLEEANHNKKKEEYASKRARFKLKEKGLYRGEQSAESY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEEDKRAEKLRQKGQTLKDNNSQKVEPRNDESRKKAKKWLRKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RPNLQREVPANKAELRNERSDKKEKSQGDTEKLDQKRKKKLKW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDSNKEFTYKGHKETEGKRKLQRESAELQEEAVNERAREEREN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEQATERREAQRHKESEKNLAKYERNVEFTKEGELKRGNDREE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EYQKTKGEIKVERSKNEASDVTFEIRLKSKKVDSDVSEAANKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ANKAFVEAESRSSGQKKDREIKDKVEDKEVSNLRYVEKTTSKI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PAREKVREAVEKNQELHIDLKGYQVQVSSGNEENAKRKLDKAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PAKKKVENIGNKSEKLEAEVNADEVEVYSARDQQLDRRLHQGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QRVVAGRSNEKKKENQELDGVADSRNIEHVKLKQPEDAAYKLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SKEEEKSGVEAVEKITRLRAQVRRFQPRRLEGRKPDKEANETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERYDKTKREKPERKVSVGGLLNQALIEKKKTSEVEQASVVAEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TPKEAKRAAADRNEPGYRYEYGGKVRVEVKSKQTAKELKKEVL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RPRKEQKVEGAAVKEAYLKTKPRKGTSEGEAYVYKKEVLRNAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKEDKEQSQLRRKELESLQRKIGEVEALTEKAVSRVGRKGENK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEWSQLVKKVDKNEEEISGQAQKEANALDDEKYRVKETGKTDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AGEALGEKKKNDDVENKAAWSDEEREVEKKKLQKQVDTYSTIQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SERERGRNKVEEVVKLNTPKAEARYGEWPQSEAIRRLKEYQEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LEWELGEQVYKSRSIEKTNGAPKEPKVNERERRQVYREEEAAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEARKKAEKLAQTYGPEVELGGSIKVTVQTEETKRELAKVIKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GELQQYIKTAGERKVPTAEVAIKPEGKVEKKRSETKLVEGLTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LPEKERARVEVPGKYVKALKGKGEIETQTTKEGIVLASQEKAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKKNDAEDEPKRQRQITARTVKKELKPDVTSAERDREGVTILT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKAVARTSEAKGNDFSKELRNDKDGDKTEKRTFAREERKERDL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TWSEKARQLVEKGTDEINIRNRVTLDNPTDPEEARRIAQEAED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VTEDDTPIITAENRNEQQDEVDSAILPLNWEERERAGRARTKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEGERYPRRIKEPAEILYIGLDQKANAEESEDGTEIARREKES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EERKERVAASIFEKGETWKWTPSEAQIEERKAQQRGERVNTSR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SSTVKEWAKKPQRRENIRSVGEQTRAEWREEEQGFATKEAIRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ASEDPHKVTELLKESLRATGRIPEAYVDESTKATTFKDKKETR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EVEARDTPREEIEREDKIKRVGGEAQRFQKQLIKRAVKKLKKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDKAAFIKQRQEQRRKIVKLDVREVGAEELEPGIREETDKKRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RSENQLAVELIKTLIRSDTVDYENTGDWSKQEAKKFAQKQEQP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEDEARERAASGQPPKTVEIDDGYKVTVKKNSEEYRKVEKRKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKYIPDKAEEKLKEQLERVEPSENDKRKRILIRRELRKGAVPD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QIKKAASFSEGDRESEIKKQINPVNNRIEGVPEEYRARTYRKF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ATKRDKAGSEAEEDRQKFRLEVEERGKVPTGTPKTVDEQASKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKTEEYEANQQLERFDQADVDQGVRGQVRKKEEADSTPKNLRL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NSQVRENLGFRQGQEELTLKEAQDEQRGVDVYRKKDAPDKETA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RETRKTGKQLIKSGEKVKLEVRLWKIDAKEAETPNKFIEEETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EWRDKTIEVKKASQKEKREIELNGLEETVKPFETARIELKTKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKQKEEFALSWAKQKDSYNKNGEYLTYETSSANQAVRRTEKEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NKEQVKKEADREGTEVTVQLGTQTLRIGPSRDDQDRVAQAIES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDEVSRGKDAQQTDQLELGAQGKTSVNETPERIDARTKIVQEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RVNTRQATNQRREGLEALTQEGEEPVRDVPQTRTEEQITIGRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence FIPEGEAEAESTEREKRDKKEKVAVKKTSIEKHKEKDYNKEAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KREGQKTVAKEKRDFQPSAEPATEEANDSELKSKYYVSEGKNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.299999952316284"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSETTTFQKNWEYPGLTYLQKSAAKLTVGEQKLPKESAKEAKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TPFKQELKKTQEWSQTKYALTKLNEKAYSPSLAAVKQKTEEGG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SRTEEIARQLIKDSQPYRFKKNGEEIKVSTPDEAREAAEKKLK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.509999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RSEEKIFKKPGYNKQARTADTKAEEPKAQSIESLREVLRDEIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NSAIKAIARKKYKLTEKDERPPRDLSQRVIEKGKEQEFTSEAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VETKEENESEPRKEAEVRPEAKGKRDKFVSKTEGQQWEEKASG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ARTSKSAFEQGEGNKTETSSGKPADQIKPVKVTESQKTDVAEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REKRKATNEEEWPGKAKSTSVDVEAEYSQQQSDNRRWKAKDQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ATKTKVKKKLTKPLEEGTTRVVNEYWTAQELTKGAKPFEKVKF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TPTVKGNTYKVGKTEKQAFVKEKKFPTLELTEEAWLKVKKTRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKTTQVESEVANNQANRRVRIGRGDIKLEKERKATDVKEKIRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TRDKRATLETLEDQKNEYELISEGRTEKVGTKPAVARVVEKRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.090000033378601"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TSDEKNGSERPKEKREIRAGSEASLTINVKSKEAEEVNRDLNS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LNAEAKEIERNSEVELEPVSSSEKNSTRGKRDSENRDKAITKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKYETKGAEKANNTKRRAKYEAKTGKLEEKTLTKVVKSTSRKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SAKTRETLYKETKGVEKTEKSAKTKTAKEKGYARLEREVKNNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TPKSAKVAEEAEKKGQKEVRVDGQTFSITDEQLQREIEKWRKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IEERAKEQWKLLKEKEFAVPVSQDRGEGQKASRDTVTEIKQTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKDYREVGTEITNTGNKAQAEFKRGKEKQKEAKKAIEEESTTW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETTKEKVTRKNKYESHESKERNYQQKLDQAKNREAYTEAKEGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QDTARRLAKEAASETTKIEWEVIEVDVDSTKEKKRLEKKGDKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IKDAKTDELKTVTEAEAESSIKERQEWLDEKKGRVKTKRVAKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKDKTTDVKSEINSGEEARPSIVKANSKKISDGKTLKETIRSQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DVKAGKQEKGTFDQIHRTRLELRASATKREQNETTQKDTDVKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NENIKTAGERAKQIRSLTNEEEARGNLKVKTKKVKREVESAEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6100000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TIVRERKKSLKTNEERGKEKEAVSAEIKGEVKILNQENTARAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EESDSKVAEEANKKKEDADIVKGKISAYNKQGGNTAEKQSTKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GTYEKDQAGKVNAKKKAITEESNDDSSKKIKAVGEEQSKAVNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDDEKKEREKAKKTQLTVEVPGNYEVSGPNAYEIAKRLEKKYK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PATLEEKRNEKKKPYQKVYGEDPEKSREVAVGKIAKKYLTNDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SKYDKTFTEAAKEESRADRRASDGTVKFEYKVLTQAGDRQTET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESKLEEARKPKEQLTGTQELRKKKATGARQLYENLSEVEQEEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ELKELRPSRTEGGVSKLQQGEEAERKKQLEKNTEELQKETAAY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RTNAKKHLEKAREREEYVKQLKATITARRDDENETFESEEKQV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDAASRIILARKKITDEKTEEREANHTEKDSDVKRNDQAWKAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DPDSAEAIKKALKNETKVRVGNEEYKVGSDDEKEELRKIAESD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.680000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NVRKVYPIREAGEESDKATVADNSDKLIEESEKKDADKGLEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8399999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SGRISKDVGAEIREEDPDDEAKKKDKEALEVKTKEASVLNNEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.179999947547912"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEEEKKSEKEAQKKQQTFELNGYRFTGHSKKAEDQKRKEDKKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ARKQKEKKQKFKHENYELKFKGDKGEATEQDPESSESKQTRKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKNHFKELPGKFKKDEYSEEQQKSTQKKKDKASRETGQAEREK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEEIKYAVANGPVYEDEPRRSDKREGADEKDVQLRKRRTAEKW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QDEDESEAIKEINRVERQGRIGKAELYEGERNADQSFRRIKER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YNRWKAPLRVASLLWTEEKAPELYEATADKVRGKDADRSGKSR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REENDKREAEGKTAKGKEDLFEKPWPQDDYSERFEASQYREAW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRYQEELAEEGFSWQNAKFKKKEEAETQEKSARSVLTRASTDN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SNQEKSATKRTEQWLGQSLKKAFEANVEFEKYARDTSEDREAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YKKEAEELKSGAEKAKNGEAKVKNKRKPSKREVNKFSEQIEKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IEQEEVKPKEKSRNLGRKSKNEKNEGKKAKGFVKASKEKAYAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PTWRGVDLLYTEWFQRREDKEAESRQDANYEYKDLRRKIREGA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RWYTAEGQAPKEWRVDRGEARRLDYQDRLNEFSDKEKELRTIY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDRKETVPEQADREGTLQAEYEFVSWQAETGNSGNYPNRDEKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence FERKRDATRDAEKITAPNLRSKPSEEGEVRERKDVDRGLRVKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRRDLNDIERIRETEKIFEKREKEEKANGAKYPFKLVAGKEAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RGDKEQNAAKAFERWEGPRPLYQEAEVQKEDFERPLKRRQNKF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TKAKKVAEEFTNKETTLQFKSKAEVNVKTKKSEGKDVSEKRES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKKTEVKAEFVLTSKKAEKSFSDATNEKNTESKKKRTVGKQEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PPDRKKEKEENKKKQGYTYEEGGVRVTSTTEDSAKKKVKEILS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PVKDEEKSKYKETKELKERYSAGIDGRKKTEEKPQNSGTKVVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LTPYGSEEIKKREDAEPKVKDKYVSKSKRKTKQTEVGENKETG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.990000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PRDDEEAARIAIELNGEYRLGNKSFHKNSDLAEEWRRREKKRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKKNRDLWEPGAKFRAYDRAGKENIRREERIGDSAEERESNHL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GNALRERLDDAREWKEIRRPAELENFGAERSISRKKHNGEYKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKNEEAVYQVRDENEEWKISSEKKAKATSNEADTEWKKVARNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IAKKTAEEAKEEGPIYRTNPERRKKKEDTPVLAQEDENKLFGT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VEADLTYPEGARRLKTAEKSTRKLAGFTTTEGEGFSDKDDKKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PRERDARKRGEQKREEAEAVATERDQLRQETNLTSLAEEARYG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESRKQKEPNEELQQRGKVQAENDKPQWATVETTYKAEKKVTDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RQQAWRLKTDTEQEQVEGERKTTKKNPANEQEYDEVKKKPSAV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEEAWREAEKRNLEEFELHNGNTTLRLTKGDEAWKELEKRKKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKEGLEKAKRNDLTTLKFENAKTNLEAEELRKWWEHPREEERN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ANWKLTKADNEWEREEGNEKEFLERGLKRKLTRALHPEETKEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DEKEELKRKAKERPPETEFTLDNKITVRLETDEEAKKLAELEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RETKEVEKKPKEEALDKELNATTELDPKATEEKKFEDLIELRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EREQETTLKKIRNYEEEYSTGEKERKRAEHEAYYKLRQLRHEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YREGLERELRQEEYHYEEEERTGRELTARKKYENKQIKASTHK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DEKKETAYKKQEKKDKASGKLKVETAEITKVQSLQTVVEIKKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKKEKKASYRGRTRAVKKEERKAETPDWNKKLGEEVKTEKYKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QPQEKREAAREAEETSTFQLGTEKYTRNTQKVEEIVKQLKKDS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8600000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQRRESVLYYATENNTKKKQLEAIEASVETRNGETAGKRAESL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YTGRYERKSQTVTLAEEKSSAEQNLARKEENKIGVTAARLNEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.870000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NDWEEASRQVKKTDSYQFKDGTTKIEVGGDTERAEREAKRAEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.889999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DTAREAKNTGSEESTDNGKDVRETGRFVARKYQIEEDWKQAKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDEEKQQKEIKKNNDRYTVNGQYEVEGGKDQKALDWVTKEWQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNNTQRKNTGKEEDYKDEWEIQYKGEWLKQQQVAKVVKDDGSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKKNNAEEKKTYKRDQTVSIKNQDLVGQQDEVEEYKWDWEGKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TTEEKKRSYDEKSLVKEVRRSLEYASAKEKRELEKGIENGSTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.970000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QDLAEEAKKAVDNGGEEVRVNNSLTFRGVSSEEARERADKALR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKAAQKVRDAVEKGLNEANLRRDASGEVGSEDSVENEATRFLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEKSKEIRKRANKQDDFKINGQIQVSRSSPESVDRAAQKYAEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.870000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQRDRKPSIEQFVREPSKEIIRSKDEAYKNNSKVAQASGDANQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQNRSKGATEVQEKYEKLDTNLPEIESSKVEATKGRKQERDSA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DDSNEREYEEKSTRGKRKLKGRATEFELEEEYVIERFKSELRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSGEEEEGRKRLELRFTYERTEFDRIELSEEKVEAYRKNAKDS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKSRDDAKKVASREEQVKATKKPEIHKSELESPERISKDLQND, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKADKSDSSKLEEEIEHPQARKSEVALRQSTKREKPDKIDVNV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDEEQKKAKEIIKRTEEVEVGGERVRTRNPDDVAELLRKKEKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKKDKSRINRVGTREEEVKLLGTELEEEEVRKAVDIPKQRKEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VREEEALKREGESNKTALDKRRKGTPKDEREQEIIVDKVKEVL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TYERESITRVLKDTDTARAQTATTDEKIKKNTEGRKLDEEARE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEVRAEYFEERQNSNEVGRYREKAETREGEVIRNAKRQKLQQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence WRRRFGEIEQETVVADDINQQLEEGSGKRTWAGEREITAKADA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SQRNRLARGVWEKPDNTIDAKDDESAKFTKLDVQEIPNTATEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDKTEEIKRRIKKLDEYTYGTIRVSSSESPEQIERAARKVAKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.019999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERRTESDKAEAVKKFKSFQKGDVDGEEGNRDARSRAEEFKKKF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEGKRKNFFVEDDGEKTKDEVRESQKSAEFASRKAKRDFKGER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SKETYETEDELTKETAKGDFQLQQIEVKTTDNAQKATEERKSD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDEFLLYKSQTETETEQTQKSAQTDTAEDIKDNGEAVERKKEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TEYKERAREAWEKQQKFRVGNVEVERPEDYRKAQEIAEKVLKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RERYRDAEQFVKEKEYIEVAEGRWKNAEQQEQLTKPVKKVARE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDGEKLELTLKTKKNGKEILAEKEKKEDKTYTNEASAREERES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.990000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SSERTDGRRDQEKLKERAEAPVYKRKDKELKVANLDLNGYKNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TKIRKLDRNATTRGRDRLKAKKKVDFEAEDTEKWENLIEEAQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.159999966621399"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EERQRAQDRIEKYPKGYTFTVGNYEVHVKDTDAAEEFRQAVEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VERSQKPKENVTKYREEWNGAKRRASVNQREPEEEVEEDKKTS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QNGNVEADRVETKTEWVEPRVKERNRKESEYPEASSKQKEKER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REERNSAKDLSQKVQEGSLENVTGEFKLKEEKKLRKAVEAIST, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TLRNFEQESKSAVVQAEEDLKKGSTELEIGEKKKRRANSVEKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKWTKAGEKAKKTGETYWTEKPKEAKGETTKNLETAAKRIVEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKNKTKDELTREKQQGEGTETILKAKIDLGNDKKLNTLFEKLS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LTELGTELTFLDDDQAIKNKKKEGKRKQKKEKIDEGNTTSNLL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SAKHRVPLKGKKNFREAEPQREKRWTGYNLSIEYAEQRAEESG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RAATKEINLDASTEIDKDDRKEGTTQQQKNWIEVKTVRVEETQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAEFNKTEGETYVREANQKEDQEEEKRQDKKEKARNVKTSENV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QPDEEEAKKISKNGERITSHNRQTLENPSEDEAREAWERLKRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QIRSNTIQQGKRDPEELNRKSRKRWEEAETENASEALHKPEED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERINKNRGPQARHTRELPELRNAEDSQKTEEEDIQKKSESEAW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDEEEKKRRKEQYRHVEVDYNGQTVRLSGYSERDAQEKARELG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DSKKYSRSERRERRDAYLERTAQELKVHGEYEDQGEQNGEKVV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERSKKEEASQTLEYEEDHLKGYEYQRNQGVRVRAVRKEDSGRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQLYAAIERDTLRQVREQDKNSYGKTGWDTLIQTEAEKAKAEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SRNRQLTEEAQRKQRSVYKGVAAEIKSEKEKAKKEGEEPDTNS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GIRKIGESRIKKTTIDAARVEHDVIVTTPGDSTEETENALLAS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DIENTADEEARDDTEVQAEQEPRDGKLRLSRGKEGQTIRRKLL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TKEATRPDETGTEAEGVSLRKVIAEDLEGEKQKTVQNAVRPFK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IKRELAVATGEAREFQTQVKPTKVKSNGDKTGEPLREETAVED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.470000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QTSKTATDGIRDKTLDAKQEDVKQAKGDVLKERVGKLAIDQLN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VDGTNDLLGLKKKGDQTAKKKQDKVTRAQTAIADVRSQIEDEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRNNDVGERVAKNTANRFTLRREKDVEEFEKELKKVESKIDRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKAEENEVRTKFDENKVRRADRGVNNEKSREFIVRKTKKLEDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NKDNTERKRVTEKIQDVRGKKEIQATVDEDSEGKSLVNDKERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YASAEVVRRLEKKPLKNKKSLQQGKIKANSVELKEYPTRGNEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NVGQDEKRNPEKIAIADDRTGYGASKGKIEKKKEESKKGQVIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7300000190734861"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DEKRPVQQEARAKWERARFENGDDASERWERDSSGHKKWNNTL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEARDYIKEGQNEKNTPKAASESVEWTLKRKGKKKANTIKKEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TPRKRVDTNLEENDSLEGKSHVRKLNASTYKIDPEKEAKTLII, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ITKEAINKPLIDTENVSLKTLYKSPEANEDHKRLVTRRGSEKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SNKDETEKAKKKNLEVTVKSGTQEYRYRGYSEWWAREQAKKLN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSERDKQKAETTSWQLKGKEANNEEKYNLSERWAGKYYVKTVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GYEKRKADWKETSKQKYNQKLLRNWKEVASKSTREGNAETVEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TLYRLEESPERKLAEAEDGNQWKGYWKDARETAPQKLSQELKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TRRQNTLARAINTSTNKVEAGSVDAEWTKKSIANKVREYVEST, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence STEGSVNLKRNNRAAAVTQIYRENTRSEAEKTATTIVVDKWSK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKSTSKFIRGGVQTGDREDLTGRQAKAEDPKAYSAADNAEDTI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NTVRWEEQDAWTDTAGDKKRNAAERYTKKQFEEQPNVQSAKQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NETDDVEKTAKASIRYGVAEDRETVKEGFGVLKTEARNKVKKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TQDKEEARRAAEEGQRVRFRNKIEVNGPSPEQAKEVAKRLEKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKQKTRPREGANEAERAEVQKNADPDFGEAERLRRVVKSIQKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DFVTERKQAAIRGEQKPELVPNGNDAAAKRSKKEVERREREQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKTYEQARRSVNEKSEASARRTRQTDENAREEEDADQFVERVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QADSRRQNTERKRTAERVSARYEAFVAERQDEKERNVEEDTSR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YLNDIKEAESSLNEPASYQRVKHKKTRSEDAEPLIDTKKTFAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YGIDKEKKTKDKKRNEREAAVKKSQIKREVDDIKQEAVDERNS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DTSEAEKLINRSIKVWKEGEEKNEVAAKRDGPPEDGWKKRPEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KIQEGTETFRSEALSSVKIRGTKQADIRVELKKGAKWDDEVRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AFQQRIILRERRADEEDRNVSQEKTEALEAGKRGNKEPEVAGD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KYQKNAAEAWIDQEGNEYKDAATIRGKGLTLQGRKAPRKLSQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DNEKDETEKKNENQVDRFKGSDTFRLKGANETSVREKDKQSRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDNQGVSTKKAGENTRSKFRREREKVLEEFNKDKKQDDETNND, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REAEKYSNKAKKGQEVTIESPDTGRKFKVRKDPEEAERAVKEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESVTRYKSKADKVKEFQGKNAKKPERGTVERDPEEAEEGIRKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRPAKYGFDNKKKESSEEAKEKTEVEVATGEKGRQKVDPREIA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence STQEAAREAVDQNTTVTVEDGTQKYKLEGNSEEVKKLAKEAKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KETEVANEVANQKEKGELEKAQTKDEVTAYTSTLDRAAQKVSG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LVGQEGTATEVSAAKQTDKEENANKLRDKKEVVTEEAKAYQST, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRESKQAVREVAEDDSETSESRTAEWDDNNDQAHEINSRSRYR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEIKVEDNKDRHRTLLKKAVQIDGQIDSAKDKTEAEDQEAVRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8600000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEPGRKKYKWEQMGVVTTEEVAQPENEKRSARERGTRRVSKEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NRQEDKLWWNAIKQKLESPNADADTAEGETLEVKDEPKRISDQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEDEKNAKEAYDKNLSEYTQDNRKRYDARTYAKQVEEEWQKKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QWRRQSYNQSKAKYANADELENKRAEKEEQTTKDVYDKYEEKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.440000057220459"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KLEEKTQESKKNENEFDWERKFESAQAPKRKAGRRGRQEVNTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QFRDNERQTENREAPYYRGEGFEEEGEANKEQKVNQKWRDERR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DAEEGNKFEGRRQREQEETADNPNRERGFWYEYREQQRKNVKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKNTANLADRGWKDKKKFRLAKQEVEVDQKNFKTEAEDVSDTP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VEKDDSQEEISRSVKVKLEAGEKEAEPTTDSLGERRDRRVTKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TETEVKEKYDVGKRESDESGSTILESLKRRKDREEQVARAVPD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GENARRQQADPQETRDEKAEKFSLKVADSEVYEKTSDDKGEID, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETRKARERAENKEVREYELNENDGDLPPEEKKVVKQADEKKNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence HDDEPLDKKREIRAYEGRGRAKTNETNRAKYEQAKSARDSIEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ARDILNSGLKYPTESDNAEVPLDYEEETRVKPKEDAEDFKKKF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.889999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QPEEEFAEKAQKKGEKFTQDNKYHWEGNDPEQAREAFRANQKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEEQDAQFTERNEAEKFEKQGWRAAFYPAPKGNQDYHENKQKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SQENRRAPDWVTRRDLEKEKIGTLEARQTHIEYESTVKEDVDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.009999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEDKKGIAQLLDSAWNKHTRKKDPKAKVFSAYVKKIGNELETD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QDSALKTDKPADVKGSAEIKKNFGTKKKVWYHKALRIDNLEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GRETAERKKQVIEQPEPSRIKVDEADARTEENEKEGSRLVEKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AREVQERIEAKLPEGKDPEVVEKEIERRNQKRETKGEADVSTS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.019999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETKYEELAAKAVKTKEYPKGAEQSVTKRNAQFEQFVKELKTSK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SFEKANYGFAKKAVEKLELTTERATQSKQKAVYTPQKEEEKKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SNESKTQVNEGREQQKEIEAEARELRGLTLDSGSRPVEHIKNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.070000052452087"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EREQKKKSEGEEKVKRVEVNREIIEGEINNKRQAYTEAERNEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.02999997138977"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GEKVPKKAQKELTQAPSEIKVNLINGRFERVEERKRARKGDKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GESWIVEERGTLTDSEANAGRPLKKSQTAVEELKRRALEERNP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSAEAGGEKLRKRVLRKRGVKDTKKLEKEVFSTEIKLANLEDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKKETREIKYWEKKAKSEEAGQTSKTFETNNARNVGETITYTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PPEEERFAQKVKDLGTNVDYNGIDVRAGNEQEARDAAKQRRKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GVDEYRAGQDADRAFEQVKKNVANANIPTEKQPRKGLRRDEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ARYENRKKIGDAAFQEKRELAEERVQKDAEVPNNRVGGQPDTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENRERVARKALSSTTKAYVVAERRIEGEKSKDGKEAEKKIKYG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DGKAEARGIKEEVKSEREKAASRVEKKYTIGTKSYALKEVRNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEIRKDARKTITTEFAEAKLVTHEVTGKKKRQLKKITEIPTDL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IREEKNARRVNEDDQKGTVTTKVEAEAQTKEKLSKPNRKAKKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LTPAGKNKRAEVRETEKVEANRKQKDKNARLKKQTTKDVSIEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SKESTAVTNAARKNWDSLKAEEKATLESSRNSVKKLWDSVKRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.910000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDETKKAKEEAEKGKQKRTVGTLTLEYSSREEAERWTELKKRH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKKSEKEEQKKRTTRRWLSHDGTKGERLAATSKYEAETVELEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEKVEEDKSKTKKANDSGFEAKKDKLAEELELVQDKAWTNGQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.269999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NRDFKEIKRIAENGKRGTEGRLKAKADQKVKKIKRLLTEPKDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RIREKKIKKDALLDGKEGERRPQKKNIKREGTDLKANKAVAFT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DPDKDARKLADERDQTRLRLGNYEIEVRRNDKDNAEQRAREAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DAERRADEPLKEYNDQDIRLVRERGRADNDNTRRLQKKADEAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DYERQNAEDKNGPQDVDDRRLIALNDKRDRRALERKETALAER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENKDENKKREKPMKLPVLREQEQVEAITYAWARRDAKKWKFNG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VWNDQEEEKEKNGDVQGSLVKRKVIDKKAIKAKLGQSKRVKAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PSSEQKEAEARSAQGRIQGERFDDDSYKKDRTSRGEAGADNVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DATTRKSPELAKSIEAKRVKIKLIEAQTRKDQGDEGASSGDKW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SAEREEQKRRKYKRTTKTGAASDVVKVEDNGTLLAITTENRTI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNAQQLIKYLEKNTAKEEEVDQTLEANNRKKNELEEESKRRDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RSSQEETQKRTGFSRAVELTKEPATVEWKKEEKGREYLDEANH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEERTNEEATSLVKLDGTEGKREKPWRFQHKAQETYSKVEREA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DTSRAHVAKRMVEEKEQIYLIRWQGYSATEEVKDKDEKGTNTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RAWKMGEHDREKKAEIDKGAQALYSYERTTIVQTVNTVEEDSK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TKIDEHLKRVKEKAQEGHALKGKAKLVTKRSLKQEVEEGLEKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.080000042915344"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VGDETKLATEEKLEAKEKGKAEASGKRKVHELQKKVQHLKIRL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKELNGVEEAKEKQASKADNWLYTTGNAKNDEVRTELENKRDS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NRELKKAAEGLRQKERFNAKIEDDKEKEHKNKADTIRSYVRNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DNIKQEAETTKDKETNVYKRQGKARTVSVEKRHKVEDGTTLIP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IEKTEEPKTNLKDVAAKYEKEGIDPEGKTSKELRKVDDADRSK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QDDYREKVRRLQKKKPEVKLGTVTIKRGDDDAEEKAVKEYEKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NRKKLRDKEAQLEYKVRRVDVEGEQDTIKGEKADDTEKKKVPY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKKENIDRDVKKWTKAETYKAKKYTRAKAISNEALTPLVTKLL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IRRREKGAKSIEEQKAREVKVISVYVEAEKERPNTAGEELKTL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NKAEELASEEIEKEKKREPAEKSIVRVELGYGVVRAIRRKQTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KVKDENVRELPSEKPSNELLAGSDPEAKKAKQSYPLKSLIRTL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AAPQLRKVSEKPETKEPNSDDSPLYNLAIRSEVSGKKLELKKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AVELNKNVERPETEGERKAREIYATGTPEEEERLREVQRKAKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YRERAIQGERATLEAVREKKNVAKREPNGEEEKTNRLPEEVET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKGETAIERLYKKKRFEQANRKVTKDKAESAKKPKKPLKSAEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TYIRNLARTLSTRAKDKSKEGREDSHARSSKKATEVRKEVTEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKKSSTWIKSILDNKEEGEAASKSVKKEKNEASTVRTSLSEYY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VEQVRLRAKSAYQGERRAEKLNDNSREVWTVLNERIRDDIDAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKAGGELDDDVKKWRTTKEESESGWDARGKKEQAVIRNRIQDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETDDNRKVKRIFQSIKEDKGADYKGTFAEREGGKNASSAWQQD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDKNRTLETAFEDRRTNANKREKRYDHFDNDKRQESAETISDS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.9200000166893"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ELNTDSDEDIRHSKRRFDDAKKEFAADSRKYTTTNENEQERNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEDEEKALEKGVQTQRTITVNVVEPDARNFQLKDIPKKASDEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DERKVVQENEFKLIAQGLRKAEPTAEKVSTNVDTKKDAEQDPI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YKNLNEAQNEATRKRKRKKKAAIGQVEDDHKQAVRRIESKQEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NQEVADYQADQSEIREKGAKHILRKTRKAKEVQKENKKENRRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DQRGDDQGEKILEETKSLRVAALKVKRLKIKKGKQAKDKVDTP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ARYEKYFGASLVDKKRRATQKLEEADSKYQTIDQLETNDTKDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QEEEKTIESIGDKAKKASGIEAEWNILVRRTEGRTRAKQGHQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EFKLRKGADANVYGQYTESTSAEYAGEREGDNADLEARKYKSK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDRASKEAEKQIEKKDTYELNGLRFRRNDEEQKRRAKKTAKKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KLSNAIEEDKDKLGNDRFRTTKERYREREAKQKAAYKEEQKRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence STVKDRAKEPRKEINNEVKGTVAKLTPTVQEASKARTVDQGLV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KESTKSPANEVNEKSQEWSTTGENGGIIKEAQKTIEKKLKEKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAKEIPGESENTSLAKWQGEKKKTKKENTQVINSQIEGSKTEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GEEKKKAEEARKKGQRVTLFGYEVRGSNSEENIRRAQKEAEKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ASQEEQFYRGNKEAESARGVIKELKGRENREKGERAKTKVKEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.139999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKSLVEEEKQGEAGNKYRIQASFERRNGGEVEKAKAKERTEKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RPNRASFLGDLAKSYAYKEKVADTYLKNETENKAETLRRKEEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENEENEKANAEKEKRDEKASHKSEVKRLELEEKGRTKILELDN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence HKRLDQEKHLTQVEKKEGRPAVPVLKFFKKTKLSVEKEDTRAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GQSRDAAKEALYNEVNYTDTKVNDQQQYSKWELENPEDSPRET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TKSDTRKDEEKKEDTRTSWSINVEEQTPAEGRGFNTADKKRKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TNTKTGVKTETKDRQREKDKSIKESTEEPKDGRDREWAKNFAS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TQSTKKRAKDTAEEALFNGEGEPERVTVSTYEKLRNVKELESN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AAVSKPERLREGFYNEKTTREGEVEQKLKALNETTTDVENSKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PTIKRIIRKVQEKSRQATIKEDANLEANDPKKEEEVQKKLRNP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDKKREAADRAEKQNTEIKVENIRVRWQDQNVRDEIKEERDRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDREEESKKAKKKGQPVTLKDGNFKYEYYSEQKAKEQQKNDEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YQYAEAPTSIANRDKPLSGRVERRTDIEETEAREKARELLNKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RNIELEKISESDAPDYLKRRSAAPANERYLRRQAKETEGVTET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LNHEGEKISKAGKEETKKRAKLKEVQAEDEKPREIFTEADEKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NSETQWVADGADESQSAEGELFRQWEPNYVEATEGAKKARKRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence FKNTRDEAVESQAAEYAWETEPKEGRWKSQAQGVGDLARNQSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEKQTKILEEVYRKDRVETDGKEYHFGRNDEATEKAKRAYKKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YKNRKKLIRRVESDKTAEYNFYHKKGVTQEKGREDATDAEKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEQREDAGKARKKADEETKVIVLGYKNHTKYNKEYRFTRDEKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKEQQRPWEKIKNNTYRPEAKDEEVEAKNFKAETDAYRATRTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDEEEKKAKKAEDNGRYTYQLGTNKFTVTNSDEFREALKKAKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDKKKKLKEIAQRKEEVNFDNKYSLKRPSPELAWEAQKRAEDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEVKTYVKRRNREERQDDIAAIADEAPKEPTESRAGKKDQLEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DNKKKVRPERQNEDRYGQAAKKEVDVEQAEKKEGLTSEFTGNA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSGSERKARSEIEDTKGTNVADRRKEIREENPYKQRIAVGQGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KVNEKRPNELGESDIELTPTKKPNADARRIREAQSIVERASTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEKKKKKYTVESTVRESNLEPRAEKGEHVRKRKGTRAIKQIKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VLREQSKKSKGVAAKERGYNRDKKEVPHKRKKIETTTKRKEIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQKRKLEESAKKRSEGDATLARVEVKVRSESDESNEKFADKVS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKTESLKESKVDERAVRSQVKSESRALRGKKAAKSEFDDENKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.939999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDARKALQEAKDKGTRVTSYGVTFEPGADDKKADKIDEQLQRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDATDFAKQIYDDAKTVSKEVGKGRAPLDKTQLRKGDDQAERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YAPSQKTRKTEGKRDDEKDIKTVALADDGETLQQAGDAFVRDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TEERRLRELSKQKKDEVDARASIEQTFSTVYYKAANEGAYKQN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IIKENHPEEKPSNANNQKPRTYLKVEIRLEWNTGTRAGETADI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEKSQNRGDKNARDKSKVRVTIVRVDATKPDEFKDGEEGADSA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QEEERQKNKNIISKNDDAIERDGKAFSALDERGNKAAKVKGRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEARLQTGPSQYDNTDEFETWRTAKKNVNRVTTVVNQKDAPQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNDYYEGKDYLSNADVTRTNQTANELDVSKDKDPTNGTQADQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REQKEAEKRAEKGAHNTTLKFRGEEYTVTTEQDAREVAKKVKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RLEKELREAEKRGLTDYTTTVNGKKIQLSPTNPEARKIAQKEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.139999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DAENNLTQPKERLVTKEEERGTAKTGKGELTRAQISKPLRKYI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEINRTIQKTATLVKKAQLGKRDLRESGPKEELERNYTGTPAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKEREKIVYEVKERRNKISATANTKGSEGTTKKAEDRNNERET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAESVRNETEGTKEDKVERKYRNNEAKETNKETSKTARGIRIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDEVKKAEKAWRKGGEFKYGNRIRISGSFSEEEARRLQEKAKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKNGKEIRRAGEKAISASDGREAKFRPSLERQEVEEGYKKWKF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQFRSGKAKKGVKGAEERYESIFSAGRWKAEEILKREGRDENP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EVEERTETRSEKNRLNQVEVKPAKGTKANGTKAKKKGDKEPEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IRDDDVKEEPGSRAKKRLRLQKVELEARAQRQKVESVKYEWEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DNARSIIEQIEKTAVDRVKPDDYEKANTRRAKEADDGVEDFTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKQDKLPARARINRNDEPENEVAQYNQRSVDRVFGARREESDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SIDAQRAEENSIEKKRDKTEEAYARKVEGKSREQESNRGTPER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KIEDKKDASTAPTDKNQGKIKSEVSAEFRESRNSRSLTKEFDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDRKKELAKRAADQGTTEYTQDGDTIRLSSEEAKRALEEYNKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.699999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QEKEKRAEEVRQRANGDFKWSGPIQVDIQSDEEAKKALEASQV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8399999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEKRQEVQQPQKKLSIDWKAEAAVDFQGEESNEAKRGARVEDI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EFQQNQQAWDDEKAGEVEISAPREAIGLEERSKRVSKDQKKAV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKDRKVKQRVVNDEEKGTAEPTKEVRDEEAEIRSAAKKISKES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRKEEAAEEKVNKEVRKTIRRAKSKVEVITKKGDEDSQKESAP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.790000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKEEEDRAREEADKKTSVTSNGQTFDITSEDDKEKAAKLILKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKTDDKEAEKSLSRTEDGKKNLSDISITEKEQEKKAAEVFART, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEQDIRNARRALKEGRTLKDGNKTFDAETEENRKRLQEEAKKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEEVKKRIEEQAQKQPSYTFPDNVDVERNDPNSIEEAKQRAEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GAEKEVETGVKRTITSLRPTQEAQLNVDRANETKKPLSTQEKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GTTLQDRKLKAQETLKTKPEVEEPRKRNVISNTAQASEATGEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKESRRPKQAGKNSNLAEVKDSLTKLDIEKNEELKDPAKTFQD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NARDADKPSATAPEDNETRPKQAEEEEEGKNLEKERFRRVKGD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RASETKVFNAAERQPERTDLSVAANDITEQSVERVGSEGTVRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RTKVETKLEDNGTETTEGEAVTIEIRADDSDRWKTAVQIIRKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TTIARDSDREIVETVTDKIVKTNQLARKTKDWGETEIERGAVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VERLNRAKESITSTNYDAKPGLVEGTFSKEEGVKEADQLKKKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RAYDALSRSFQVNDTTEKPEAKKNKSKGKGEELVTGKAIVLEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEEEKEIAKLIQKTSEVNNRNKEEYRQGSDDAKQVEENKKKAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QLEEDEKKEEKNNTSQKDAKQSKVIINVEARSKYGERNDEKAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RAQTNTVTDEEIVPRGKANAPSKAGITSEVKKEAKEKTTDLKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TAVFKKNKSKTKNKKARSLDKRTSADGESKDDSAEDTELVPTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKERKPAEEGIQKLNDGKVYTVNRSETIDSASEAQEAERTLQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6100000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence STEEKAKKLKKKANNGEIKLPANLKLKGGSEDRAREIIERIRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KETKESAERLLNLRAKNKELKEGAPKISKKARNIIRDGKIEEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKNDKYINRVVEKNKQGTLEEELTITPKKADDATKAKKNAKEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRNQESLYNEASTIDRKKADAEWTKGEIYKEETLSQGKQSLRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LASAETKERGKTSEQKQDKQNYKIELTLNYGDSAEESIKRTWR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PRREKTAEKAAKDRTEVNVVTIEARVEREKNDLTSGDRDIKRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERNKKNRDRRTEVKRERLEVKATVEKIPADTDAVRAETDIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GPDYEQAYREVSNRREYKLNNRLRYRGEDPEANKQAERDAKKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.580000042915344"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ALNEKKASERAERYDYDRVRRELYNKPEYANPKQRGQREGNYD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEKREENPRQWREEKRQAEGRANEAKLDTDEKVRTVLTFIETL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EIEAEKNGRRLVNQKTEFNGWRTAKPEARTVRSASSEAEEVKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKDEEKARNKARKKDQEKSPQLEGESDADEYEKKKGFTKAEEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.049999952316284"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEAKREDYWETSGEINASGILEVDKKIKTKKAAEGNRDFKEDV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TEELEGKYRKVGSKVVAATRKNRIDGTSEEKEARDKKQATLES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DYKNSEGRRQEQEERKERPLTENTGENNRTSVTLIEADVYAEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDEIKNRVDDKLRESDDGDRAYIKAEINEAKRIKQGIEEPRQV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSERVKNLSTLLQNELEEGKGEFEKIRAIKNEEAESEARNAKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KLAEAAVLQESTFNREREEIRKSRIKNKEEENSNEGGKLEKAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NRVKREIEERIRKDETAQFETKWKLNLEKETDADEEATRIADK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TAEQLFADVKITRRKIETDKIREDEEKLKRAEEKEWTEANNDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YVKKTVRNIAKDKLDEQIKPKLSRVKGTDQEVNPAREIDQAAS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKWSYEVHELETRTKAANGRNQIRKVEAEQNTEIKKASRTPNT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LRYEREEFKEEASSRDDGTGKIQRPSLRDSSTIRKIEKAAEEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ATNQSDAVKHAGEYETRWKKWDDRRGRASDQRVNTSVNNAYNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESEKRNKQKYFQLPAETDVANQNLRKSKNIVEAKNTEKKGWEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence HAQEAYEYAREQDQDTYEWNGQFRISRDYTKDKAKEIDEQAKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.460000038146972"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EYQIFAADGTEARRQYKKNRIDKQYAEDKDKHSDTEEQYEAWQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DEVDYSLSESAERNESSKALEADLKETKHERKGTKRITRLKTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRSEEAEKEIREKDTVTRTFNGQTVTVDARSEEASKRFKNIAQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SNDELTARLLKKTQDVQVTENGETKTYDGNNKDKAEEIERNLA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERTNGNVELLKKDEQVNLETDGTSTEQKAYNKNEATDIDRKAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKTSRVRTKFSNAKKSAYWLEQVEVNVETERTAKELLEDRRRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKRDVRREEAETKVEVSWTERLLTEKTKESVKAYAFNLSRNAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKEEGYFVRYATNKGSTEEDAAEKAKLRQRETRYKGTKIQKST, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.350000023841858"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDKNQSALRRLEQETNDMELKGAEVTLKQFESTTNALNAPTQI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6100000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKKEEKAVRLLESPGSEGEAADSQITVQNLEVTKIPRDAEYRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RQEIQEKAETAFDKRDRDKQGRERPEASTSENKAHRAIKTEVQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDNRENVITTEAKIGKDVEVRRKENREAPSNLDKSATETEEIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DETEKEQEERAKRINRVTLGNEEYSRSQDPKKAEKAAKELLEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ELAARLKEEREYKRAAESEDEKITPKKTSEIVNQEEQKRNDLG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEQNERLIRWARRLGGRWKGDARKIKIEKEKLTDDLESQNRED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DEEEKLAEKFRKNANNQTVTDGTETYSATSEDKAREWAHKYRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDTRSGIERFEEVRNEDLRIEGDRRLYITEVSRATNGTKEPNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.059999942779541"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LYKAKRKTRAGTGEEEEYTRQERTADVVKDKKVNDKRQTADTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SESEKVRRAAESTTEYEWRGSTTLRVSSSNPDLIEEAARRAEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DSERRLETLASETEYSRVSAERSAEPTSRTWEVAEKGIQNARS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QRDRTEAPSIFIERIEYKEDPEGKELKKKSGSANTLSQDIDKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEDEKRTFRTGPKRGLRIKGELNESGTGATKQDAKKIAEDEEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEKRKETPVDFGRTNSKAKRLSKDGDEAKREVKEAQNKLDKEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RNKDKVTKAEEVWRKGESRATQAVRSAAKTREREEETNRKLVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AGGKTDIQVLDNEVNLDNEAERKERNQDERDAKADEIEDKKRI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AYSEKRAWDKAVRAANKVEVEGEDKKEEDKSKPNNLGKTLDDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TTKEDNEITKARTEKSKAESAWKEAYGYNELIKKVGEKWESQW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TRKNNEVEKEAKEKPSTTVRGTIAELESIRGQRLAEPLDEASE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RREDTAIRNQPEGPAVSKLTEEEKELAGLKKTSINRAEEESVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRENRNKTDFREEPQWFKHRNEQESTEKLERELTPSAAKQKKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RFKANSRKPTNREPEEKRQLNLTAFQSEKENQDTHEEKRWRKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDIEQRWKKAGRTIAEGTGERVTLDAQLRETETGKEVNKNANI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SLRDEAQQRLKDGTDKVTISAGYSVSKSLSPKQIKDNAEKAER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SAQYRDKASEQTAKPSQLIRAVKRNKEDDEISLDVGKGKSLTS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IEEKRAATGDTDYNRREIKRKSEREYTFLIASESLASLKVLGQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PLKRDDWLHALKAEKYRQGQAFQVRNNTPSEEKEATKAQLKGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QEDKKRKAEKTRQKGTTLEINGDKVSASDEERIKEIQKEAQKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEKTRKRAQEEDRSIDKGKAKIKEIKVNQQETGESATKKLKQD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NDSEDTELIIAGEAKAVGIETKKEKKKRTKESRQDKKQQERQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.850000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKSYTDKTSDATAAFDVVANKFEKERTESRHGTEKGNGPNEQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NKLARTRVEKNEKNENRAGSKFDDGYKTEDTLTKENEKVAAKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IVTVGHSRADQDNATKIVVGENASVKKTADNKRREDKKYEEQN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.309999942779541"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence APNKKEGETEAKRKGNVEVTPADIRPITRERKIKEFVKKLRRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IVPRRPVAKTKEEEEVKLRPKKEKIRKRFGNETEAIDRAGKTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKFADSLDEKGKRLANKPNAGNAKELSPQEEENKKTVESTVYR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDAIERKVRYKETYLGGHKKLKADLPAKSENLNDENATARTEP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QGSIEKDEFRQAARNRDEDGEFTKKVAKALRSKEEQVPKSYRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDGDEKKKATAINDQGAIAERIKPARVQKGFKRDIEIEKQNDP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QEQDEKWFKQAKERKEDPTGVREEVTLASNAAKKGRQRREEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAWEDRTRGEQKKKLQEKSGRTPEKFVEAAERENVDRQKEEAQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENKTGYQARKKDADTVPAPKVQKQVKRGEKGQTWEDKNLEALY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VETSWLDRQARTEESGKLERVKRTQVVTTSLEAADKVLNKEKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LEGEKKDKEWISFDKIIAEAGIRRVRNRGVQLTEEQDKLTAET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QSETTVIEDAAKKFNQAERQADSEGSGKKENATSIFTSAYKRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SQDEKEELKKKAEKLERIRIGNLEYTVKSEQDSREAKKAAESA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ELRIAKKKKETSAQRVDERSKLKINQSEGEKSKADELYEAAEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEDEEDKTERKPEEGEPRFKVVNKTAEVRQETRIKKAESDVNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTEYEETLKKVADEIRDISVGAKKSKGKKKEGREGADKVDERI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.02999997138977"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRIIKVKKGKVGKRGDEAAKDEASTLDTVKKKSGEEREIDEYE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PHVQQEPRKVNENKTDEKFKQKADANPSEAYRIEEFEELLKTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKAKEPETLKDAVVSEHRIENEPQYKFNKFQEDLPNKRTRAEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKTEDAVKKLGEQKKKVEAWAAEGNPKVEDNGTYELSRLVNTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RQQNTTKTRGDRKVEWPKKERRVEEGSAYSKKEEETVTTEATG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEEQVRAPEKATRRRYKGEEAQTKGNFARWEARYREEEATNEH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TRKFAVEPKYNNVKSTWENTGPKAKVYAEDVELKNEDEGKRLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EESRSDVTEKAIQSKKKADLAGVDPKPTRLNVTKVEQKPTRNG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NSKGRDDQGLLKPGEKKNVAKAQEKARVRVEARPKEKSYHTFV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKDAKNQAKDILTNSEKFEVQGTISLESEQLETIRSVAEPEEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PAKKEEIIQKAPSYLVKEGDLVDNRADGTSEEGIEKLTKRAEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.169999957084655"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YAEVAPIIKGEEGLKLNDPVLIEAEVETGDESRDTKRSQKAKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VYEDKRAAESVEKAAKDWKAEPKEEEEYRSSRGRDRATEGLKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KYREAKEDLAKEGVEAQYGVASKDSPEERDEREEKWRAASKTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IIRDKPEERVSKTQKVRIRGKIIRASAETHETTELNEIDQVVG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKTKDDKEFKSRQETRVNVKVELSSGEAKSYPTLKKKISKANE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YYVENLQKKASKKALKKGRKETELNLEIGSKRLKEEVREGKKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GQKAESLREAGEREDNKTHPVTNYAKVDNVSDYTRANDKREEP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8199999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NNYQLPFKEREQTDENPVRSGGAKNLSLEAEKEAVTTRARINR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TVGKKKEDNTEKKYGYEANAEDAFKKRKREERARNELKAGETP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TEKRTDAGKKAQESQEKAEASLKSEFQVREESPEQLEKELRTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YRETNNEQEAERRKADKVEPYYEKNEKKVRAKDPVKVLITAYK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KETRSTVETKAAERSVRQDQVAEGELNGKRKLEEYWRDKNYNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VEKTYATKAEKNAERDREVQEQVGNDETSERKELWSGRLNRKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DEDEERAERAQRNNQPVELKWRGKRTRVHNREEAREALREYNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QDDEDKDRKKAEKTYNTTTTINGWTVSVPSDDLSERVAKALHK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKSWTVLAKVFYQNEEAEFSRTTKAEYQTNTLQEGAEKADTRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NDKYQKGEYARTTAQAKRELTKTQTAVEEFFKAWEVLNATSSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKESEEKAVKRVQEGGKRAELAEAKGEIRKTDKDTKLKKSERV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNYSESEAKEKEYKWGSEPKILKARNSTRRGLKFKQVKEKESD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LVEGKSQEKKEIAEESKTKTRSIQKAEEDYITQDVIDAGNRTF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NDQERKDIAKKIKKRRVKVGNQSYEGVESEETAQKIEEALRRL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETEQKSDVGQQIENDEVEAIRKRKELISRERRAKYGKKLVKNA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QYGLRKSEKEEDSALEENEQKKAKRTIVQVIRGERRNAKKDVI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NAEIKDWEESKGYEAKAYLIEKRQQADARVREKIGKVSEETRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKKKVDLSIRKKFEIAEVNELETEKGPKRNETAAKNNATIQRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDKKERKEKEVESGEKVSAKRENAENSTSATRAVEKELGKPIL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KYEEARAASDGRDEYANDLDVAKREGEVQQSQKKERVDDWKQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NNAETGENERFEAVDWTAKKKKEKYYTSQALTTERPKPERVNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IEGEERAEQLERQGEKNKKIKERPRAAGRTYTIKEVASEPNKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DDYRAFARDKDNQLNDLDTNNQSRKREKADNNEKLEETLEKKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.320000052452087"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence FTGKTRPESEANRKSKPKAAEIEAEGRIEVDRKKRVLQTVQER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESTRGAETTRVRIAKPKQESERVFRENEKQLAKPGDIERAVKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KIDEKRAKNKVTYRLRQGTADIDKEKGQQEDKLKKAPDTGAQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NKESKRFNYTAQEETEDRSLATAKGSGDKLNLPEQLERNPTKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKRAVKFANSPAKGHPKADRKISKVEIEGDYFNFDQDTTEAYG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENKISKPLRYLQKRSETAKYTVAEKEVRTEKIADKGDEIANNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NTYKDQQYYSEETVGSAADEEKTKAYLLENVLRGAARRELDDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8600000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRVKYKDVKKKAKAGALKEGLSKDEGVWETTDDNEVSKQKARE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKEEDFKDNGTSKTEAELEKPQGKVTFTIATERIGDRGKKLIV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDDEKQKIEDKASNGQEVRVGNYTLKGASTDEAREAIKRAEND, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKEQRFESRLYKDATQKNVKKRPGQARAATENVIRQLGRKWES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DAREDNEKAGEDAARRDRNSEYTLEVNVKQDEARRATEKPKET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QEERRGKTAERNVREPDNADRRVSDKADKATEDAAEETEKYLN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QDRERAKKEASKTDRIKWNDNGQEEELKVTSEEDAERAARRIA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.699999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSKERRSATERVTQKENAKFEGKYEQFQDDKTAKTGWDELREA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence FRFQEWYDTKTAKKLEAQDKKTARKRKEEQGTEGESAENVSDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDREEEGGRNWADSAEKAEWNGEKFKVARRDATKQRDYKDETS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DDKVSRKKPKKPTEPFRRKKISSTLSVEEGLASTAVELQTESG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RAEKREEAAKGAEFGSGRGKLREPKGSKKKKLIKASELEEEIN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRDKTEWAETGNKTKYEAKGVEVSAKERNLDKVKQPNREVEDV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.080000042915344"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PVESDEWTVDGVANRERATEDKNEKEKQTNAGYLKVKKVRKEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.399999976158142"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NTKNAASLEEKIDKQSQDKVVAIKTGTEKDVAAWGYGVSVEKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AERSVSNAEARTEDAINDKEEQPDKWEWWKKRKQKGNWPEQLK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAAKGHKEKERKRTVIARNLDEEAADKYAREYSKFVGSEKTQV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.699999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ANTVEELLDSPKETKKRVTGLIGQWKWEESTPKKRAEDEAKTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EIRTKKTDNSELEKTSVVKEITIDRRETATEELENGDTAEAKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TERTKEAKSWQKKENRLELEEFKAQADVQTKSNVKKGNDERES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ITPKKIVTEAEKKKEIDAQGKWEQESEPEEKKIELPRLTAEHR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RVTSEVAKVLNRNEKQYKKTTERISIEKKDASLEKPYDQEKKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SKETEARERAEKQNTEITVDNQVRVDATNQDQKEEIKEREKKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TKERNRPSKDVNDSGERRELEFASASGETLDKEKKVREIPQEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EERINSEKKDEVEELGPFDLKSVRQEPAATSNESKGETRKRDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TREQEEEAEDLQRESEGNNDEKEDLRADEKKLARRFKKEVKKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKQKNKSTEAKRKGSEKEAEVEVDRADWGKTESWKEWIYQYTQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDKRRAAEEALKKGQKISLSAGITVSGSSKDLIKEIQERDERG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENEVKLPKGPDQKVKKAQALSYYGRDGKKAEEAYEARKKASTF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDKKKYLVKEAIYRDRKRAEQVNNKAREDKEGVESVRSEASRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NADKQEERVEKSDRRDSKKLEERIVYAVREANVNKYGSKAKER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.350000023841858"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ANKEKKEVDKYLKDSKKVKLVEARGDEKQGQKLTTIQDDPKKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.870000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TVEEKDKTNAFALQETQSDRQAKWVEPSTAREKEGTDRTRLTY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKKRTKALYYVYESENEADAFNVEVTATTKSGEQALTDTKRQA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IEQADVAIDEEINREEAKEAEERRNATRGGKSVNVSRREKGSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TASDRGQEKLRTKEQEEAYADRVKLRADEKDTTNVQTVPTNLA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAREEKSQDRYKAGAKTKEEERSKEVKGGVNAKENKLRRPDLL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DEKRNTKERAEYNKEKEEIQERGESFYTAKNESVYKRADDFAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENSEKTKQSYRNKIERFEAKKNVYDTERREFADDEGRYAKAEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LGETKSDTRPKTRVDDRGEIVKVKAKPEKKSTAERLVYLKESA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EELRSGKTEVRNAYESTNITLNVEEARDEKYREARDLIYGAEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKGKKAVNELRRNDKKASALDEELEGEASSEKPKEAADKFEYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERINARKKSQNINYERGTTQVEEIEEEKSKPRRWVKEDASDAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRRNEWVLDAALSEDQVQDVEKVKARKEKEGEIPLDQDTRKKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EREEQLPDELAEKWLHQGEFKIRDNAQGSQTEAQRELESAKKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SAEIVTRNNAQEEEKLSDGDSESRDDSQSRGKLEDRAWANSVQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AVKVSYQKAADSEDKNPKGTTREFWEQKQFEAERDERKTLIKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEKQEVKDKARKTGLTVRRNGKEEVTVSGSESDAEKAWKAQQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KENDWQKGSEARTAKVKEQVLTSVKARSQSDGEEGTGEKRVAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RPYEEGEEATSEEPPENKAQAYIDRRELKEVEAVHRLKRAIYK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKSTKEPRRAYREEEKAVDIERYGAHKYEQPLNLVIAERAPEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKKKEKREKEKKQNEEARKAFLEADVIEGLKKSEDAERTREKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKGGEISKLKFTAADNQKPVSKKPLNRTEKDKEVVGESKESEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8999999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GANAEPKVYEGIQRAKNKQTEFKEQDAEDKQKARKELETVAKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SFRDERKTVREKKGREFPEKQEQDEKATTVDTDITEAEATAKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEQDSKEAERQAKEQDTYRLGPITVSRSSSEQVRRAKEAARNG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRKKSNEASRYGTQRESSQAGLPSIRETDERSVEDVQRAAEQA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence HDDDEKAWREATKQDTFRDNNKREVTKGSDNYKKLEQKIRDEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.910000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GQRKRKTKKDDVRNEEEKWIFHASYDDTENTQAKLKDDKRNDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DTEEEKEAKKQVTGADKKETRKGINTGYAQESQEDTTVYSGAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GRESVTRKGDHVAELDERLELNRVKSKKTETQTNGKALKKDDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETKNSQVSKRTKEASTEKYELLTWSGEAVEKAKGQDSPRRAES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSESASENEDRRKQRKTVYKTSEKLSEGLAAQWEETAPKTGSV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PPVRDFAKEFKTQGTLGRLSEAKETADIESRYRATTGKERAKI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKERDETASELARQEEKLNVQALKPSLEKATARKLLDRGGETI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TPEEKGRKKFREVFREVRPTIAVKYGKATEATEWEKPDTYATQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GQDQAESGVKARDQEESEPNLYLERRYLNESKQVDEVDTVRYA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SRNQSVKTKAANKNAEDLKRTKQIEADEYDNSIEKELDDLRDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDLEKTDKEDNAKQREDSNLKYSSRIVDAIENKAQAKLTNDER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDAEKEEKKAKKEGKSTTVESGNFKITLASREKAERERKRWEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8399999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SGREGKAKKKTKIWENTLKEEREATAKAEKEAVDSRSSREFEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PRNRPNNSLVTYPLNYYERRRTQKPDGAVEVSAEEEAKDKAED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.509999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKSKSPISDVINEVAKRLKADREKSKSAEEEKAYTPGEDLEKI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DVNERQAWTTAVEKNKDKLDERGPQAKYSEKSASQAWKTVSKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NQSVSKAATELQYKTATVDDDSEREVERPKKKQWAGWESANKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.980000019073486"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEEKKKEASKQFQKYDELRLGTLRVERGDPSAEKKAQEAASRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SSRSEELKRRIRKLSSFTTNNNVTITNKSEEAKKRAEKQAERG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8799999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTREKAHKTIKETAQVQFTFSKVKGTINEETKAQEATELKRET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KVKTKQFKQVKFTRTQESEETETEKIHITAAKRKEENATAGLT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EARKSDGPSGVKRAKKNEDKETDRKTALYNKIQRVAKEITENE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VVAVKAKTDGKTAAMLQEAPKGPWDNGEKARKDWWEEKRTKSR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEKQYEEATGRDKKEGTAKKLSESKSNRFADKVVEAKADITNQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KGKRAEEATNIASKVSKGDILDDTARARDEENEEKPTELVEQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GRPVGAKDKLAEKEDIATRDEQEVKNITSLKSDTAENRAEERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEDEGPTEGDKATKTKDVKESTRERVAKKETIKDKLTRSDKVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.480000019073486"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRRGESAEQKISTNKQRGEPDFNKEILQTASESNKVSKSRLED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.049999952316284"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETEWYKVSKEADHTWVYLTEEDIGKKRTTKKPKRYNDSEEERY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TRKLKVRQDKEEIAKEDAALESHDLTFARNKKEKANRSTDDQD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEEEKKAEKERKKKKPRLEVNGKLRFEGPNAAEKFYKAFKKVH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKKHKEAKKRKEKREFEFKGNLKVKGNVLEAAREAEKFPSEPY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKEEVANIANKQRETKGTRTEDEVSLESKAKLNKNKYRKKAVG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDKRESKIEEISEKVTATGRTNKKLNNSEREVEEARKRATKEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KVKLDKQDSNIKGSRVRELKEESKKTGRDKKLEEDADDKLLYD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.870000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENRTLEKETTKLEREAYVDLWREYSDGWRGPEEAKRVPREGRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EGRGEDLRRAEREEERYPPRWEEYNTKVGVATWLESRKDLKAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PRETYTYDNKEKSKPVKTKKRETKAKLKESNVRSGKEEPTEPA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QNRTEKEGKERFEKKSEAEIVSKGKEEAPKVSKAKEAPNKNTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PREEETVKKATKTYKAFKGTVIESSKNAREKERPQKIEKVEKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTEHGGKNAEEHPKKINTKEYAEYVEARGSEVKSLKQAASWLK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ADLKTKPKKAGKNGQKVKVTSEPLKVKIEDLTRLENAGQRADV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EGTPILKDKTEKGDPRKQGVKQSKKTKRLEADVVLVKALANNA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKEVDTSLTKQESSLNDATGAVGEKKNKRLAIREETSTEDRVQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DSTKEEAPAQGAKKWEVPTRKPRKATLDKGKVEDWIKTAKQKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.790000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EGTEKWSDEGRYEDEPIEVEAQVTKNAKATRRKILSKASEETV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EERKSNEGRERWEKAEILEAKVRRPTKGEERAAKDALESEGNP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PSEKEESENEKKEREELVLRRAATWAPAGAIEGREKGREKNRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PETERRAVKLAEDLGTKVQIGTIQVQIDSEDERERIRREAEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IDQEQKPASIVDTVATEGRIGQAKVEITDEREERELKRELRRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RLKIQQVTRREDKGAPQAVEIREGLKDEERTIVSDAIEEERTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DDKSESLVQQGQEEWSKSDAQGERLKGRQEEFARAAWSATFDY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDEEEKLKKAQKSTGTKTLTSNGYNLQYANDELLERARKRLEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ARSALLKLKELKYTLNERETSNKNEYTGADQRKTESEKQLKDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.230000019073486"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTKRKNEEEEAANETRGVLSADELVKKGNEKELENIRQVRKAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NETLKEIAKELETKEKVKVGTIEIRAKKTPDEVERVKKDAKKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKKLEKVIKEVDKTTKIRPVKANLDAKKKVEEIKTAEERGTEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EIEVTKDRLEEIPKKENDAKVKIRVKKKKVTKAETEAVTKELG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.930000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKDYNRALAGERAEGVTIESDPELEAIARKVKLVDRETQTKTS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKKEEAPPIFSGKTRDERVKQKNTEREKAELEPINAEDAKLGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KLTRIVLGKAATAIEDKEKERVEPELEKKIDLEEKNGKLNAQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AGKKVKDARIDVRDEADDLKASSWNPEETEVRVSSKELSKEFT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTISHKANTLAETKKIGKASVNVRDLNAQTQKEVRDLPEKITE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.810000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QERKSKAGTIKVTAARKDENESENYEVIEQKKAKDDNVLATEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.230000019073486"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKSNEQAEKNVAKRQKNPTEREVRGSAKKLEAKETVEKIKKRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSKQRAKTVIVGEDSSRGDNTAADTLITTDLYTVRGKNKVSVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NQSQRQGFKRWKEELDYPEYPDGKAELSEVKVNRAETKAKDRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDSPLVYKKNKDGEYDERLAQWAQTKKFRREQSGPARVNQEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.7100000381469722"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAKRTEQTEEAETKPQRVTLFEKKVKPEREQDLRSAVKLGNER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AQAELEKRAWVEDLKKSNKTEVERVQNTLNRNTEIIEKSAEPP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8600000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEFSVEKLDGVAHDLDKPKNSSTEDLSKKADNPAYYTRQKSRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSTLDGRKAREIKPSYKEEEDNTEEVEDDRRVRKATRAYTAGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QEKEVDALNELTEKLVDVRTKKEETRIVEALKKRANVKEANNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SQRDKKTESRKAREWGEKAEKPNESARATSEYRRNDFEDAGKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNKKQLLKERRPKEKEKKPRDNEYEDKSEAKAAAYVRGNEKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQSESRQIEDQFEERVEAEVEPASAEAEQKKKKESIVKLGKEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VTLENIKELETKAENETVQRRGEQGVSLGALDRKVEVKREKAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TKRQKGRDKPVETREQEAKEIIVVRAKQQSKTAEEGDSNEKSS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKSIKESQKEQTAISKQGVEQPEDRRETKRDENVASTRKAKEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KLKRRKKNSRIQQEALRLSPVKGEEQSAEEEEKNDGQEEINRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SREAKEVLDQVKTRSTEVSEAQIKAEINYTNEKNYPDKDGRYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YQYDREALEVVSSRQLDDPEQARWKANGKSASAKEFVNDRKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKFTEARRTAKRQETVAEKKDDVNAEAEKDESPSELPRNIKDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YKSEQGDKKLVYEAGEQIQSSAKINATRKTSSVSDLESDQDKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IDGKVYDQKTESRSASQGSKDSAEVKIKEKYLSENQDSLAQKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEDEEKYYPWIQETQWARSHREENPRARAKATRPSEGKISKAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NLRKGTIIADLWENEAQYSKAFNAQVNKKKSEEGENPTYASRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKDREKLQEGVRKPTPKYAKGPEVDPKTKIRNIESEAENNARN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEKEKKIATKIVKEDVENAEPELIEVRGRKKSADRTGQQVKTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKGRAAIKEVPKTNKEQLEKKDEEVIKAKDESIAGTTRVRKEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QPKEEEAKKIAKKTREITVNNKYRYKFNNPKAHEAAKLLLTEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDEDKKIKELTKQGNTTSVRVGNKEVKVDDPSAAEKWRKKVEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GQTTDDGEKWEKTADEKNVRPVKDSVNVEKPKAIERGKKSLKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKTKKKVEDSSKEKPRDTKNDVLVGRQTGGEEPEVKIDANWVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KERSRKVSRWVDNRLKAQPDGAEVREEKDLEELAKKLTETREK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ELDEERNLAKASEQAADGGKKEDKLQIRKVAGRQQRINGEEAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERRKKQTDREKKKKAIGRGEKVEVYPDRAYVEEVNQEPKRAEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AREEPYKENAQRKYEEGETDEVVRPRVDKKKRVKKKQKGAREI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKPAKQEEKAESAKARESGKENTEVSVSTVKWKDNSERREDVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YEDKAKIPGAEKQYEEDAQNSTRANNLKQFTTQTRRTRNKTPG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EIKEIDSKRKKALGDQDREEYKGRKKQAEPNELSKRKLSIEPY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.320000052452087"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDYKESEERQPRRQTHIDEARNESREDKTIKLAFSKDYQNGQL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.699999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EERKRLIIEAVQKGTEVTIDNRENYSASTQQAREEARRAKEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EETNYIIAEAVSEARRIDLTTRSKKEGNKERAERQVEQARQEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VGREIVENTKSNTENATDTTKKIIQADDARLKTLKLSGELDGS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EIRSDGTDDAFYPKEKRSREAGQGNEWVHADAELADVKREGNL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRKEYKLEERVDSDEEASGGREKVKAKEDVNRASNVARRTPQV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KYNNEAKKRRRDKKVEVVEKPGGQESEEVTLDSRASREDRAVA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TVIDTGQNEVSQLAKADFKTPTLSVKMKNKQEVDKAHKGAYEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKKRTKADKTVTELDGNWKDVTRKPQGSDVQRFKKAAENTQEF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LPEKYVASKPSSKREAKRNEENQQKPNPKKSKAYQDAYDTKND, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDEAQEAVQRADRNDDKLRAGKGEVKLLKSEVTTLIRKPQREK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEKKENGPRLAEKLGFEAKDEKRTQNSPIRRDASRAYDQYDES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEEAKTAIELANRKNLTEFTYGGRRVSLSSEDAKKLEKKLQNT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ARKLQDGFSVLTEKNAENLETAPKRANGEEKTLERIKSKLYTS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDSQKEADEANKRAPTTKRKNGYEFTFTSEESAKRAWKELQKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.680000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDFASKQETEKTENGSRNVKRYETPKAKEKEFAKDTASAWQLR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKQGDAKQIDNVQDKEPAVGEGGVKKGISAEKSKKRVKILKEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.680000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTEKQPKTEPIKEAKALTASGERINGEKKSSIKDEGKRAQESL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ARRGEEQKDEISKAKQEKSTGTKTEKLEKISSLPAKGKANIEP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENTRASSGVYGTKDFRKGKQEARRYDAWNRTAEDALERAENYE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence FSNAKSEEENATRAKGGEADDARTYEGWRRYARTNYVQDKERL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AINSEARSKEGESIKSTAIGSKEVNVGREAKIENDRKSTETRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ELGYPSTPAGENRKEEWERQAEANTEKTQKIEHKRLATRDDTQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TKPAKTYQAVAEKEKSQKLLSADETELWKTDTPLIVNKYQSRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EADKSLNEPKASKSDEQAEKGIKNREALYPIKFADKQVADDNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PPDEKKRQKLEEEGKANEYKYYGVTVRVATSELAKRTAKKLAS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GVTREYEEKAEERLKVTKSNSKVPKATLAQKKAPEYKGRYALD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKLKTADAQKRYEEKDLESSREKAAKKGRLALEERNEKALETY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence INQTAREAHVVIKIENSRNNRLEEALKRKRQDPRQEEKNEIRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TQAETELTYVKNSAKKTEAEKDLGEAKAVQQKPFYQSGDREGA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTDSLTEAFRQAQYVLKKAGDEPEEATYAQKAEGKEGKTQNSV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IENQNQKDESAQKRGRYKGEFDFIRWDATDKNRAERATEPVEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.3700000047683711"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEPTTVGKELVDEAKSLEATIAKKDKLNIKTQDKAQTITTLAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDSKSKFEKAYTTPEAIEENAKGSQKKKYNGKTPNDVGRKLLI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DETERRAQKFAEREDVEERALWDRARVKKKKKVKTAGTGSTTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YYETSIRKEPKERAKEDTTSIESQADGNNKYERQAQELASRLG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEQKTRQALYYESSAIRIYEGNKRTEKEQDRGSTNAELDSPAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SYESRIRTAYTEEYKTDVGRKGKKNRLKKEATAQEVDKREKIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EIRRASTEPQNNRQEFDEDTATKKLQARGRRQRNEEYFKNAAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDKKTKDIAKTGYEDKEFERIVAEFDGRSRTRTSYAQSAAETG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDSIKLAQEAEEKNLEKVTVNNNEEYRRGSDEFKKLLKAAKKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PENLRAFDYGKNESIDKVNAEKSRKKKEAKNELNKLAELVQET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EYLKKVAELDKKNLANRPESKIALEKGSEEKAQKDTENVRNFN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SRETEAEKRARTTKVKIEDNGDRVEVTGTSQDERELAREYWKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEEAKKWAEEARRKHETVTFEGRTETISTDDARKKATEWYDRM, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YKTIRRAFNEMEKKKEDAKATGEETRAETDHVTTSWEDAERRW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAKRHRTETTTKDITEKKAENDYTWAEGRFRWARMAKSEEVDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VRELVRKARRIAEKGVEDLNSPDGRLEEDKIDEPENVISELRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DISKNKSEKSDLAAAVKWSVELADQTEKEYASDELGREQKNDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SREEEKKEKKKWGTKPFTFRINNKDEQTYRSKVEAEDSARKAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QREKEYNDKKKFASRPWNARVKKESEKESKTNFTGKERIEDAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IKSEDKTKDRTRNATPFRKEENAENKQKKWEEGEKFSYSVKAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QAKEKGSAEGEFSKWSEEVNAAPKDRETGIRVRKLERDEDTEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YRKEEGRKERTQASVTKELRTKLGKVEEVVNETKKTIEEVKKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKNEEIRREKITKVSENINEREWATRSALGGNKAPEVVDKAKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKRNIWEQNAANRELLQALSSEDDEAKHRENPEFKRGGTAPKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDDKREKLKRIYDTTELTENNKERYSGSNDDLRTEAEKAKRKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.850000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKTESDYGKTLDKEDRLNTEYTSNKEAERDRLDTDANKIKRRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AGKLSAEDERAKTATTLDIRKGEKRTVLRFLDTAETQPGTERL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence STIAPAKDKKTNKDEKPIKQKYELKRVTAQIIKNKELTTVETG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TYYEAKNPNKEVKSDRENNVAEKTLRQKSIEDAKKAREIGETS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTIRESLEEKAVQATENEATPDIDKVAKYKEKRNENYSKSNRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDAEKARKDAEKNNTDKFTLKNTWNVRSQDKERAKKLAEKEKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKLKELKDKAEREEKTKAKAKNTASWNKDKRNTVTEAFKRDND, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IKKKRTRRRDEETNESDQPEAGKVTVEDNSASEVEDRGKKKEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IRKKRAENEEKRQTNGKLEKTPGREEAYFARSRTGEEAVDKVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKATEILSTFKKKVKAARPKKKAKVNLKESQKTERINNVVEEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VEEIDKRVKSLNEQQEQLNVATPEATGENKDKIKKARKELKEP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKDLGNKEKQTALKKVTARELVEIQVNEKSEEKIREPKQEDAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EIQEEAVVATKLSVKEIKGKREKRIVSNRKLSDSEEGVAEYKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKEKYTAQDKVEEPSTLELNSDQNGEADEIRTARELLSQASKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LRTEKRVLEKAEYKGKSISATLVTGDRPEKAVKDIEEKGKEKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YHKEEKPESKLDTWRYPTASKGAERKETVDTATRGKEFATARK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TETEADSEERWKARKARFLDAYKGRGTVATTEPKPSYKKKETH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEATKRAEEAAQKGQTLDVNGVTFESRDNPEENKKLKKKINNG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TRTVEAFQRIEDNNLTHLELPGGYRVRQESSQAQKDWKEAQKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNEDEDAANSAIEYWDNIKVGKTKKTEKQTRGNSVVTEIDDRW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AYKVDKENEEKDANKQTWNVTGRDESDTIDKITGSRIVWKEAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QWEEKKDNAHRRRDKVEEKRANESGEIQGANLRVDGNKERQKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QDLEEQARREAEKAGTTWKSNGVTITATDKEELSQRIAKQLKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VLGERQEATWAQIERSKNKLNDSEKKKALQETTTIQGRAEADT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDEEKIAAIAKKLGLPKYTQDGSKTYRLEDEKVKKDAERFENS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKSKKAGAAVDKIFLIKRTEELRTYRQLEKDKANDEPEEGDYS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ALKGSRGDEKEKTEQSVYKYLNLRKDKIPKEAIDRAAEKTEDF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REHKEAFKETNLDDQKAERTESAYKLRIWDTSGNQNAKATDNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.299999952316284"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence FEYQDAGRARAESQAQDNKREVSEFGDNEKRDKKQDKAVSEKP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKSAWRTVREKSPKVKARPDKDFLWKTAEEKKGPLEKQAEQIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AARNRESNAKTIKTDAVEIVREGRQTYNLKEPENEENSASRGY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.769999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TVEVTQIIRNAEREERREGSGGRASVKATQVNSPDEEAEDENA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence FAKDDVEKQKTLKREQDKFRKGREKVKSLLKTADKEENIHNGL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SGEKETDVTRSKTEPKKKISKVDTSLPKAGKLEEEGQTLKGKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKLKTEEDDKIEKAKRAAGVAKNLKNVAEEEDRLKSLLSVGEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TPKAEEAKKQEKNSETYTYNNQYELRRGDEKAERIIRELSKEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SIYAQYPRKNEYKKNRDTEKKEETGRELENEAETLGEQISKRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GPKRQTLSTEKGREAKEQESNYKAEETDLYEKEKENARIYRNI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DNDRIAKRARIAAEQRTNVQTLIVKEKTKESPLREKKIERNEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERDERKKAKNADQSDELKERKNRRAVIQNPEEGQKRSYELAET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRVYENLEDEVRSREKRKEKEQREGTRTAEVRQEKSNKREQKI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TTVNSETKVRQEAEIEAAVGIGRRSSELTSQITVTKIINDETA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SKTEEKPETNLKRQLTKYLRKKDRSQAYKDRANNSLTEKYEDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKTQIQDKEEAGEASRFEQKKEITKFEDKEKIQAEAYETIATQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEKAGTRKTVEGRDKVDPADLIDEESKNENYKKTTEQLKYTAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EELKRLASYFRNKTETVEKNAEDGKYRETSKSAKEAIDSATKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RYTNVSGALRAKKENLTKDEAISDKAREAATEYKKFSESETKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GELTYVIREGGKKAAKVDNELSRIKPSKTFSRPDDGAKKAKKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKEVKELATTLKDTKAEIELRAQKLRASKSREFKKGDKTVETK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DESESREFQRVVERAKNKVEGFGKTLKLEEDNAEELKSKIKEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTQSFTEAKEPAKRKLKGNAAFVEARSESLDQPEELLRTIKKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSKQEQDSNAEKKGVDEDNANLISGRVKSDYLGQEVIDNQENK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VLINGKIEKKQKGSSQQSYQNEAREKSDDAVEKNNGDLDEDNV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RYDANVAAPDTAGRETRQEERKQTGLTNIEIDASERTDSERRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PQEKEKSEAKKWNEAGNETNVEDDATRSKIQKALDEYTEKPKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GERDGAPEAREYVNANYQKRRVEEYATKRRKAEDVSQETFSAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SETKERAIKPVFSKDQGPEVATAEWHAEKTEITNVSRKKRKRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SRREVRKTEFQRKKIDQAAKSKGKITTTPEEKWNVEHAASVEP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKNPDNKPNKSKKEELEASIKNEIEAREENLERKKNVRTKVQV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRQEGEEKIRDNGSAKPKIAGGNRARAEFSEEGITEAFRIEQL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKKEKQSYEANEEQDDEKANAGRQYGSRKKRKYAEERFRSLEF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LSRVEELKDLAKGARRGREEKSSEANGNFKKEETRKESPAPEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEKETNTEGQAGKKAVEKFQPAYEAETTDQVPNQYRKKNSKAF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSDKESSDKGLEQVERATSPGAGEARIKRRDIEELRSQPEETT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GARYAKDDAVTRDEKIQEARRTKNARLLREVESEQNLKDLIKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RQKKKITKDKKEEEAEEKYVREGSDRAKYAEKRKGNRELYVET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IIKTNVDNKLTESDAESITFKEEETPNAKERKASDYLKKVEKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YEKVKNEAATKSDDKKLKSNEKKNREESITFAEIETLDPIKTV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTATNEIEELANDKTKVNINAKAEEGSFKKPKELKQVKRERKI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KPSEQPNKVRRKLTIKGQVEGGAEVEDEARVREIYEVPSKDSA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8399999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KESYRAEKRITEERHISTEVTKDKSVKENQSTGKSSKSKDARK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LPYWDLVRGAEKGLNKELSPGLPEEAKSKTAQRQESAKKVLRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VTIGKEGENQVDKKRERKLEGAKANINVLQLRDNEKGQEPLTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKQTNEKEQAITGNGEVGREVKKGNLNVKEDALLPEKDARIQL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IAELDSSKPGKSAEAFRTHNAKEFKEEVGYLKEKTSKNLTKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RNSEVSAVEQAEKKDERVTLGEIKAEWKYRDLAEEVRKKETTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RSENRDVDELASERKEVDINANKNSSKEYSGKDATQPVSSVAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKTGEYALDTIYNEATEDDRIYVAKVRLKTLKSVKQGAKTPVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EVTKLTYKRPKAANIDKLTLKKGETLDQYADTIVRGVEYAKSV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QDEETERANQEIAKGKTEVTWGGQNYTSKNPRVKKEAERARKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQKRADVGLSWAKEGEEVETELREVYAGQTQFREAAESPNQWA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SQLTWVPVDEEAETRVKEKQGNEGEAWQKEEGRFAARQYAASL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKREKKKLVDYWDYAEKKKEAEIRIKPEKSEAKEVGNEIERSW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EPEKLRQAAEEAKQKDEVRVGNWTFSGSSPDTLEELKKRAEKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESSYARGADDAQQSSETSREWKLVEARNETSEAYRSVNQARDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GDAKKLAEKLIRNGTTTITVGGSVKIEARNTDEAKDRAEKNAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKGTKIVKKAGDELKEEIEAAGNGTINARSRNTATRDVDKRAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAARTNRIVLEGGKKEIAKTGTNDDTDIANKGARETRLASKEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REQNKELSSEADNKTQLRIGKLDVRKTLKDQTRSNISEEAVQA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RILGKSERLNEKAQDESQRKRQNTAKVDEDLEATKSNVQLITS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.009999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEEKRSNEASNGTERVDRKAESRKELLAEAKEGRVEEFIIAAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RSTLKEARKTLTDEKANIDGANTKAEATEERSISTIITERNEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKETKELQRRPSKKKELKLAELEGQAKKEVKSAKSDWKEAVET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEEVDEALDNGYKPTEPEIGSKQLSAGLRNRIKKEAREREKKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEAKLRLEKSEVDGKQEETKAENKGRIVRASKGRYLPEEKDNI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKSLDAVSNAATEKNEIKLTETRRNRITNERRYYTPSDIREEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.4900000095367432"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EITVEYDESRAEDNINLKEAINRTKRTRREESTPYRASTKLEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDETQWVATALDDQKKVNVSKDANITKEREQWKREANSVNERL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LRATLWLTEREKRNQTEDIEQKDGKAKPVKYTAEYAGEGQEEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.810000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IENLRNIRKRARHKREEITKEAINPEGEELRIRRRLERGPETA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GERAIIGRHPREETKKNRALPIAEILLRTERKNERENRRREIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7300000190734861"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IYLEGAELTLKYARVGTQQTTLRLETLPSTEIKLEKDKLENKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.049999952316284"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RAVRRRPLKRDVEVKKNVENTSLTRNKEKLDDAKIEGDPEDAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EIKVKAERVDVRGEARLREKIKQENNARDLKEQTKEQDGDEAS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKKAKQNTVFGRPYLEKQAKELPADISEKNEEPVKDSSKDAED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SQTTKEAVEEAQKKGLKSIKVGNVEVRLENEDDRREAEKRAKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEDEDEALEEVREEGARKARGVQLTVRIKKEKKNSSAKKQVTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SSDEKKKLLELAKKKKKIRVGNTEVELGSEEAKRLEEEVRREE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8999999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EIGEKKGRLENLEVEAKSAKEEKLVTEKSDRLKVKKLEEESRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEEYSNGTEEKAEKLAKDIASEQVKTDYWLRARRAKKDGRLKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EVSKKAETTGTHEDGKYKDIVEARKGYAKKSSEAKNALSEAEP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NATTSSPGEYYGKKEKAAAATKKSEVSVDLEEKKDAIEEKHRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EESKRDASDQLKKESYAQATKDNRRTENRVKEIEKAMRPAEKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSKEKSDRLTSKKTEIEAQLTLLKADGKGTRRKTIKNVIENIY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKDSRKTYKKKKLGAKIDFKSNVEGKDVPTLQELEKRWDSPNP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEEKEDLSQKAEYLLKDLKVKGETENDIQSKRARKGSREADKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.110000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NTRKNQGWVEADKDKQSKDDQVQKEIRLTKENGDYAARTKREA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.829999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TIKEATARTKQAAEVYSLDGNNQEVKDDDKKNQEKQRKRRGDW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDEDKKRQEKEKSNPTTVRDGTVEVREKSSEEAKRRAEKLKRL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKKDELEDPRRTERRESVTKEQKTKRKLASEDKVVENAGSRKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEKDKKLINEVKEQLELREGQDKFKIKKKKNADRLPKEPEKTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENETTIVDQAGKEDKRVEARASNKATEREKSAESVFKSAKKTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKRSKESDRVETKLEYDRTYVAGVEGELSTKREATKEARETQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LSTERALAKTEREETEVKRQTDDGGYKTKGSRSVVRYEERKAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SREDASREAEKKQQARLTTEDNGETYNFKSEEFKKKVDNKDKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VPKQEKAEKEAKKGTTLKINNQLEITPGSDDAIKELKRQIEET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTKDDAFSRPVSREKRGDAAAGTKAEVNESKAEEDGERLKRKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GLASTDEKSTEESGDARRRGFRREAKDETAAKANEVKKVKDPK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DDKEKAERLAKKYDEVEFRSNNRTVRVHRGDDQALKEAKKAIG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YNVRLVADRVKESKADTQKRRKEKELAGEEAKDDGHFKDINAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKGSAFDEAKSNRKKEKNKNARTKTKYEPASTEAPEEKKLFEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NIQRVEERPESTLVTKAEKEERNQADIKDSKEEEREAFTTPGV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.059999942779541"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TAKAEGKFTVRELETTVEVDNEIENQPIKERERRKQSDSPEAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EPDEKKAWEAVQLGRREVTNNNQERWRTESDEVRQRAKNFQKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DEEEERARRAEKEGKQVTLRSGNYEVSRPNYKEAAERIKELKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDEENLERKARKTSLSQESNHSKRVKVDGSEEAIKEYIKAWKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence FKQVNKGNRKIRKPGVSGEPSVEGKLEVKEASKVTEADTDAEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GEDNEKEKKASAAKLRPVSVKEKERIPKVDVEGSVNTGGTAFQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKEAKSGKQAFEEADRATAEINVDSITGEKEKDGTQVKTEAKF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEKAEREIRELAKKQSTVTTYGLNVSSSSKETEERASEKAKKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEEDAWKEAKKKKTRVEVREGNETRTFEYGDEEATRRWEKSQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKETFPRKATEEKTTVEARDGKQSRKVRKWEEEAENEWRDEKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KFTEKKQKGKRESTEDWERVYAAKRGAREKEEEPDVEERWTTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKIDEGRHQSRSKAADWASEKRTSFKVKREDDVRKEKLEEEDV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ATKKLRQRKEALEQGYDIEPVRTEKKAKADKDTEDLFAKVLEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQKDAENKAYKGEEKLQRQKGSKIARELIVREEEAEQIRDELD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LQDAIRAEIEGVKGAKRSEQEEKERLIKRQKDEKANEQLKDEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KESADKIAKDGLYTAKKYEEGSQKVKEKFAKRETKQQLKEDLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VRKGKRKLKKIAQRGVQADNLSDVDDRGLEKERGNKAPEEIEP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RVKRNGEDPAEKSKIQKLLNIQKLAGGRAKPEEGRVKEDDVDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LSKKNELAERIAEDLIKGREGNEELEDIVPEKKKLQQIARSPA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NVKPAAQEEKGEQKILNREREIESESIKLRGPLKAAIKEDLLD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KYNLNRPWKKAGERSLNLTEVEKIIDREVDEPKEAETIIKKLI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SQRAQKEPKRKIEKASDVNDLKNLAEEAVQERGDKEVKKGSKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRKKLADKRIEDGPNKENDAKSQLARKVVKEEAEKQKGSVEQS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PYLKEEDEGEKRAWEERTDEDKVKPRESVLRAIEAAIDLKSKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GRKQLKGELRRQLENEEREEDKKEIVQKEDAAEREWSEGRDRL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LLEKKIKELKEYAKQDEDELGEIKKEKNKRIKAKNRRSKGEFD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QRKEAENAKSNHWAREEYREQKGELGEDLLVDNANKRIYLEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EERYDEALLENKRYIKEEQAEEKLNKWIIEPREGRSGPERASI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NGIEERVERKSRDKIEQLKIPAAESSWDEVGAELQREKEKEVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LGEEKARSLERELSSRRAIKEEKSEILITGKDDNLVKSEVRKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IKRARKVEELGANSFYEKNADKPKKEEKAERKASSDVERIAGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NRDLREIVDELLREPGEVNQLKRWAEKGIAKANQAEELVNNLR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence HNKLRDLRRRWNYEADNNYRIDEGLEESERRDTAEKGQRTEEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VDSAEQKAQDGEEKLLEPKELTTKGEKVIAEKDELRKGPRRWI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEEKARRKWKDALEKGSDNELRKAIRSWEDRELEKALNELQNV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDEEKEGIKKPDNRVDSAREIKKLGEKAVERELRSLIEKEEKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEKENIPESASAKIVKKRKIRVGDEKEDEKEEDKLGELREGRL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.910000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EASKKLVANRDEKGYGDRSFEADIKRKGAEWKKNEDEAPSQVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKTEKRGQSDIDKVLVREEKARQAAQEAEGKEQKIRNLWESEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEEWENRAEKLVENLGKAKRVEEQLEDNLYEKGIRRAKQIQEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AQERGKERASDIERKLERKRLDYIGEDLLDEESKARKIIKDPG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GDRRELEAQRDAREKESEYAILLDSKKDRDEKPLIIKGRKEIG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.699999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKDEEKLAKKALEDLLSNKNPEKEGKKSAIEEEKIERLGQDLK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAKSPEAGLLKNKELELERKDIESKDNLEEGKKIDALKEELKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKKVEQLAEKGYEKLRDLRELKKGIEKAIASEETLEEIESKVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDRQEKIRKELHKRNASKQEAEEQARKDGLSEDVIEKYKKEWD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.200000047683715"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AQYIERKSETLKNQKQELEKAGKDVSDEAEEEILRKLKEKIRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NDENLERTGKEFGKTASRRKASQLLQKGALEEDNFEDAADRLI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TAREDLGGRDEQEGALQSEEATNEFKKRRSDIKDLFKLALNAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RILADVRGGEKESEIVQRDEAEDEESRRLREAPVTKKEGRLAI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKEEVEEEWEKLGERLKDRNIREAPKDLAVRKNRLKEGRSEAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.139999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEKAEVELKKAKEEGAPRDSRKRGVRRAKNRELEKWEDNELIL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NDKKVEKRIKKAVDEASEEYAQEALKRLLDEKRKISKGGKEAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence FERPREGLEDAARQLWKLRYADKDVEEKRAEVKEWREPENKRF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAKKQTRAQTVEEKLESLYEPNKPGENAGRREWVEAAKKDKER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.850000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence WKKIEDSAEKIAEEAGEKEKLKELWEKIPGNREKLRDLRESVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SKDEREKEKEPKRIAKSEELIELIVEKADELENGRDAWLKKGW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QESTELVPAKGREEEKEKRDGEAELKRAAAKRKLNEIITTFDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.870000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKKVEYPPQEAEKEVINKSWAKSQAKKEEIYLEKGQLAEKQSR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QPEEAEIIAEKSLSYEKAQEKEAPQLKKYEKKVVNSKRKAGQW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GEESNKGTKAKEEARARKDEPKEEVKREAAENSRLDKGRQNVF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GRSKRSETPREAVSELKSEEAKKLVKDSIKEYNKAEEIVEEGN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEPLDKRIVEYGETEKEKSVASSGRELSKNISNEEKVERKEAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.02999997138977"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEINLKKAKKKVSAAGEERKDIEARLGKSRAVEEKVPPKRIEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IELKNVKSDEKEENIDREEPPEKKAEAKGKQKKEVPKLDLTNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRQKLAYDFLSLEEKRNNREVKKGAKDLIADREEWEEAAKQAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IFGEAKYLARSKWKKEAEQDDKADREKNLLNELVEREAEQKAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QREVESKLKKVLKDLAKEKDVSDRGEEKAGRGNDVERPIDQLA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKENGREYAEDALSRPSRRRLTRGFREAIEDAEKLKEAIEELA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RERKEIERLKEATRPEEEGRDLFRELADILASSGAYAERKENA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEEKRNPIREEADKFAGKADLSALELLKQEKRRQNRDKIAESA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EYEAEDSIKDIREELKRTNKLAKIPNSKAGRGDEAEEVKEQAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRGAEDRESAEDDEALGLNQIIAVKNKETKRPEEIKKEEASYK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.769999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEERKERKEEGKANIRNKSKLELTLAFQDKPRSATRIIEIVLG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKFIANKARSEKGKALARGAEDKREEEEYDDKKKKKVLALDES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKEEAEERLKEIVEKVSRREGQSAAKEVARKSRLGYNATDKEW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VERLEEEKVEEVDRTENGKQAEKKPQALKKGQALERDRRSSIL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence WRKKVAEKESSELRAKTEIAEARVIVKWEGELEGVARKLPDEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SQLKSEGLEAVDEAREIEGAKEIIKQLAQKDKEKPKKPKVNLR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LRKEWEQDGDDFIERPSEKEAKEQPSEALGRAQKLRKANDKIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NNRSKDLKRGIEKAAAKKEKGKQLAQKVKVDDRDARSFFEERA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LDQDGKDDFKRALEKGKKKQAEKALEEAIAERDTGKSFAKKLD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RQKKEEAEEWAKKAQPNLEAENKGEHKIWIELNRGYEIFDRPK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VNETKYFFAPRKVGKLNESDKKGERAQERKEEKDAKKEEKLKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEKEGREELRKLFQNIEEKRGEEIAENVAASEKRAKNARRKAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEESAEVEKKKRSEIGDVLKLLAINIRIRRDEIRGEEAREEDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IVEDNNEKELKARNETDRKREKNETRKSIKRKELASKLKGVVL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEREQRKEKARLQLLGAIQGEFDAERYDSKKLNIEKSEAGKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8600000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKENLQKTLERPLEDGEKEKLQRAGEKAVAKIEELREARSDIG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKDEYKIERLNEELELKLKEAEEDLSDQAKKEKIKAPNSPKKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8199999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKEIESLLSDAFENLLKKSQASEGVKKVGIREDRVSRAIQDNY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKRELRKRAEQVAENAKDTKASRLAEEGALEDERIDEILREIG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEKRRPLEEGLQAASKELSNVKKTASKTLAKVKKPLRELNSRF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AVRERKKSSVEGLKPNLFRKSLSAANPTEKRTEKKLLAKELEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEEESKAKGIRLRIADLDATRAKKGEREKVELLELSTNKEEAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKDAEEGIKSIKERVLEAESGKELLRKVLASKEEAEKIISKPK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKEKKEDEIKKAAKELEVEDGSNRGKRRVSSYVNKDGREARDP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DREKAKNEAREGLERLEEKKAEDIGKRPLAKIYDLREAASEKI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DPRARKENKEELEKSLAEKDGKYELDKAARAIELIREIKERGA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDEKLEKSIAEGEKNEEPRIRLAKLFLKERRAKEGAINLRAEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ADKELKEKIESLFEDLEKDKAKKGAKEAIPNERRGENAAKKLK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERNIAKEAELLPSKNLDFAAERKLKAKDEGEKIKEKKAKEDKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDDEEEKANELLYKLEENRRVKKRGKRANWKAEDWREALSRAA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LDEDSNIRDWAKPFLPEKRKGRESLEKARIKAKELERAAEEKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KREAESQAEDAEKRPWKLKEISKGIQERIVERKYVKELEKSGL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VRIKRKDQSLKKKPKREWLEYAIERSGEEEQGEKVEKIESLAA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDEDREALKEKDWKESDLEKEEAAKQLKSEPILRGTKERRSKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QEDQERLFQQLKKENRSTEEIERQLRKAGSEDAIKRLKKEEKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.320000052452087"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKDQIDQNWDDKIRRVKRKKGQYDGESGALKEDYADDVKEKAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence WEGQPVVDKRQASDAKYRDKGRAKKKLIDDEIKNDDKDELGQY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DQNDKETADKITEKLIKSRDWTEIGESRAPRLESGYNALQQAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IDRYEENKAKKIATRPEKREANENLYDALIDFKKGDKPKRSLG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.829999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DNRDPAAEGNEDKKDKIKYRRERAFGKLIKIPKLAYEKSNTEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NKDGEKTLGDNALKEKVEKLEEARKLANDKKEAYAKKIDNSTY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEEEDKKDAESLLETARKKNLRKAGKELIAKKQRVKRGAESAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKDKLAEGLVSRNRAEGKKALKQLKKIAAEDEKKTEREAEKES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNTWDAEPQRSKLAEYRAKLLENQQKKKEKKSADDYALGAERG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence WRENAEVKEKERIARVEEIENGREFAGEELRARRKALPENIEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKKKLEKDAEEPAEEAKKNQINSAVKNLWLKGESGSDVLDEAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAEKYESIAREKKRENVESSAKLTKEKGGDRELIRDSVLIDGL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8199999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETDTLEELKERLKRKGDNETIKRLKEAEKKNPEDAERLAKKIM, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.039999961853027"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NREVREALEKLEEKAIKSSSANKAVQKKGIEFKEPSDGKERAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAKRSAVKGFSKPEILKLRVEENAENIQKSSKKEKREADGEKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LQKAPKIAAEPEKNLENYVGESEREAREERESKKDKLNLTRRI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKTKFEKKLRNVLNEVEDEKLNRIANRPESRKLNEDADKAEKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKERAPNEEKNLADNLKLNEERKSGVEIRKRVFKNAKLDKTEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LPLRIKKAGNNDINYRKEERRAELSPKGEIEDEEARREAELIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKQERIVYEAQDKASGQRENGRRAYKSLLGYEEEIKSRAEDKI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKKAEKDPSNAESSAAELTRGVKKAEEELEQYVAEYGQKNPND, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERREDRQEEVEKKAIIKINRAKKLANKGAKEEGNNKGREKIRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IRVRAKGNREEGEAEQKRERKKKIKIEEGNNIEAAKRELDKNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LEKLRRTKAKEQKERRELERAAKEELKGKKYGAKKNDAAENLD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKRLESNLEQLRRSIEEPDKIREIADNLLLKYEKAKEIGSKGD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKQEYQLEEVGEKGGADLEKISDLLKDLAAKPRRFERPVEQAQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EESEEVLEIPIAGRKEGREQADLKDVQGRNADEKEVRIKAKAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDDGEKLLKRIIKEAVQKSDVEKQLSSAWGEKERLRKIGEDAI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKSGKKAIKKIAEEANNDKEVSDLGEQALIQSEELKRGKKRIL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSEKNAQKILREAGFEEFRDGVREAEEKLQSKDYAEKALRRVA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VKEAAKERFKVQILSAEENSEDARKGELDYKKRAQLFRAERGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NKEDPKGREKEERLEIEQKSIEKKVVEEEKKNARELEAEDGAA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.159999966621399"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEWENLAEEEAKKKGQDPNQVKEEAKRDEEKRRKLEEKYRKLQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VERSKEDAERFRSRQRKVIRAVLKKRAPEEANERELGNDANEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TEQREDRLKRALSRAWSDDEAEKWAKKQSYKKGQKAWEEAEKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKEKESIRKIIYDLAVEKKEGDEGADRKARRRADELLEKGEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GDGRAKLEIYKDEELKRKEEKEKDAAELRKVDEIEIGEKARSR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EVDNQLDNKREKIEDKFVGVPQVPQARKLKQADAISIKLENLG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KELKESVEKKIGEAEGWKLKDILNKEKPSSKIAAAEAKEEKKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDQKEKAARRIREKSADKEKLDEKVSKDLPNGKQIEKLLRRAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LLDPDGERDKEAAAEEKLARRSLLDREALRKGLEDKEAKEWEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RREEEQGREVVREELAKWYRAKDILKKKIEKSALEGIQKVANK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDWEELAERIRKKHPGSELWKRIQEAQNRGNTQEARDLAKKWG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PTDIKEDIEEVVDKVLRSKKFKENGEDRPARIKKGDNLQRKAA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EIRLSAFKGRDVLIGDKAPPVEIEKKRENKNARDTDEKQKDKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERRKTDEEDEQAAKSREGRKIDGALVIVLSERANLKEKEDLEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SKEQESGVKELVQQAGDLKKIKDAGEERAIKDQAWNQAVREIP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QQEQDWKEEEVAKVSIRGAKQRSQKEKNGAEIDAVLLGIDPAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKSPEEKGDSEEKDEELEKAELARQNAKNADIKEIWQLNWRER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RYPENEEGRNARYDRKILRLRALKQDDKDEEAAQKPSLLGALE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKDQQEKDLNKILEDWRQKTPNEAEKYKGNKSAPKKLNKSLEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LTELAKEKAQVKEEKASKIESKGKIKNKLNKIEDARLREELRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KGNLDRGEQNAKSKELRIEEKEAWNIELEKKIDQEADKKVAAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ARERAADEGNAIRGEGKKQEVEYQKWSEKENKDKKAIRSKDYK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEKATNLIKNAEKEQAKADSIYDRVDNGLLKKSELKQIPRELK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YDRVERGLDNAENKLLEIEKIKSWAEKYQWEQYRQEKKLEDSQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERRSETETPEERLREENARELESYGRERLEERKELREAKKRGF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KELESREELRTLTEEREEGFYRKREAARELENGEEPRERSKRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DYSPKEKADKALSRPKEANDIEEAGEEEWGEAKELRRLRRKIF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.169999957084655"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VEKDRQPKKRAEKKEPEKKEVKEGIENVALEASKIKRALQSAV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8399999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KIVEDKGVKSDSKAQQEEEENPLLGNDKRLEAILRKKERALRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRKGIEGIERIKQKARKDDELKDLIEEGAIDREELSRIRDKAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRKEADKEFEQWASQLENSKAKKALDKGIAKGDKPKTIEEEAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKSSEDKDANEALDRANKERVDKKGDKNAQRDGDKLGKEWDKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKNARDDERVLSAEGKNGAELEKDSKDKADDKQKWNGDDRLKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.889999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KETKKQKLAAENGELEDRAGNRNRAGKREEKRDVKKRLLADEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AQEISKAARRPEQELFDLEEGEQPIEDLVDRKGEEEIQKRSRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PELKKLVQQAKDEANGNEDKAEKLLESRGNRKAREVLQRIRKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKAARRLDGNREDENRRKPSEAREETARELVEEERQDERLING, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESRRAKSNLQTIAKQADRNEIEDLAERGLVEDKKIRELEREGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LDKLREIAKSAATRVLSKENGDEILEKIAARETSGEKPLRRGA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EGALRRRKRKSNSAAIPKELALLTKTIDSIGGEAEVRKEELDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8999999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSLIRKREKEAADAKREGRSKSYVANLEIEEEGKAKKLTEGDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KESERNLRRKAEEQQLEEERASSLAQSLLGRKEERERLENAIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEQRGELEEEELERLLLAAEQIEELRSASRRKEQKARSKKRNS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKLEKERESIAKRTEKGRILTKKRIKIRSGAKAEEEEDPWKAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DDRRGAEDRDREAESGVNLAEREKKKEEVERDIDNRIYEEAKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKQAKQEWQDAEREAGDLDDVKSGIRKEANYKWAQWLKKQDKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.570000052452087"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKKKAELRNARNREERREVDEEEIQGALARYSEDEEIKEEQKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ALQDERAVQQILLAPKESADREKKLESKGEEQLREEERAARIG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IVDEDDYEKEAIKDKKRNEGKELQVIGAILKIRRRALEQTEPE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESKRRYLKKAADEEKLAEEREEKQEDYDEPKKKNGAILARDGD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ASYIPKAEKKLWEPEKPDTGKKIYEAVAEGERLADLRRLDEQL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ADQRFDEEGEEGGRDLSEQSLEKPAKELIARKERRREAEKKAA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RAADAKGRKIEEQRAEDGGLEKEPERSLERKEQRAEAFKLESD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKERVLGIKERRARWAIEAAELEEAEWKKDNERKKDEPRIEGN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YDKSEAYLSKLEERKEKELAKAQESFSVEGDEYRKASDTGAIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LEERAKDQAERPFRKLKERDIEEGGRSALIEKEEIKRLLNKAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEKTSAELRARKDLELREDARKADLEGNEGESIREQVEKDVAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEEKEDAELKKRRWFKAKREATPKSKIQIEAEEAENKAGGKLG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VATALNELLKADRSENPEGGKEARILIKKRFSDNLKPLEQDAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKKEAEKKADSALKEARSKEGKDWANKIELDKEKKKNLERNPA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VSKLNDGLRRLKEKIRRSEKLREGAKKLLADDRAPDELAEIIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEQKEGAEKISRRAGWKEEQLDKAAEKDWSQTESEAGSKKKDY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ILYEKRKEWEKKKESEKDGWQGEKRAASKEEQDAAASTGQDES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSTPEEEIRKDQKELESASKGRKYVRKEIPSAHQARKLKKKLG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GDRELNETAEELPDRLKERRADKGLDKGAAKEERLKRLTKEAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence FLEFTLGEEAENEKEAKADRARSEGERRYSEKKIANERRIEER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.810000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKEDGKKEAKNPLSRIRREKGNEALKYLAKQAQDAEQIIRTPD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEEDGDDQGKRAAEDAKEERLDRIAQEVVFRDSAARKVDKRLW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.790000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKRFKEEAESGIRNGAYIEKIENPLKRTVEEPSEASDALKKAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTLEEVAKGKEKEEIENNIAREFIDKGSLEAYRQSASPAPRKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LQEEDGNRDKGRIAAREDTKRKDNLEIRRIEALKAEAEKVPAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEKQKQGEEKAESLDLRRESADKEARKEAGRISRLEKIVEQPK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NGLEAARREKEFSELERKEAKKLKIETEGRRELAESVERLDKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AQAAKKPQEEWRRDAIDRNRFDEIGEEPFGRGKELKDADERNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDEAKKKLEDLAKGPNDESQKKKIAKTYGLSEDDVKKIDKKIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEDRKREAEKRFRNGEDIEKFKQQAQKDGDSETAQWAQDLQEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence WERQQQQGDQEFTNPQDADKFKEEADKELESKKANIARRGDER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KGKANEKVSKKRREARERKEVGRELAIIEREKRFSARNAKILE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DEKINRRKERAESNKVDAQKLEKKLKELWKDKGAHEVNEEEKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKNGEKAKKAKDLKISKLVVEKEELKKERGADSDSLELRNEAI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SLKLDERREQEQERIADNDEQIDAAIVELTSDVKRERYSKKNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKEKEKKIEYEPKEAARVDKISDAFRDLAGKEERGERALKKKI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEERLEREANTALKQGTRKEIKRGAKKLVLNERKLEDVETEAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENLQGFEEARVEKNRRRKIKAEGERLKDKESKKEEILKKILKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDELKKIAKELKSRGVSYEQIKKWAEKRGLSSKEQKILEKAAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRSIYRGLEKAQEKLAKSSKLEEGIEKRWVKKKEKSLADQLAI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LARGEELKGKVRDSAAAEERQQSQLEKQVRDEADLDNKQDPKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IIQGQEKADKLEDKLAYRSEAKKAIKRRGREKEEEPPDYIEKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKGKAKSEEQDGKKQKNAKEDARQEDKKNEELKREARLKLIED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IEERGDTRPKKAISKIKKERASNLIEDAAGEEERIKKAADELK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEQKANKELKELVKKVEEEAAEEIWRKKDLKGYEAKEDPKKKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRKLESILEEIKKKVRKAKDLKDLINKGLGSKKEASEIEDLPK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GAKLLDEKLKDGVEKIRKEPLIDKIKLESRSKNSEALKKEDIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDEYRKRVKNKLKNGKSLDEIKKEADKNGDDNEKKAVDEIKKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GALRRRLKKDQYEDKTGQLQSREIDAAREEEKQAEAVFRWAER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SREEERKKAKKPIEKAKEDDITEGARELLVKVNEVEQAGKKAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DQKQKDILKKVFEKKGTEEAVQRAARKLGVSDDQASEIWKRLL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKGFSRGALDQVKKILSEVIWEKLKVERRAQDQKAQTALKDEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.220000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VEQEQAKREALVKSEVPKRIEDGRTDAANDNDINTKEFSKKLL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKKEADRRLNDAIEEADQKKPQQALERLGEKRRELDYGGSEAI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ELNEIERDGKKALKYLREENLERGGKEAAEQSDKPKEAARHIA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EVKPTKIIDKIIRRLGSSRKAEDGVQEPAAKIERLDSLDKELE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REDQRQIEEKARERLAKIDDIEEFIENGVLKEDRLRDGDSNIA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LALIFLIDERNEQGDKEKQRVIDAARRDSEEKENIDERREDGI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LDERADKYKLAGRERVEAEENYENEQKDDEKERFNERDRKRKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YEREKKRESEKLRTEEEIEEGKTGAESIARDKRKLENAIEKLP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NRRNRASERVKENYGEASVAFALAELLEERREDKDEGPEEEKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LNENAAEDPSANGIAERDVKIKSILPKVTLFERKGEEFKAEQD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IEDKADQKGREALESFRKKEAYELAKDALGDRKEGNRIPQDEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NPEELEKRVEEALRRNDKDEIDRLAKEYGNQNAKEASRKLEDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QIEDASRRLREAPEKKDEEKVRKAARNYLDDKGENLENNLEKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DNRAKEKEKEAESVEDKQNEYKLIRRGKEPNNDALELDLARER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LPDAEGSAGRKESIKKKLSAETVARRKELEEELYKQARAKQRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNQASKAIERIKEKERKQKDASNIVRSGFIETKALQEIDKDLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDDLSEYVAPNLKIGAAEEKERKEQDKKWQANDLAQRKENAKF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DNAQNEDQAKGNIERRRLEEKEENKEKEEAPKWREGKAFAAEP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKYKKNAEKAEKKGLGRKSKLEKLGDEAAKRDALDIAKDLKST, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SKDEVEELRKRAKKSGNDELAKRIEEASKDSEDKAKKVFKKAQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REKARELAEELYRRAEQDSSVNKVISKLGVQSKKFDKVIEEGA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EIQKDEELVAQSKVRGASEKGSSKVLRAEKINVLEKRFDERYA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKATLDDLITTGSARRKNEAEEKALPLSEEEEELIRARKISGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKEKVEELKFDQSNKRAERFDGNEKRFAKVRLKEALPEAEQEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KELWAEKEKERTQRGRKELARRKDGEEVAPEWKLEASKAINKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEEKYENEEGRERLKGKKKRAQEKAKDRVENQQEVKRRAENAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKEENKRNKEQAEQYDERVEKRDQVAKGREERLKNAEEGAKER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEKDERWAEEANETGEERSDLNQAAERQLQTRRYRGGKRIQNV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REEEDRRARQIARDTGNEDRWEEAERKGQPDDVWRQAREDLKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.100000023841858"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERKERAEEKWKQGVDVKEDSASKGEDTGVADETQLKQAINKKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDDEVKEGARIEAGAKKKESKVTRKDAVQDQAKNETWEELKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LDERAIAPVPAADSENKYRRGQGEERESKNKLKKKDREPEIVA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YQEGSLISDEEATAKKVRQNKRLRGEAEENLKNLARLKEADQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TNKIKQLREKAKDKRRLKERVAEKKADKLKEAIEGPAGEKEGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEDETLKVSNNNRGEEGRLFNKTANRNKENIKAKQERLQLEED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EREAPKIPVKRKAKDAAKLKKKRLGNEKLAWDDGEESVFSILE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEDRAEKKAKKAIESGNSEQLRYAGKEFARNRIEEELKEVERA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VQEKGSEEVREALERIDNKNIKEAAKRLRPEPEEANKAKKEVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.009999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GEREEKAPNEEIEAEKKKIAKKVKNRADSPLVNRLDVEAQEER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKIEQEKIGKGEIVNRLRYAALNKKKDEEEFEIASDDEPELVQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RADEIAEIVTDKEQPRAAIATIGKRNEERKQDLSKGEESEPEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.889999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LGEDLDKTLRLKQEARKNSQKEEEKNELAKEEEEAGDKTEKRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.930000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERRAEYRPKKLERDAIEGEKVSQEASQKAKNEEGKNVKRLLER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PRQRLRQRELEEVSKEKEAEEGEKEAVYSARKLKNKNKGRIDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TRKNKLAEELIDLPNEEVRRLEEQAQKKEEKEDTAEDSARRIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKRQRKGENGEDEAILSAREISKGLEENARKKASDALEEIKDS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NILEKKEDKRKKAGASQESGGDRSEEAEAENLERLSRIDKAKI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENKALRELKRALKDPDDLDYLKQILKSEEFKKEAKDKAQEEGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKAKSEENERELLDRGLKAASGADKENEEKRKKIVKALRYNLS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEILAELKEDLNKEKKKKSGKAEDEKGLFNKAKAEAEPLESKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VEKGERKPEEEQRSAERLEKGSSEARKRIEDTLKRSLEDAKKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKDDQDKWLSSVAKDITAEKLEKAVKRAKEERLFNGAQNNESN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6100000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DNRANQVETAFLVSNLEKKSAEDKLRIANDKKDAKWEQSGQKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LLSGDELAENIQIQVEGEEAPEEERSEKRRRARERKARSKKER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8600000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GEEASKLPNEALKEVVRDKKGSKAAKEAIVEREEIKEGVKKLI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKRNREIAEDEVKSELAKDKADFEIGKITSAWERLVDRKRKEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.680000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KLKRKREKITSAENKREKEARENRAGVIEKWNKAWKADIRKDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEQEEEWYNEAQREAKQQYKFNKEAQKRQRTLLRSIAEEGREK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NREDKKGEQIETEVQANGNKAKEVLEERLKEELKNLAKRARTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LREEETNLKKDNEAVEALEKKTANRENEVRREKEGAQKQGLKI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EWKIAKAKKPEKRKKKGSLANNDNDAEDQREADFKPEEEAVNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IARGRLNVILKSKAQLQAKDIAKDEGQNELEKREQKEKKKTEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.850000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDEDKNRKAKKLYKNGNKEEVKRLADEGQSRAAQKLKEKLKNG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SKAKAEKQFATRPQANKKLDLEGDLELTGKEGSKKPLEARYLD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKKREKAKDGGNRGIVEEEKAEEWISKEAKKENSKELREIEST, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRENKEGEEKIGKKTERKSQLSEVRNEEEKSAWKEGKKIEIAA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENEDLSTQINKGAQEVKKNELEKAGKRAERKKLKNLAENAKEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SKNRDIKKKVNGWNVQDKKKNEYALAERPAEASEEAFKGDEEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RERDAQNSIDKNAEKEYREDISKSAKRKREIGELEELALSEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8799999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RIETQAEWSGADRNLDQRRAEPEEDVKFEELVQAGKKDKEPLK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKKRLDKRLIDLINRPQEEEASEAVKKGAVDASEIKDEGRELG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKEEASDDAENLAEDAEDKQGKELARTLGIRQRQWRSPDREIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRERKVIEEQKGRKKELLIKKARESEADNAGVDLKKERDLEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ANRFEKDDQNLANNEKDLSKREGAQKEEKSVKPEPYAKIKKVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRKIKRKKELAIKEGYDRKIEAAPSDAQQLGEPALIASKEKKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEKAKNEADRFIQRRENAREIPERWEENVSKDRKAEYGIRQWE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEKNVEEKARKAAKELKRQSLREIFNEFSNSKWKSGAENAKTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NRKKAEEGKRLWNSKLNEREAQKAWEEIRKENEGNDADKKNQW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKEVWKEPEKKERQLEGLYRNKAKDIKDDSASRGVLIKADQFL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ADRERKRREKAKDVGLRSEGWESAKERPRLEWIQNDPEDSQKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KERAQRELESAASKAKELKEAEELGESTWEQDIDSWGRKLSRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KADANEKWKKAEKEKRYLQDINKIPDKEPIQEEEVREGNEAAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KIEKIPEKLWRQEGANEEPNKDVYDEQAKEEAAKDDAIKNRKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EYEAFAVQDKNRGESDEGDKLNREAKKARIEVKEQRRKRAIEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DREKNERGFKKVIEKLKREDISDAASELAGRSRDAEKGRSELL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DEIWIRNVQDEKLARTKLVEYAERQEEQAGAWYRGDKREEAED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEAKNAPAAKNKKAIKIGKQPEEEVRRERDLEKEPGREVYKQA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EADVDAELKDKDKEKKREEPEIEYPEIKKRSKKRSVVPKKRLL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDRGREKASKLWQKLLEGKKLQDIAEENVIKKSTADEVLRKVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EREKGRKSLDDALREAKKKEAKYLLEEVIRRKARKQGENDNRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TRKAKEKISKLDKEAESREYVREAAKKNADTESEEGGEKLSRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IKTDKAEEYSGNEATKEREDARLSKEVESGEKARLKEKKSARE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKKEQTKAERVENRVARPKSIKNALKEEEGQKYWPSELKYEIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RPEYKREYPDEAARRASAKEGKDPLEEIAREADTLRKILKEGL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.009999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QEKKQEATREQEFIKSIAQQDSDESKIAALKRLLGPERDGLVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KYAEDEIRKQKLSALAKKEYDAQSLRQTERNGVNKELDKEIRW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKIKSDDKKKLEEQYEAAGEKDKAEAPEVAAKDKQEFRKKGLS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KENNLDEQWKDLLEEAKDKQGSKARDEADAEEKRKKEWNSDAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NNDWRQKGEWLELEKSAEQAADEDEDEKKNKDEKLARKKDASD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EARQKLDERVQKSKLNKEEGELPDYLKAQEIAQDGDAKVARLK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EGDKAQWWLDNEEAIEQKREQVKRKPAWAGLKTDEESRREKKW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LNNEKQLKEKAKRQYLEAKDLERPAESAKLTFKLANEPVRKPK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKEAEKQAVSLRKFKDEEPKKPAKPNLAQRRYELTLNELKNAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence FKEITRAIKEILRTVPEAKKFRKIIEKLLAKKERIEKGGKEAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RAKSIKRDIEKDLIEGERVRERLAQDEEEAKLTEAKASGKNEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKEANKLANDLSEDERDRSKIQRRAYDRAISNQEVKEAKDDGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KANRKGEDEENAESASSYLRQDDEKDKADRQIEVKNERDILAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KESEGKNKLEKFLERWSEKKARKAAQKGLKKRAWEEANKQDQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQWASRKGDERFRKWAKLKEKSKEKLALEQKNEENQAKGEAKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LEEASKGGQEVITNALKIENLKDVLNKAAIKRRELDKLPQKPA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EGIPKIRRKIRGEALKLNREDLYEELGELKEAERPNESKLLSV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YEKKDDGRKLIRKAAAESNKWQQAGSKDAEKEGREAIEERESG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AANPKKDIKKIENTIEDAQKARSLLDRQEKYSAEKPPKSGKER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKELDEIIEKASREAQKKKEARKAPERGVGKIEELEKLLSIAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SIEELRKKSEKAKIREEQPIRADILREKGKAEVLKEALAKGEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDTANQIAKKLERKAADAERIYDQLESVPVREEEISELGDNVG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEIDEKRAEREGTADRLLRRRKIEEGEEEEAALKETRDPIRDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EASNLKNEQARLFREKRAKAKLIEEIGQKRAREGKVDIRASNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKKAEKIPYEARQEAPDRRKIEETIQSKDIEGELLNRLAKKIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEKREEPTKFEKDADLNSDYAKEPLEKSLEEFKDGQSANRKGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.990000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEKGEKKWDSVQTKPAELEKAKRKARKKPASSYGIEWVDKQES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEEVKKWKKAEWPEYAGAIKASERLGSDSKQKKDKKQRTEPEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDDSEEIKKEADKNNSNLKDEYERAAREGNDEEAKEIEKKIRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESKKKEIKESARRDSDRIDEENEDIAEEAKYDNLSEGKNEAKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEDPRKVKEEAIQAATKGRKNEDEKKVEGSEKRKENEKFLETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.169999957084655"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRQEDAKERALSIKSDYTSTWKDQGKANAGKLETEKERTAKFE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NIKERNIREGADDLELSEREAKKPGQRVALDPDEAKEALEKLR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IGRNRALRKAEEKPVITKEEIKKAIQNEAEEDIGRLPEYRLKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRELKRNAAGEELIPKKNDIRLAGEITQEEARKGEIYVRPIEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EYFEKAELNEEIDEDREENASKTKKKTKIKRNKLREYVSLRNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AESLKSGVEDPLRKAGKEKELKEIAKRFVIKNQDVEKVLKDIA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence FKVAKRIKEDVGKLQKIEAKVDAILKEVKESNSLRGPEKDLEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERRPKKYGKSAEEELEKAREIEREVKEVLISKKKAKKLKEDGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RAKEKLKAKKKERKIKNVAEEEKKIDKRALIIEGAEGSQLKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEELKRWLNKAAEEPLELNSAKRGANEVLVQAREARRWGDIPV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KGRWDIPELNWEVALALLEVREEAANAQREKNALSEKVRNRGP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNKKKGARGGKEQDAKIRVEEELEQAEIAADEDKIPKKSAEKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEDQARENRWNEKNQEADRDKKIFRQDQDENGGSQKLEDALEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RNKRKKASELKEAVLRRDAEIKVAGDASERKVQKETEKEEGEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKKRIDEDLSRVLEEAKEKNIKKGAKKAAISKKKARKGAKKVI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EQEEAENDLQNGLRKFSEKDIQKNADRAAGEKYEVKKIDEKIA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKSDKEQSKAEREINLNEKNARKVAEDASIRTDEIKRIGQDVL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAQIEKNNDVGQESVLIEDKKEEIDANEKLAATRDSKSRRIQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEKRKSSEPDEGADEISEKELDRAWQKGWAEAKNAQKLVQRAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KPSEEDEDKEIAENAKVRKEEREKARIKAENDEKKYLRLRAGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IDDKPKEREKKKNDRLEKGDNEAAVRTAKEKDEIGSQFLAREA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKKLADASYKIYRGARSESRVEEGGEEIALRGSKVQQAPESDI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IEKEKEREELARKYQASRDEWEEAEKKANGDTEKAREIIERRL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDELRKEWEELERKGGDNRKARQKAEDNGDEDSAREVEKLERG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EREGDKEGDSVNREAGRRKDWKREGSQELKEENLEKLERADDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SRDDQKRALRKGSDGWEEDVRRDGNKKERENAAKLLEEEEEEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.829999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKESKDRADDGVESVLELKNVDSEIRKGAARRNEPKQAADEVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKSQDEEKELKQKIDSKQSNAAVNDQKLKNTAAKWIGDKEERL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRVDALSEPLKKILALSDNGEDRDEPEELVKDKRAGDREQELR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKEELNKRIERGLEKAETKQAEKSGRRRAKTKINDLVNEIEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SSDTFKELLERYKKTGSPEIEKKLRELSKTDEEARKLKKEEDS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEKTLSEILDKEKTDFSLSPKKEASELKEEDKYLERGRKRTEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDESEDRLRIFEPKLKEREKASEYKEETKSLKKKTGSELDLKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRRKLERRKAGQTYKKLAAEEKGKLGEELENAVTGLDLEEEAS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DSSVEEGLKQIPRDEFKINRIKKEVKRNIAQANDAYQPINELA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence FYQDRSIQNKKNNVPAILKEDKIESNALIAKPRAREEGEVDQI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERKEDRSLEEAKDSELRNENLKKIFKDVAAEKKSGEKLGEEAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAEAKRLRIRKAKSRNKEEGVPERLAEEGQQIERAGEEALKKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DDKEIERKATSLGQNIEKEEIEKALERRKKDEFKQNAKYLDKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKSEQAEKEAYIKKNDKLDEKKENFERKTIIARLLRDEDEQDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKEFVNKEERANRAAEERSKLTREDKERKGLDAEIEERAGKKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AESEAQQEIREAVRRLDKEKPDRLADNGKRQELKDLADNILSL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRESAELQPDAKRVDEEASNANDIRLLEDILKAEGRLKLQRDQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEDEDKLYKAPYKDLIEGQTARSLSNKPKSRAEELKKQLKDLR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEQKRAKRALAKKGATQNQDESNKEPLEDEEWDKKLIEKPEDL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KENDQGGYEEAIKWLIEEKKDKLSALSKKDENSLPKKVELAGA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LEATLEARQKTEPDEENQYERGREEQERNDIVRRKAAKQRLVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEEADDARERGEKSPEDVEEIKRALKEAKLKQRKVKELNKILA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDKQYKSGRQDELAKRIKEESKKIEDDDIKWDAAKEKKLGKEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DEKRIRDELNDLLEDIKTKKARDAAKKAAVEEEEFSRGLKKVG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDEALKADRSKDKVLLEIREELDKFGGKETEVNKREARAKDAI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEKDPSKRAEDAGKKWKNKEIQEVGTKLFLEQKKGRDAAENAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EQKADKEIADGYERVAIGKDNQDDSRREEVGRQELDRDRREEW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ILGIARSKDEADTPALDILREAKERKEREQEEAEIRPKKLYGT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KIRAGDANFEDERAGKDSKKILKQDKENEAVKIKTSKEKQEKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SAKKEGEDWIAKKIERESEKPKKAVEDATARKNELNRLAETIG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.930000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PRKDLTKEAQKASEEGRDRRLKQIAKKLGEENEKLEKAIRYAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SQAKGAKIPEKDRDRRARKATLYLQKENGKDRKLLIKEEEEAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PERARKIREKGEKEAESVEELNQSGRRELDQRGEKELQKEKRL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PGAKIAERSSKIAILYKPQALLKKKAEEEQSREKYEGEIVSER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence WEQKERQSSRGDRAEARLEEIDKAPSQRILNEEKAQTVRDLLG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKKKAEKSAEDAAQKWRPDNAERLAKEKKNLEFEKQGRELKKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDNDGKSDAKSALETIKENDAEKLIKRLAKEKDEIKKLEKKIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKELLDKDETGKAEEDIRKALIELAKNKISKIEAENSDKDEKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REKKSSAEKLANKRDSKETKVQEIGKEGVAESDYLKKAEKRIA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QGSLEEAEANREKDRRKKLEEFDKALREGPERAEEQDWLKKRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKETRKEWGEKNEEEKKAKAERSAQENSADRRGTILKGIWESK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REKPKRAEKKEKKKLEEQEALNIKKILERGYNDNKAEGPKAKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GPIRELAEKPRRKAREKKKEIYSLEKRVGKAEKLEYIVRDYDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDERGERRLPEIAQYWEQRSEEQLEENERIKIKEAEKVAEQRL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKRNEAAYRIIKRAIGEDEEAEYGGKEALKREIQDYADKQIRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DGRYEQKDANEGRKYRIAAEQIEKDRKKEEIKIAIRAGLYEAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RIDKAKERIKKGGENAEEEEAEQDIRKALARREKPKDVEQDLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KLAQRLTEEVERAYPEENNNLEKEPKKVWERRQDQIKDEAREK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RSAKENKVKLEAEIEFQRKEELEQNDQNADNKKSKNEDEGLER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRLPKRANEKLEKDKLSADDLKDAAKEGAVEDERARSVKKEGF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.090000033378601"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEEKDQRYAWYANQRGDESKLRDYWEKAGPDEKEAEDDIQTQS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EERKYEEADQGRGEADQDQWAYKPDWATAYEIDSDKRLQKNES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEADKNEINRELAKILYAKKVEGDSDAKAILGKGEKDESRKPK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDDADQEAKRKIRTVLENKKLKKAGEELVLERKSIKKLGERAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDEAAKLLEKKDKKANKKKEDRVIERRKDSVIELTGRLLEGAQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LEEIRKLGKRAKENPVKTKDAAEQLRDQLKSELGTLAQEIKEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NVEGAELLQKERIEKEQWAKQDKQPGNKERKDIKAKEILEKSP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKPLEKEGQIEDLKEYEEGYARATLKASRRIAEPQRKKNPLVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ADKEKEAKDEEKELEKGSELKIAREAAKLLKERLTVALSRGQN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EQEKQDGEKPIEKLAGRLENAKKLADEKAEAKASKGGKRWIRF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QGELPSNLDKGAAIIEREEEKAGRKKFQWKARKAKELEDAKKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IRRLEKNKEELTTETKSIKKPEDPGQRLILKIDQGKDPRKNDW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNRLKKEKIQIDETQDIGKRWEKLPGTDRSPEIEPLLTKRNDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKRKQKSWEDWDEDARRERNAESAGKERLEEDIAKSAERESRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.980000019073486"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DDDKEFDDYNKIKKRKGEDYKEQGKLAAAENEKITKIEVSLGS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNKKLREEGQEAIRQLKEKNARDALESEAAREESAEQKLESGT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RASWKELIDEGSQYLRYTQKNRPKQDAEKNQTKALEEARTNGV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RQSKEEAKELKERAKLDENDLDNAIEKKKREKGKEIAEKNYDV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEKRARKISLNELNDENAEKQELIVDEKKDGRDAEYEEKKKAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8399999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IKERAEYKAYEIAEDLKENRVKDAPSEQSLKRDSGTEAEKKVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRQTKELQEIKDKGKLEQKKAEEALEDRLNKKAGEKIEKAARN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTREKRDKAKLLEGRVSIERFEREGEEEQENTQGANRRAEVTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GDEYAERKKPYREAIISEAEQERLLAEKKAKGGKKEEKAQRKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RQAETKADEGEREWLLRANRGKELAEEKKYKQLKQELENQDER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.52999997138977"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDRRESADRGLEELIVEAKEGKDAGRRAWLDEREAKELPSEEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DDSRVAEGSERLADKAERLKEGSEDEERRLRWPLEAGEAEIAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DEESQRRGKQEEKGKPKIERQLIRGVKDLRAKLIESNKVALIA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEREEEKDEKNLRERKDAKRAERLLNDLEDERLKDPINDADSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RLRDRDEPRRAKELAARNELLNDKENEDDEIEEKSNLEKKDDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKENQKANEGSDKAKLRNRTLKKIANDEGEKKAASDIRQEKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEDQAEKARIEKESAGLLRRLKNQNLRSDDSEIRENRREDPLD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKRDAAELKKALYIILGKKSRKKLKSERTKEEGEDGKAEVVEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERESAKRTERAELGYQERNEEAEYVEESDESVPNKKKRIARDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEEEKKVEKELRKKNASEDEQRKEADKTGSDTVKEKIERKQKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEEKREINKEVDKSRVKKSEDKQEAEQKGESRLTEDAKEKTKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.52999997138977"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KVEANDKIKDVEAKRQEETSTKKEKREEEDLKKSKKERESSGQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENIVKQDEERKILFLKSEDSGKEKADSQEKVIQKALIQDAEGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKKRKLFEIRKVAEWKSAQEAINKREGEDGKKKRDEDEDEARL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SKTERVKEADKARKIESGETATQEGLKDRISELELVDKRLIAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKELDKKLRRAEKEIGEAKDIEKKLRKEINSEAGQALEELDDN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SERSKELEKEARKKGESLDQLRKKLEKNGNDDDAREAEKLLRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.870000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEEKKNIRKIAKKLNASDEVWKEIEKLGLSEDEAEEYARRWLN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.829999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GDTEKKIVKEVKKKNLSDKEAEKLAKKLNASSDTVKKLLKELG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKSKSEALTKGEDKDGNTKKVKSLVNKVEIKKKELEKALDKAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KVLDLNKKLKEGESAKLKALEKKELVNKDKGASITTEDVSKKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IKLIDKDIKALPRGGDKKLKAEAEILKLESSKRWKIPEVEKSA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IRTTLDKDLRRPNKENEDEDADKAIKYLEKKAKNIEDVAEEPA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEPADPTATRNKAKVILAKNLRDIKREDEKENKDIEEDYKDLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.910000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VESPTEQAERGKEEGRTVEKLEKEIKEKAEKELNKPGKRWQDL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.179999947547912"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AQEQEAGESDNFGTLQDRPREKRERRWQKEIRAALKEAASRDP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEPENKEKKGKDNARNEAILGDASRLDKRRDEEAAAISIEKEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DAFKELRDDEAYRKGDRRVDARENRRRSNEEEADKASEGWEER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEEDEREKKRRAVNNGDKDLQEKLARKSGGSWEDVKREVEKEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEEEQRKKSDEGVEEVDDNARENALERKLWNGKRGSKDVKKRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRRRVKKKSKDEEKDWEVELRLNSKGGEAEAGNPVQDKERENE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTENEEVKNKNLKIEKAKERARNIPEENAKDWRNERAIKQESF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence WDGEKDPQQLLKKQAIKKEKADEASKAGKQEVENVRQELQEQL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SALERGANIEALDAVQVKEEDEGEKKLQQLQPDWQKEQQKKKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRPSGEREGAKAEGEELRAQVEEIDKREKEKAKANDWKNLETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NKKRGQNEAREVLEEGSKKELKKALNDAAIEEEREREAKKRAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRSTEDEQAEEVANKFREEQLKDLANDLKARDRRRKKAKEEGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ELANELAEERTAEDKGFQDSARDRKKVLREKKRRERKQNADED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.910000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESEQGKKRVEQLLEKIENKDAEDKLEKGAARDEKGRRIRNDVA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.699999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NPRKARDRLDNLLREAKRRKAKNAAKEAEKKEGDSDLTYEKEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRDNKENRGKTKKYRREKAEADESDPLRNALREALKAKLEAKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NKKDQDKKALKAAEKLREEEVEKVEKKRVNSRLLRNGSEVADK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AAVKSKRKTKDTAEREENKIETANKLIIRKADDEAQGDRDESR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKESLERKAENAIDELEEKSIKRGAKELAGRDEKLREAREQAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENKDESKKAEKANKELDIEEAKKLITKGAEKRWRSKGKEEAKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDDDEESAYEVRKKLGKIKDLRKAPYEAQNNEARKAWKERSER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DLAEPKLSQDEKNNYRRAKAIWRKREKERGEDRKAKSVDYEAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LEKEDEGQRIREKIEADLKKANKLAQNKIKRSAKRGVQKPQED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IKEAKRELDNLAEKLAEPKKAKKLGEKKPETEIKYDGKKLNEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKELKKDKEGADALIIKRKKKTPEELAEAYGKKLNLKNEKYPE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEANKQDRQSKRKYKAANEVTEEIRESIYEEKRDLRDKAYQRP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GADLEARRNATLKDPEKNKVRKEKKEDLEEAKLKEGNERQEAV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAELDRGAEEGTKKAARVEKVESKLKKQVAEKERPKDIANDIP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VGEPNESIEDGRRKIPEIEEADEKGRKKAAQPQSLRKLPEALA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GIERKAQRDEGDKKGPAEAVISEERQPRPKEPIKNLASAEELL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IRLAAEKKDNKIREAKTINGETKADEGKREKEQRDRKRKKNEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDSREESAKEINKNPEKLRNIRKGAKERAEESGVRILEEAEQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEKTDLGEKRNRLKLKEDKKIDEKWQANGKEEDNARRKYEAAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GEEVEAGKREKDVKRERETKSSELDEKRRAVAAIRGILKKEER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAEKGRRDGEDAGEELKKRKAKQPIENKVKEDAYKNIKEVERA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IEEADSVLESVIKKLGEPKKLEKILKNRAPRSKKGTEAADEAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EVIKKSISAETRKKKGEALLRAKNKKDEAKPIAVLSEGDPLEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EREEEKEQGVNRAATFKKEESIGKGKRRADKINKELKAQPADR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AQRDARNEAEKLADRWEKQKLKEGWDRLQERKWPNEAEKNRRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRENRNAIKKFEKEKEDPESGEKKLRELLEDQGDRKAEKRDQL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6100000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRKNEERKSARERIKQPEEDDKEKRLFKAKGNLLDQEEDKGLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AERDKEAYDAGKRGLVQEDSLKQGIDEQANRELINAAKKPRSG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKAGDAEKLEQKNEEPAKEREGRAIQRTAPERKTKADLEKLER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EERKYIEENKERKAAEALDRKKQEEGNLKALKQAAQEREDSRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AGYSRPKLRFEEQAKEESIYNEKKKQKSAEWIKVYLMARKERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KGKRDEKGERILRNRYEEHRPKEAADTLAEREAKKELQELNKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RPKLDETEHELEKQYREKRDEEAREIAKNKNKAKRGGRLLAAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAYRLNPREEDKIRLEEKEDLKYDSEKVERGSQNKRAQIKAES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GDEYAERAWRLLQNNQSESLVKKLAKKANISPSQLKTLIKKIW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKDKIKKAIKAWYNRNQSTLPSEVLQSIKLKWRELESALNQGA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.059999942779541"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YRVETWSRKKAREEGKAKEAKRIETLEAQRLKGDKEKVEERLA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ALIRLAEAKEDNLIDEKRTEDKERGKEEEQKRKLRLIIEANGD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.269999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QTEFDELARSLVERQIRNKELYDGAKKKAAKLEEAREWPERLR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GRELEEEAEREAKEINREEPAKDIRDIALKRRALKRINRVGRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEEDRKGKKPERILRIAEREDRLEVRNKEGNAAIIKERRRLAA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETEGSSPAESAARRLIEANEWEEEAKRLNKDQLRKLISTWRKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DARRLRYEPSEPDKKLENEKAEKGVEQAFLTAKEADKAGNRLD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EGATFNREKLADVEYEADNKKALPDEAEKARLESRRPDLKQKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VPNSKIRELRRYLESETGEERASILLESQAREAKIGKKREKRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AAGSRILPKALLDRYLEPSDKKGDKEEWAKKDKSQLKEQKAIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LSLAKEKVTENEASKTKTKDIRESDELKNENDKEKVKNGRIAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.9200000166893"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRDEVNRELKELEDRSELKEGEEAASKKPAKEDRARQFAKEAW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKKYGNNKAERVVEEIKEKDAQDLGEKKVADAEKLERGRERLP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RESRKELGDKAEKSVAELSDARKEPEKLAINGEAGKKALTEIP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SAAIEAKKKDEIPKLKLNVEDAGGREAESGSLAKEPERERKTL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKKKEKSSLKEGANDIEEKDAKKLFEKADSEVFEQWKKQDNDN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEDPRKEGKTVESKAKSFDSIKRIVSKAKNELGKRALDRLEEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.9200000166893"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LSEKSIARDLKEKRDKVIAAKSVRGKNSKELDRFGPKEEETAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKKEAYRKGKRGAKELNKRKLEKWGKKAFERQLENDAKQEDRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKKANKELLFGEEKKAKDKRDKEQERKAQRWGYRGNKEALKEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSGQSRLQKWPEENDEQREQASSDAYKLAAQIRDQQRIEKEAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AAKEPTQAEEEQKRALDSRERAEPGAELNDIKWRGNPQLLRKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEQREKTEENPKREGAKAEILREVEEADENAQYEKLRGGKAKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQQESWQEGGQAKEREEADALNRYQEPTRLVKSNKKLEEAYIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RERDTRREFNEILSKENNKKGQEAVKRDPEEAQDAKDAVKNLA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RNSEKAQPRLAKQFDGRKDDKINNREERKATVEAEEENAVLDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AYKAKEEAGEAEDKAKSEKLKKRIAGLKNRENPKNNGEKRKDL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKEAIKRLEKKAEERGERRLLDEGNKRAKKEYRDEDATKEQEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKESKETQSLKRLVSGEDKKLKQYEKQNVEEEPKEIVKSRNKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKENRSYVGKEKREKEKVVQEKEKKEELLSQKSPSQSDKNLIT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IKRKYAPKKGNKEAKIEDDELNEAAKRELKGEARQIIKEASKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NRRALREQREKAKEILKKRELRLEAEDTEDKGRKKVNNGKKAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKWRWAGARAKEQPLAKRKTTKKIDSEEKLVKDQESESESTNS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEARELEAEKDIEQELASGGKEGQQDKTAKAWKLDLKTSLRER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KVQEREPAKDANKKAIKGKELQKYAQKRAPSKSSAEDVIEKGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.480000019073486"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AESEGKVAVKDYDKNGQQKKEERPALIEASAKRAIKKSKEQPK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRKINSIGERAEERAESGEKVDERLKEDANKSLLKELKKALYD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEKKYREDEKKESVGARSNGLELARSKDLLKDRILEEKNEIAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AQEDRREKPKRLIEEPKRENAERALDDDGFKLEEASEAIRKGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDKEIQERLEQALEEGNDDKAKKLKKDLNVTDEIEEKARRNQY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REQALKYKEGLPEKKEEDETAKKVNIKDRQELDIDDRANNELQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESKEEDDELRRGQQNWSLSRIKRILRQGAEKNAAKDLNKEEER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AERKILTQAEEAPEDGEADRAYDLWSYGPKSRRKLNRLANEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REESRKDITNAAERILREDELKEAANKVKLEPEDIQRIDEKFG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IRKANLALDDKQEINTLPAERKEISFAVERDREEKDRIKEEGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.769999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKEKQSETLKNLADTEEADKLEKALEDGVREKGKENADKKEKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NRKEESIQKKINEDIAEEKALDQLGRRASAESKDGKDAVRKAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KLNEVAIQAKDADKEKDGKLKALERRQAIISARREEGSKENSD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKNRAVIEEADEEAKDKKAEAKGDKRRYREPKWIDLKEKTDAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SKEVKKDVKDATERGVKLENAAETLDRSGAKYEELEEGRRRAP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RLWRAKREQEAKRDKPSGKATWKDSNAEVNGQYTNAKDNEEEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ARKRLAIMEGKKKEVETLLEASDLEQDPERDYENREGLKEDLK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7300000190734861"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRNKVKKDGEQQVKLEAKEDGPKEKKRKKFEAEIIAADQKDGL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKKLEKEAKRLASKGIKEEKLKEVPEEIGASERELRRLVKTLW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAGKKKLPAKLKKRETEGEGLIVKREEESISKLELELRWVKRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AIIEGKQNEEDDGQYKNRERPLSTKKKKKKAETEALEWEEKRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REELNSAKEKAEDKAADINNEGEIIKKVGRREKPKQAKYKVQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SKESENGESANSSAIAEEKRLEQLLKDRGNEKIQKKAEKGKKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAINLESKSKEQAEKNAKNGEQLRKAKSSKSEKGGRRKEDIEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GRQAEEPESELKNKEKGIEENVEKAKNKLREYKKEDAIKRARP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EADIDESSKYLADIRQEARQEERAGALKWKVETKKRGYADQIH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YKREIEKRLRINKEEQNSIEILKVGEIVEAKAEKGEELRKLQS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.4299999475479122"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ANEQRDLKKKVERKGLKEEDISEALKDVNLKERKVSEIAQKGP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LRNEDPSDRIGKEVQGQEDKLRSDVSELVAKNKRWEEAAKKLA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRDKEKARKLRQKGKADRDLLNEGLEKFADAQAVNELKDPERA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDDARLEARDGEDRDAKKRNLKAQLEAPKELFAEKKRVLNQRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKDAEFEAALKRRSEIRVAEDEADELLANENEQKRNGQGLKRP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEESKKAEKIARKLNASPDIQEEAKQKKLSEDDIKKLIKKAKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.080000042915344"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAAIKKDQLLEEKKPDKSEKLSESKKKAKKNRENAQSIIADIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.930000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EETREIGKKALKLFLKSRDEIRKAQEEQREKVSELKTNAESKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KADAPKEALNAAEEFKNPRYAEKGLRREEWRLREISRPTEKIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AAERRNARKEANPKIEALERPKDKLKAELPYFRGIREKESWTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEDEKQKKLEELAKKGNEEKLEKLAKKLNVDDEKRKKLKKRAS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKEEKTDLKEAKRKKEAAREEGNLTLINRDAEADDQGLFLAPL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KADNLRERADRALKELEGKEPERAPKKGVAEQEKLDSLLEEAI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EREREKNNIKDFGTKLESTKAKKGAQERIEDAKDADEPAKELK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDNAKRIQTKEKDESKALKALEEEGINFKTKRDAEEDPKKRGA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EYEKADDNLERPEEQGNRRNASKAGEELLLDLRAAEKLEKEAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EGDQDAAKLAAKDSQAIDYQGKKEWKLDSERTKYEFRQNELRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RGRLEEVGKNIPEELPEAEKLRKVAKTIALKDEEAREIVRNIL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KINNPKEVAVREIATELKILPARERGRRVEDKKEGILALLEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7300000190734861"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKEEENGKEQLKEEDGKLRDIKRKAEKRASKNEEEAAESIKKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQRRSLYKGVRQLEIIEKRAGYKVLDKEKETEISTDKEKLSNA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TKTVKEKKGQNLRSLGKDYVKRDRQKEEKEIAEIYLRLSIAES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LDEVQEKIDKIEYRAPEDKKAKKYAEKVIANASDGEKPAKELG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ASLREERSEETRKAAGGEEKKDDKREIARNRAERKNQQLDDKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETRRAKAEGDKERPANNKKIEGIEARREGNLILKEASEVERAS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GAVEKNDAERQKDEFRELAELIERSALAVGPAESNREKDKEKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEQEQATREAATLLGISTDQFSKEAQEKNKDPRELAEEVKRKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NKQEKAEDELLQAAALRDQEPETKAESRKTSIKEGFSEVRTQV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKEIPRQQDDELLKKSEQAFATKESERKATTENGQAVLAVESE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKNKDDRALKILEKRGENDNKETELAEEKERLEKERPRGERAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IDKLRKAISEPANEKQKIETIKEILEKLLAQEKLGKRAERNAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAKLTKKEKIKEEKDLRVRPRRDRNESAELLKIGEGGLKAVEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DEKEIKQAAKVKDTLGDKDRIEQFAEKKGAKRRAVEQLAKTWY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TNRELDSDAEQAARKKDEETKEKARDSAKTEIQELKREFREEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKQLDKEVERDGKNAWEDEKAESLAKRVDKEEARKAIRRLKES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKLNEKAEWVEADSKIEVKREESRAKRLKDAERDALRQKKKDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LREIKDPGKQAAKEGAEQDSFKDLIDEFAVQIKKLKDAKKEPK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKKKKDQAESLSKEVGYVDEVEEDLERKRDNKISEVARNAKEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNKEAVKRANKANKKIEKSRADDVWEKLRLSAEGPDKASQYIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SGRGEDIVEGEEAEKRIKEERSEIDTNARKRAWIRKIDLQKKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.450000047683715"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKKKDKRQGKEAVDKIELDKAQDWAKEAGRYTAPEDPQEKFKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LESKERIRKKGEKALISARKIENAPESVRGKNRPLEDAVTEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RESAKKGNEEKVNEEIKLGRTILEKSVAALIESAPDRKREPKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AERSQRRGKDDAEKIKELKQAKKEIRDIAEKKLPDDPRDGEDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AVIQLGKRSADQEEAKRPENELGEDKERKKAQESERRKWLALE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDEKQEAEDYIKKQNVNPEEAEKEARKNGNDELSRKIQLWRDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence WQERKEADNEGDENNGRPQKLEQRVEDSIKKEAEYNLKPIDKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SKASERDEAQKEKDNEKVEEKKLDEQPRINKKAGDIKLAEAGK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EETNTDAKDAAKDLEKEQEKLENLAKRGQWKNEKLKKAIKKNA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.340000033378601"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKKKVENKGKQGAKDGKLNEIEKALNKILESEAVDKAYERKDL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KENRKRAESKARKESAQETEAQRLVERAAIEYKKGQELLKNDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEAANDQEEEKSARLQRLKVRYERNKAAGEEKTKKQRISELKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EREKEKKDADRGASEAELREARKLLKSIGDEKADNEAEEVQRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RNLEEKEERGKSKWQANNDRAQEAAERDAYEQGIKEEYDKRKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ARERQQNERAWNRGRLKYAEDKEGKYDIKEENEDKANKEEAQS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KWDAKDRWVNQFEENIRRAKGKRNNKAEEADWAQEKAEQTKQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRKINTDGKDDKEKKEEEIEAPIRIKERRRIQDGEREAAEREE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRQKELGYKASKKRKAEPNRIKSLGENPKIDIEEAKEAASNIV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LEKNRKNKAKKVLKRGKEEEPDDLWREAVGRSKADKRLEKELA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKKDPNAEVKKDLSWLKLEKGREDRVARKRLENRAKKEELEAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERQRREIVKRASEDGVEGKKAKDELTEQVARTHRLDEPSEIAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.790000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DNEKERKEGSRIGHEWNEREANELAKKLNEAKPRERITKAKKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TEAAAEGEENKIKENSRERDKKEKRLNIWAKNAPERKLGRHEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEKGEDALKELRDSGRERRQAKESAERIAGELRRAQELVYEPL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAYLAKKSEIAEEKEKDEKKGAFTTENDNAQSKLIERVQQERK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENAREKARVLKRENARGDSQLIEREEGEEAKQKLDLRSNEKEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDEEPVQSEENAQRKWEERKGRYAERDANAEFERAERLKDDTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TFVPEWEELQDDESRKREAYEEKARKRDEKNAERGANRQEDAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LDREIEKNAKKGPSKGKREKAKDILEKAAIEENELERLATKLR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LEEKVIERKNEASKKVQYKEPDKGAKRAGYRERGEEWDEDRRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKRLRYDRGKKEKDKEGSEVEYREEGQDIPRVKEAEAKEWNAA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEEIEKIAEDLDESALKVKKADKPGKEPGISKREAEKLIREIA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEEEAKRRLEEALRKNNEDEAKKVAKKYNNEDWLREQQKKENN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EENKYEAGNDIWRQPDQAKDVGEIANEQAKRQVASLARRIKRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PWKRQTFRDPLKAALVEKQELSKARKEALLNGKKVISAGEREK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KVEEGLPAERTWAQERVDKPLRFIAARGKNALKKSQKLEKKLS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YKTEKRMIYKILRRAGKLEKADEEAQTEPKQSRSLEKLIRGAA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKEDESKNIRRLAKKAENEELNKGGRKIKEERADSKATKADKI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AAKTKEAEKKEKRNGGAELRKDIDLKDKNRKIISRKEAKNSEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VLLVEEEEWPALQKDASSKVKRKEAGKIKGQNDDSKEAKAKKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IKKGAESQLSDENEGIKAALAERKEVLNKDKSYRTAEKRENKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EETAEKVIRSAKNEVNNGNKLAKRPDEQGERKKVEYADERASD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.810000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EHQAQKKGEQWNRSAPYLKKVDEAASKRSEKQVDEEAERLRSQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEQQNEVQRHAELKQEDLSEDKEYSQAASWSRKEKKRAKARGV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDERKRQAKKELEEKVDKRQLEEAGDEAAGKFEELKKAPKDAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.970000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEDEEKKQAEEIRGNRSYEQARNEAQKKGNDEERKKIEKAQND, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EQIEDNNQEAADEKEYAKSRENKRKEDIGKQRRAKSQENKEGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NSIRKKEREEVNKDLSSARLAKRREEQAEKKEEKEDPGERESQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENEPRNRLEKGAKKFNKKYSAQEGAEDAERAEVKEEWEKKQRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKKIDAYKANLIDAQEEQESWGKTKKKKKNKKKQPQENEKKVI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKKVREILKTLRKEAAELSEGDEAAKDLKENKVKRSVEEEKRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GEAERVREKKESEREKILLDVKGKDVKARKAKTAENKKLELSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEAKAGQARSKPDKKLKDALDREENARNKRKEEKRALDTVEGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDEKEKIKKRAKEIGVSPSVVEEAAKRGLDAEEARRIYEERQN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GEDATLRLYKEKGKKAAEKVLQKRAKREDPNSERLKEKKEKGI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.409999966621399"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REKKAESEVIELLENNENKKWKEILNDPEKNANEAKDAATKAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RASAREKKADLLEQDNKRKNIIEEIKLSRASKVGAKAPKEKES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AESQGNEDEQKVRKEAYKVWKQGLEELPANASSPREKIKREVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GEPQREKVRYNRLAESEQRNEQDAWAKVLEKEKPKIVKEAGSS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKREGDNEAKNWSKEVEKKQLDEWLKTGASEESAKRAEEKKKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.930000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KREKRKAKEAPQNGTAKERRFNDLADDIEKINLAYVGKDKANI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKIQRIFADAKKNKPVKLNANKRIGAAEYAKEDKNDREGLDET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEDIEREWEELKKRGVSRTEARQILKDKNKNYEWAERQERNKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.299999952316284"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKQIEDKARKAEYQLLNKEKINTWVSRREREREWGDNEKEERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AYQKIGKEAVKLKRNIKEKEVNEIRREEEAEKKQWRDAKEEPN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKEAGLKIANEDVEEVQEKEWEEPIRKKEEYNKAKIRRKQNKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AVEEEERDVYPSEGEWTKLGRKPKRPASWKRNRLNESIEARAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEKKLSDRPRELFESLKLNKARDLAEKYEAKKDINEEAKKDAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEEELERIAKKLIKKGNEEDLKELRKKDPRAEDAIKKARKKFL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.910000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKDERDKKNLLLALAGERKKIRIKLEIDKRKENAEPEFEKKAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KIQNYNRQADEFAEEPKIREAKKNGKELAAELDELERPAENGP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AYEIRKEAIKGQNKNNPEPKNLPGDEEKRDAELRLFAEAEAQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRSNEDLKEKLRKIAWKINKGQEWKEELKKPQEGESPLRREKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKKELKNEADKLQEEDRRDGSKSAYNDAGAEENEKQSVKKRLK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RLKRDESSYKQGAKNEDKNRVKAELSEEANQDEKKAELDGKEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RSKDGERDIEELGQKLRKEDANEPAKDALVRVNEARELAKRAS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EERKEEGREGNKDAAIEAREATEAIKRELTRKVAERGEKRQDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.949999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TKEERAERQEKGEIAEKRIRRGRARAEKDLGEAKEEDNETAVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEEEDKNKAEKRVKRFNKKKAKKNAEEERKKRAPEGLKNEIED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEGKAKKANNARFLRNPKVAKREEEERKEEKNKKAEDIKEKED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKEGERENKALGNEGDAKKALKSDALNLANKRDREEKKEEKAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNKIKSELRDLRTRGFEEQDGNELGERAVVDRDSAREIDEKDI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKEPNEELKNALQDAAQANQADRGVEKQPERRIAEKWYNLDKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERNGEQAADSVVEDAERKRRGEEQVNEEAVEIDKLTRAAESPR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ARVTEEEEEAVQRRKAVRAPAESEINDDVANKRQLEGREGSED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKNKPYEELDEAPERARKKEIDKGYTREARKASQLKDKERKSK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EETPDKAALLEIRRKAGAKKRKEDPRKEKRDKSKYENAEKSYQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DEREDEINEADQRWEANVKNARKALENNKKKKIRKNAENGKER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENKWDAKANNRNKEKDIEENEAGLEERRADKKRKNKNRIVAQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NILRRPILLTSEWAEIKKSGAKEAKKRALKEESEKRAEEGKER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ARQSEGRVWRTKERIGRAEKQLILKNWEVPEAVAELKEKAKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EERSSKNAESFADKAGEERKLRTAWSEKEESRAEEAVNRWKQD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNAREKALSEWKEANEATVKQAERERSEDEKESSDSREWAGFR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VSQAEDRAERADYDGQSISELKKPLREAAPKEYRGEELKRDAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DWEIIQKDVLKGKGEKAIKKIAKKLLRTAAEEEEKKRENKKQN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKREEEEDARKVARTAKKDKAKKLLREIALEDERPNEGTERIL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ILEEEDERKRVAITKKGEDPKLEAKKREEKRRENATALDAGLR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.580000042915344"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IKKEEKQAERAGNKPARDKEWESVLDEIEAKVQKIRNLKEEPQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8999999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VRSKIKTEGNKGPTTADKQKIEKAGKKLAAKERKFENLADELA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKKEEKAKDPGESTAKEQIDLKATGKGKKARLLIKTNNAFEVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRSVPEEKKKWAGQRQELTRREAKRGLRSLKAKLEEKADKTEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEKRYREKPENGKQNINIDEAEDKFKEEDRAKREQAADKVQKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LEYKREIQNAPTYSKVKQNIESEVKEKRLDLSKAKKPVREARK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NKENRKGKREGRSALLKSKALEDLARELEARLEEASELLRKAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKRLAALNKKARRERKRLKSELGEASAAGLEDLLLSEERKNEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GRQNAAKQAAKLRRQVKDNEPEKVDERRRGEAEEKKQVDYEWP, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKEVGRAKRDQVDEEQDAKKAYQNREAVERAQNKPELRWPEGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKEDAKDQLKDALEEFNKKSGKELAEQAEKSTAKDKIQSKNDQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKNKSLDEEKAKEQKEATSLNKAIASEEKGQKEFKKADDQQDD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEDARREAKKLKKNNQDPDKIREILKRRNLDWKWAEKRLRDES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEKRIALKRIKLERRQKKERDWRDADNWALSKENEPDNPRLDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ILDAEKIWEEPADTGKSKRVVYRQGQERIVKARDAESPAKAPI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKESNYAVQEGEEQALQADEPREALEQSRQRKIDNYAKSLKKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VSKRKNREQESAGLGEIASLEDAKEKKKKETRRKGRFIAATGE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RARRKELEDEASEEIAEDELLDQIKRKPDAQNKKGREIGKRAI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NERQDNAKRQASTAQEKPDKIDEAASEIGLEEDELKRVAKDIL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LARAANQLPLGEEADAKEDKIKTDQDKRNDRSVEIAEKEQSEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERRKKAEQASDDLGAKQGEEIESLIDQSAKDVWSLLKKAKDKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDDEAEKKASKLANSNNTDDRIKAAQKLGDSRLEEELKRRKKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.980000019073486"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAKSRRLKRKKSLGASKQEDDAINSNKRNAEDETKDLAEDSEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence WTVYKEKDYSEEQKKKDEIKKAASDGPRLEKDRVADDAAAGLK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QLESVTDQEEQAGLKETRAKRDSAEKQREDEEDDRAVEKFAGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKEQDDERRLGEEVPASKERASDGYRDVRKAEKQANKIKQKEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKKKKEDDQAAKNEILREKKSYRAAERSVEEKGEEQGQDRVRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence WEKESARLEKKEKLERKKKRDAKIEDRVGWTERSKAEPNDAGA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDISKEVEKVARKLGKSREQAAEELAKKKGSRKAEKYLRKRKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EYQKIELKRRFDEPTKALEANSAREPEKELARTKELSRIGKIW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNEDAEKELYKAKTENNRKELDRGIQKKNAEDDKLDRAWDDIL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RVEKEQREAAIKQALKLILAGEEIDAGKRSKESAGNQREPKED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKSNKQDKGYELAKEADKQSIKEILKEPAKNAKTADEALKKGR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKLEEIDKGYIKESKKKSDQAALKKEAAGRAKKEKPDANNTQL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDTSNREQEKNEEGGAQDQSGKRIEKRIKWKKESIEEAFKEAA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.309999942779541"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KREDARTNARDIAEKLKDRNADRAKSKGEIEETELNEANRSLK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.790000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AREFRKAIENIIDEGIKLEKGQDAAKSVVLEKKSAREPAEQGL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRAAKKVKNEAKKEAEIFDERVRKGQNKPEEEKASEGGKRIKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKIVEKNSEAAADEKDRPERKAQIGKREVGKKREAKEGNEKAF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.810000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEEKLYKKAQSARSKIRDKDAENGAQRGGEEKQRLKRIKDDLA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEEKEAGISRDGKALKQKSKQYLDKGDIELARARNRKQEERAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LRIKDEDEQGEESAQAEKDDKKRGVIEKNQQKNATAAKLAEIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LKSRRKANKLGEEAIEKANHPDELLNKGEPELEKADKPKEAAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LASNEPKRELREGLLKREETARRAANRIPEPRRPKKRADEWEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RWEEEAKEAKKLANSGNSEKAERYLQKLGSEDAENELRRYLNN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDKSNKLKKWTSEANAEADKLRRLAEEEADEKKNKGGEQAKQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERKQRQGEIAEKQDAAIKDKIKVRVGKEDPYKLPELEALTIRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AQRKVRLEPLTSQEKRRKQEAEELGTKYKEREENERELKGLTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENEKENDEDAWQKGIGRLKKGKDGANDEIRKRTVKNIKKKADI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEQSKRNLKKLGGEKSKDAEVVGTAKPAFEEKKKEDSNLKLRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKNKVKRELEKLIEKISEREAKTAAESPGGDLTQAENAKKELD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.9200000166893"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PAGQTKTANKKKKDVEREEANKAEKIEKLAEGLSDKERIELSL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDKIRVKGKKTYVPETEQFRSIIDKVNPTYETFTGERLTAEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDEVTIEGVTLNKTTVTWIKQVWTSAGLTRISVTGKKFRADD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKEARARTDTTHVPEVDEATNLVEYRGVTTVYVEEGTFRWNT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRARNEGRRQDLPQATAIEKAVDEYGLNTVEVKTGQFNFTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.970000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKRVTFRGETRNLKTTETFEYFAKKVGLERATETGETVKARE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTETQVKGKKFTATQEEREKYFSSDAGLTTIHERGERFKATG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYTFEKGRNSTYLRDDESAKTTAKYLGAKTIERTGEEITLTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERVYASGEYTTAQTPTKATTKADNQGVTKVHVRGEEIDIKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.230000019073486"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKRIEKDGEEKEADKKTDITETIKTLGATDVEEYRGTAKAQN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKRASENGNENTFSTSETATELVYTVGITRFHLNETKVRANR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRAYVTGKRKNEPYTTALTETFDTWGLTYDTENGGNYRLRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYELNVKGRNVTGVYTTKIKKVVRTEGIEHATEQRGTERATR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKDAKVGGEKYTGDETTTAREVAQYLGWNRKTRKRGQWTFYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKAEVKGYRDEARTTEHAKKNVTKINPEDLETRGQRIQLTY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDSVRVTGRETEGENVETFREWAYQSGAKEARVKGYYAEIER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDTIYERGSERQAREDKDLTTFFETDGAHEVEVTGEKATFTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDEFTATGFTASSEYTTEWDELWESLGARDTKTERGNIKWDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKASWYGNTTTANDEETLAQVVERTGIREVETENYTVRFTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREVYAGRTETRINYKEFKRRLTTRADPTKLTDRGPDSEATK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTNVEFGPFEVRGDKKERLDHLYRKAGWKKAETTRGTDTFRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTFTEEGEKKTARRSYHWEKVVSTNGVTDVYTTQGRAEAEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEYVNWETNKNQGRYLVEKAWQVVKEQGTKEYLTEGDATATG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTWTVGEKRTREYENRDWYKKATTLGFSRKYDTGKAKYAKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTAEAKGTENYVDTRETAYRTIQYEGVDTVRVKGKTAEWRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDELKLTGKDLKARTTTHLERIVNKAGFQEAEETGTRARAKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEYIHLTGAENERTERKEITELLKELGASDITTRTGSLRVNH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEDVERGRKEETIPTVTKARQFWTYEGLESIHSEGEKFTAEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDYAEKRGTETEAEEPTKAEKKIYTVGIDKINARYGKVSLVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRFTSGKTEKNVTEERKAEKLVDTTGANKVTVTDGYWKAEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRSFTEGTKESEVRYEEAAKKVARREGINEVTSYGNKWTAEH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREVKFRENQQELNQSTKIRTWLKTLGADHADEEHGKAYFRH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTIEATGTKQTVQEDKEAKERLYTTGVTKANADGTYVKVRY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGQVTWEGKTKKNTTFTRALTEAITRRGADVQDNTGEWTVYG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKWEVTGQTDTVQDKRQATYAADTKGFTTAENSGRTIRVTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEQITWQGREFTFEDKTQVREFWSQEGAKNFKQKEGKAKAHT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.949999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEEITTDGNTVKATEVTTWINNTWDTQGKKVEQYGKKAEATK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREITIRGEEEQIQEEKTIKKLFYRAGAKRAKATGGTFRARN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTVKTRGDKDENTTPHKATTIVETFAEGEATQYGTTAYWRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRDWKVEGYDETGPEVYDAVQERVRTTGTKFDITGREATAKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRQLKIQGQSATIKKYETLEYAADTDGATTTEYTGEKFKVYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDSINAKDTEKQTTYPNILKTEVKTVGAETAERKGRTLEWTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRITAEGYRSTWPDPQTAVTEKVTNYGFTYQEDNGQAQFKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRSAKTKGDETRVTDKEDFETIVTTRGIKKLEEKGTTWYATH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDSWKAGRTERTLRRKEELQTAVKEEGIDRATKTGTTFTVYY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6100000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKKAEVDGRESKGQTNTTVEEFVEERGATEIKEYGYTATWRY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKRTTAGGTSVETTKEKNVKEYIYDSGIRQIRTQGKEHYVET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQSWKVDGATNYTTKRDLIETTLTEIGVKRLSKKGTQVTARE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDTATWGEYQNTAERVEEFTTAVTEEGVTRLKKRYGKVSAKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRRAKRGDEREYGTDEETLWKVAETEGIEKVTLTGKKVEIYK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDRVNEGYTTSEIDKNQEIDTVIRTVEPRTVKKTGREVQATR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYTFDAHGTNETVQTPKDAATEERRDKTIYVKRYGYENQLNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.980000019073486"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRFEAGEEKHQGVRTEEADTLKNTVGFNEFRRTYTTARWRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKTVKVKGTYTNERRANEVLENFLETDGVQAYTDGTRARLTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKWEERGRTRYAKQPQKFVQDAFDTKGYTVRNTGEEAQFEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRAKIRGTTTEANEFKRVNKLWKTWGFTRVETEEGYAEVDY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRYVNLEGLTDTWETRTTANTEWKTLGATTFQYQTGSVDFTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKVYFGYQYKDTDKPTRATTVAKTTGFQRATEDGEEVRIER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRDLRLTGVRIEVEYEENTTRAQEELGFKTLTDTGQHERATR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSELDNGKYRETTPKYEDFQKAIQTLGARYAYTTGKTRQVEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEAFVGTTQIDATRHETFTHLFSRVEPSRFTETGQTVEFNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQEIVIRGTREYLKTPNNITDLETDIQPTKAERKNGNARVKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTVENRGKDAYIPEVEKVTHQVTKYGAYRADVEGTTAELTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTDIDATGLTATQTDTKVVTKAIKTLGIDTVNVTGTTWTVQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQHLTWGNTTETDETKESWYKFADKIGIRRTETTKGEAEVRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERLKATGKEFELETRTTLTTFVKTAGATRNKRNSGSVEITT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGTFEAGYRETKTKDPKAWNRYLYTAGAYELTYRGHREQITH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEYFEVKGYTRNGDNTKAAETVATEKTAYEVEYTGRTVTLKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGYLRFRGEDVTGPKLNEELQTVAQTVEAKWEKTGRTANLNG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYATVGREEEKGKTYRAWTKLFEKKGAQTWHHSGEEIEIQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRNVNLYKTKARLTERKEANRVVERDGWEEVTSTTGEFTAKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNQTEFGKEKKSEVTRTRKNTFTETAGVRRLEYTYGELEVHE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEEFRADGSENRIQRTTYATRVFKTEGWKQRKYTTGNAELQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.910000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQARRRGEHKNWPKENTIKEAITTFGVKNADSKERTLYASE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKLYATREKNELSNQTKATTVATTVGIKTIEITGTTVDITT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYTWKINGRNYKGEEPKWATELAYTAGIENITQTRGTVTAEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRARLTYRSEYAEDTTVAKTQVETVGLQRAEINGTTVNWEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTITFGQNTTRGKRPQYAKTVLRDETPKYEYTTGRTFRVEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERVTAGYEEVEIKEVRRLKKAVTEAGVEKATITGRKVDITE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNNINEKGEKIEEQRPRTWYKDLRDLEPTQVNKTGRTARITG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEADIGETNQRYLHPTTAKTWAQEYGLDTVRERGYREKFEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKTVTVEGEREEANTRTVAKTAVTKIGVYDRDARGERLYLTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRDAELTGETKTAEEANRAVRTVVYTKRETLKDYGTTYKIQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTLKAGKVRLHGTTSKTIDYLLKEAGLEELSRTGTEWTATG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDNLYVRGEQENIKTTTTVTTIVRRIEPTKVETSQGELTAET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEDWKITGRTVEIRDETVWTNVVEDDGAKQWYRTEGKAKATT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTYVKATGTSDTGPQAEKKFREEFHTTGYYADTEGERYKVEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDQLRLKGQKVTFPTHTDARQTASEIGLDKIRTNGYEARFDD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERRNLYGFKLERITQNFTDTAERFAGLYETKTSKGEATARK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEYVRLTGKKLKEDRAVTFVYDTLQTEGWEATREGTTHKAEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTQIRWEGEYKTLDERTNFTRVASTKGAKTATQRTGKFTLTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.870000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTVDRTGTETQIKRNRAAQEEVETVGVYRASKEKGYATVHK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEDTEADGQREERRKADKAVETNVYTQGRNWKRTGTKVEVYG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRFDAGTETRYGKYTTVIRRAAEEEGAETYETKGEEWRWTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRATWDGRHWEDKETRDFEELVTTFGADERTHENGRANFTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTITIEGKTTKGVRPEKVTQFARTNGWRRAEVENGEAEVTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEEEFFGRTETTTFNETNFTYVASRITLKKAQTTNGYAKAKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDYVNANGNRTNWPTEETTQTVVKTLTPTTIRHEGTRITIKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.139999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRAHVEGTQTTKREPQDLLTKQATKKGVRWEAHGTTVTIEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDYEEWGRKRSNGIETTTWERFVRTAGATETTTTYGHAEAEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRNATFGGFHARDGKYYRESKVTKREGIDEKTTRYGEKEVRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.949999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKARVDKTYEKIRRRRTARSVAYSVGVEEITATGEEFNLEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSENWDATGNNRKVTQTEEIKRLATQAGLRDVTDRTKSWTLTY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRLRLEGTYTKERKEKTVYETVTSFGANKLDTSEGRINATT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTAEVKGERTNADTYKEFDTFVTTVEPREVETKTGRADVTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSHKETLGGTTTYEARTKEKETARTEVGFTRVYRDGRTYNVEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERADFKGENRRTYQTETFKRAITTFGLTTRKEDGDKAEADR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNTVSVEGEELYGTTAEWVKYAATTTGVSTWTWKGTTVKIRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRYWEATHTRQKFSTTETVKRLITTYGATEAENRNGEFTVTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEQFQLTGEYYRITYPRTAERKASKAGIETTTIEGTRVNADT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSELTAEGETKQAKTAKTVSKTADDLGVREIRKEGYRVYARK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNYATKRGREVKVTNTETFKQLVREAGVKEVETREGSAKVKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEFELGTARTYDTTPTTATRTAEKFGATRHYEEGKRVHLYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYTLHAGKKETEITKLHEATTKLTHAGAQDVSARGSYLDITK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERVRTEGETTRVREDTTFTSVIKDFYPTKADATGGKFNVET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNEVRFHGQRKQVYEKNNVRRTLTSLGATTAEEREGEARLRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKTADKGKRHEQWTKYTTATKVAEETGITTARNNDSTVNVNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNRVTVQGTDTNWPQVTTAVDLLTTTGATDFKAYHGHAEITQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.790000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKTFTRGDSSWDAPTDEFLTEAVKTWVKGTAEQRNGTAEWTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNHAYVKGREVKLPRATEFEKEVRTVGAETATVTGEDLTAEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYTIRVGKTTRSFTEPDNATTIAETSGWEYITTERGSAKLEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKQVTAGKETKTLRYSTDLTYKAEQVGAKTADTHRGEANFET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTFQAGTKTWEKETDQVLVETVDTLGAEHARTTGTRVKVTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTVTFGTEDKPVEEHRNFEETWRDEGAYKITTEKGYATAKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTWYIGTSTKEVTTLTNALDAATSTGVETIEFTGTRLYVQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGTAKVGERQTTGSKERELYTVLERAGADTLYLRGETFTVKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTVKAGSTEFEIDTRKEVKEAVRQLGVRTARITGKRIKITT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKDLQVQGERKTFYKEDAVTYNITTIGATTVKDSQGDATATE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGTIETGTQETTVPEFTKAETVANNLKPKYFTVTGDDLKART, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNRLATRGERYEAREDEEINRAWESLRPQEVNAKTGTVTLTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6100000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRFRVGRYDYEEPERTLITSAVREAGIKQLKLEEGNARVDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSETITLHGNTWRAPTPENVERLREQAGVEEVRLEDGRFSANQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGNVEAEGEERDVERLKRARKVFYNAGVSDAELSTGKVTFTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGYLTEGNTTESIPETTLAETAATRFGFETARTSRGDFKVKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEATTGKRRLKFERETKERTVEETIRPTKVTTYGTKNNVET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.889999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRIEAGSLETRRYNKSRLEETLEEVGFKRRKLRGEEATADT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTIEWGKNETTGAYEETLTRYARKTGAETKTTEKGQFTVYR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRVKFTRSDTKENTYREAEERATEAGFDKWEKRGGTIDADT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTELKLGDTKTKGTKETWIYTRVETAGATYVTKTGKKVKAYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTITTRGEQLYLTTTYTFNTAIEEIDPKEKKRKGTQANATG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKAKHGKTTEEAPRDTVLTSEATYLRPKTATTRGDTLRFYR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEYATFQGQNERATNTSEFTTLVETRGAYTEERRKGTKTWKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.120000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRYVEVEKTRTEWNSERTAHKFAHKAGVTEAEVNKGTAEIKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDQITRDGKERTDDRNSIWTKRLTNAGLQTAREYYGKITVET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTAERGSKTFQWRTQTEIREILERRGVTDATIEGKKLEATR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSETIFATGNRATADQETYWTDRIKRFGAYYEDDRGRKNEIET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQTARTGKTRKRIQETYTIETAFKNLGATEWEEESGTARVTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRVRAEGRRANGRKAVTKIAKRFDNKGEEITQYGDEHDLNQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEAREGYKTETLPRVEYFNEAWERTGIKHSEERTGEITATQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRFTKGRTNEYVETITTAKTWVTERGLQRVEAEKGTWDAEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTFTAGQIEEEGLRTYKIQTVLTRVGIEKVTLERGRANATT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQRANFRGRTNTAKRTETAEKLETKLRPTTIEDTQGELTVET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYDFEFRGNKKTIRRTTSAEQALTHVGLRTATTHGETQELYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKATTGERDDKGITTTWATTVVKKLGITYWQRKNGEVTATE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTQVYAEGTKYSLEKRTEIEYATNRFRPDEVETRGRTKKATK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTDASVTGLDEKNTETEYFSKAFQRLGLTTEKRYNGEARITK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTQITFNGKHHYLPRREFADSAAEEWKIDFTATEGEEFRVQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREVRAQRTTVTAPERTDLLKIVEDEGAHDLKTQGTRLRLND, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNQATFGRSTQEVHTPETFNTAFRQEGLETTETTGTRFTFQY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRRADLDGREKYAKETRTNTWADRRFYVTQITDTGQTATFET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSREITTGTQKEHVPDDTRVSYAARKWGAYTARAEGDKIRVEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSQNATAKGEQDTGVTKTRFYQVVKTQTVENAEITGTKLTVKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRHARLTGKQEEVQDTYDLTTLAKTAGLTTLTASGETVKITR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEARAGTTTDEIQYIRKVNRYARTAGLQTFKQRQGYVELTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKTTKAKGESKEDDYTKKAKYVAENLGANKQDQTYGDTEFST, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRKLSATGAEKDFEKDYRLDYKAETAGATNFRSTGTEVNIKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKAKLKGKEFRRGESVARRFEYWNNKGAKREEETGRATWKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKFTTGTTETSAKTVYNVSKAVRELGFTELEVEKGKLEAKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEYAKIGGTDKTATYTKEFETKAYTYGATSKTTKGKQVELQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEKVYVTRENWRGYRVKVLETTLNYKGWKDARAERGNAEVTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRTHFGKTYNEGATQRTASEIAYYAGIRETRHEGTTIRTKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRKAKIGRTTNRGYYPREVKEAIDYEGVKTVRYEEGTATLEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYYFSTTERREDIRNARTVNTVLQTAGANTATLRKTEVEFTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.3700000047683711"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKYATAEGQEVNGPKVRKRARTRATEEGIYVEVEGQTVDITE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTLRIDGENTKGLSTNVATHASTRFTVEYVHQYGTTTTIEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRSVKFTGNEIQEQDRRRAEHEAKTQGIKDRTTKGQEAYFDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.27999997138977"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRKWKWGTAKYDLNEETTLDTVFETAGAEEFSRRTGTATATE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTAQFGKRTKDGKTTRTAEEAHRKFGLKDFDESGYRVYVTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRVKIQGTERTGATDTTVKTVLTEAGIKRAENTGRKFYVRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTDIEANGTTFTVPTKKSIRTLERDFEPQRVERNGKTLTARG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNEVDIQGTKARTLDKTRAYEVFTEFNPTYEKQEGGKADRER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEATTEGTTRYLPEIQAVSEAWTHAGAREAKDRGRTVRWQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGKFRVTGEKNYAKDPTTANYELTTHGAYQVERKGDRLEATG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTAEVKGKKTTAYTVENVKELIDEAGITSLKVDGTTVKVST, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKFNFGETYWQQSKTTQLTTEWTHAGVEKAREQDGRATVNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSENATVTGQSKKATQPRKASTEIDKVGLQYFSTEYGHVNAYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTEVTEKGERATFPTPRTIDTVWERKGATEVTQKDGKADINT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGTINLYGKTQTGKRLKKIVQLIKEAGLEDATAEGRTLTVTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTQIDVTGRYLHYGKPEEVTHNAREKGLTKADEYGRRADFKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGRFKATGFKITTEKRESANTEIRRAGLTDLDTNYGKTEIRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEEATVGTKRERFETETRVETVVQRLGATRWRVTGHEAYWRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTARKTGTDIEITTAKKVTNLAKEAGWYEENVQTGTITART, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSNNAEFGKATVSLEDKTEFEKVLTRWGATRTETTTGTIKVEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSYEVRETGKRTKAPYVQTVTKVATTFGATRATLEGKSFTAKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSERLFKTGTYESFEEQNEARTAIKKAGVEKVTRRGGFAKVQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSKYVAKGPRNDEFHEVTSWETAAENTGIRSLKWYGKKLTVQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.910000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEEVYVRGNEREVTTYTFVSRAAREIGLTKTTTKEGKAKWEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTADAEGAKETFETITTATDVARKWGAETFYTNGQTWELTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSEQVKFGKTKKQDPRVKTVIDTYAEETGWRVATEGEQASATR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTQLKLEGLEYYAPTLHTARDQATNDGIRKVETTGTQATAKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTVYATGKRTYARTQNSAKKNVEEKGTKELKRYGGEIEIED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTDILAGTYNTQSRYESNAEQKIETAGWTETKYTKGRETLRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSGEAQKGRTEVKITDRKRFETIVEEAGPTTATVKGSQIRIDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRQLLTGETRARRKTSEVFHKKLTYEGFDEVRNKTGDWNATD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTTIYVGSTNERVETHRRARHVAETEGVKEAKAYTGKVRIEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.949999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSHEIEWGNRKTEGTRPRAAKKTFEEAGFRDTEETYGYYTART, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTRVTFDGKKTQDEYQTEWNEAVTTTGWDSLEKYGTRLTVKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRTLTTRGEKTYFDTPEEDTYAKRTAGIYKRRDKGDKASIDN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDTLYATGNNDTATTEKTLTRAIKKAGVTTAEEEEGKFKFSR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSDEAFVYGKSTTGVNPYNIETLFTYTTPTDTETKKGNKEARR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSRNLHARGKTLEVENPEYVKNLTTKLGLEDDKRKEGTTKVYG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSTKKYAGEQTTYGAEYTIFTTAAHSEGLRTTREHGYTKKLET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.790000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRERRTVYTRDEWTKLYETATREGVTVKVREDNGKTEIEAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYERVTVDDKHEFTSAEEEVRKTGRTEQITKTGREFRLTKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGREETVRDREKIQYLAERADDEGKEVEWEQKGERVRVKAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQHTRRTPEQKRAKSVLYRFEEDGEYLTVTKDRGRARADNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKNTEARERRKIEYWDREFTNTGRRVEAQDHQGTVRFETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEETNKEDRRDYVTRIATEWETRGARLTVEKEKGEVKFRAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEENAEVRQEKEVTKWTDELEETTVTADLNRRNGHIRVKIN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.970000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRDRLTAKRPNRVERAVYEVTEKGRKITVTETGNEIELTKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRNELRVRERREAEQWDKRVDTTNVDFEVDLTEGRARLTIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEKNREERDKFVYRVTTTAYERGTQVTAEEYTGKAHLNED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEKHNFEDRTNFTEVSREVRQDGTTVEAEVKTGTLDIEAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEVRATDTNKTEIYTILTDVKRTGEEIRVTDEGRRWEVTAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTTWTLTEKEEATEIKHQVTETGAEVRVYKEGDKKRWKTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRRDEARKNTTVTEFAYRLTTDGVTAYKTEEKGTVEVTFE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTEATEEEPKRVTTLTREITNSGVTLDIKKDNGTFEIRET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRTASVPETSEVEKAVRKSVTTGVQFHWEAKGGYISLRIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRTLRIRKTEEVEKVAETIREERVPNTITTRGYQATFTID, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTDTVFERNEEWRRVTTKAKRTGVTARIEETRGEVTVNLK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEENYEYYRENELRTVEHRADKSGTEIEATKRTGKKEAEVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTEVELRRNETITNVKDEVEHHGVRIHAETNKGTIRLTIH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.009999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKEREIRRTETANRVRDEIEYNGFEVRLTETEGEATFRAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEQWQITRTRELKKFVSKVDTYGEKRTEENRHGDAAARRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERDNNEHRRREAKYFENDLKDQDATVQVHKTQGTITAQET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRTEKAETRKELKEVQQELETYGEHLDEKRQKGNWEVKHN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.009999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRTAETETTHTVKRIIKQITERGYEVTLHRTGKRDEAKAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDSERTFNDHEDWRTFRTRLKTEGEEVKVTTTYGTAEAYIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRTVEASDNNDFEEAYYEVHKRGETVTFTREKGTVRFTAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.02999997138977"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGDQIYEDKKKRVNEAAKRVNREGQNWYFLSQTGTSTATEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRNKSEVNTEEKIRQLWTNVEDEYERWTRKDRRGRATVTVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGRRRQLDERERVETLKEEVREEGWNVRFNTDGRKATATFT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEERTKDETPTHAQNAVNRVTKTGRNANERYYTGEVTVTWY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.149999976158142"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTERHRAKRRTKATSFFEKATYRGEPERIETYGDEIRVTAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.02999997138977"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEEIRASTDEKFTEVKKILKRLGRTVDITHTGYRDTATLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQREFNVTERERVRRVKETVETTGRELDATLEGTRIEVTKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKTTTVYNTKDFEEAFRKITETQRELEVTRNQGKEEANNY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEKVRVPERTTVESWTYRQTEEGTYATVRRIGESIKAKFG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRTDQEYEYTNVRRVFDYAIREGQKIYLTTTEGEWTAKAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEEVDLTTQEKVTRFAKNFRTTGLRFEAERVEGEVKLSKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGTRVEAREDTTVTQAWDILDTKGWKVTVKRKGDEAEITWT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.699999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTYTVKVRDNRTITTNTEYIKTDGARVQEREEKGTLEAEWY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRYDLTVESSTNVHSVADTVKQNGTQARFEEKGPKVTVKWG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDNTDVKEYHKAKEFARTIENRGKHVDVTEKTGEATIKTS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQKHVERTQKDAAETLARELRKTGITFEVKTSGTKFEIRTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKRTREETREKFETIRHEVRRTGIRATVDYTGTTVNLEAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHEDLTVYTTERATYLIETFTRTGVKFDEERNRGRKRAKET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDTDEEFRNYERLETVERRANERNLTWHARTTTGYEEVEVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTVTVTSTRPDALRYLEDRIEEQGNTIEEEKRKGEWNFRIT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEQDTQATETYTVKELEREITRYGKKVNLTETGTRTYVYKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRKRTVEYERKVQKVERKIEKDGTKIQAEEEGEKWTATIG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRVEHEYDRTRNAQTWARTIEREGKRAHFTTRGTTITVTIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTERTERTNEEKVYKLTEWVTERGATVEVQNERGQFKWKAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYRTTRETKETELEEVAREIDRNGLQLTFKYTNGEWEVTTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTNKTKAEEDEKARTLTKRFETDGFEFRVHEETGELKFTAQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSETARVNENKLISKIFQKFREHRVTATLRKDEGKAEVEAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKKTIRFTRRNELTDIAETATEDGVRIKVEKETGTIEITVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERRLSDTHEENVERLEYKVRSQGKEFKARKKEGQLTAERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREEENWEKTDKVYRLEERLTNRGEKLRARERGEYVEVRTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSQRSDVKTEKELTTLERYLNRRGAEVRVTRNDGEFTLEET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKDARWDNTKRVETVTQRFIEKGAELTLRTDTGEIEATQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKRVTFYTYEEVNEITTTLTYKGIRVTTYDEGPREEATVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.049999952316284"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEHRENLNEKERAKTVYERADTRGFTVEITRRTGEVRFHAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTTHKAYRTEDVERIENEINKTELEVTKRERGKRATVELT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTEYRLNRKTTLQDALEKIDTTGERATVTKETGTFYVTNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTKAEITRTRVVESAISREEDTGYTVTVTTEKGKNELYVY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERDKEYHYREEIREFEERAEYYGTNVRARKTTGRVDLRTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDEERAPEREEFETVESYAERTGRYLRIKSKGRKVYVTTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKEKEAKDTREVREFRRKIHTTGEDATVYVEGKTVRVTAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKARFSEPNNTTWEEIATNFVSEGARFRVTQRRGDVDLEVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKTVEIEKPRKFTNLTESINKHGVDAERKTETGEVKFTVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSREVTREETERIRTRVTEFYQTGFTLEVIKTGREAEARTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDRNSQAKRREAAKEWVERFTETGFTLEIKTYKGTLKVTLD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRRAEVKKPNRVTKFLETFREQGLELQTETTGEEVTFKAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSANRREKTRRHLEDIAEKLTEVGLESEIEYTTGTVKFRRY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTEVRAETTTRAYNFRESLKEIRTPFTKKRTGENNEIEVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "2.049999952316284"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKREDEVDYREKFRYAVKRINHRGRDATVEENEGRTQAHEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTYETKFENTERLETVDREVDTRGTEVTTRTEYGERKVYVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKKTDTVNKRRLARTQLRTWEKDGKEITVTYEGEEADFHET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYEREKQTETEEAQKVKRTARNTGIKFTEQRKEGKAEWDVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREKLDIKESKTAEDARKDFYDTGLEVKEEDNGTERNVRFR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGEEIEAKEPDYRSRVQKELTRDGTEKEADRYGQEERVRIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKETWDIRKDQITKKLYETLTTTGTQVTNRYSHGYAEVERD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTITVTTRDRYDISELNRTARKDGVTVEFDKREGKNEIQAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8999999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKDKTYYQRREEAEKVVETAEKEGNTIRVHERGTKAKITDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEQERRKRRDTEINEWIYEVNRTGYEAKAEKREGEVEAKAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.049999952316284"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKKRETVTRETYANTVKEKADTAGKPVTVKEYDGEWQVEVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEEVRLESTTRLTNAVTTALRNGLTITFTRERGKLEFQND, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.149999976158142"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTEEERERNRRVTDEAHRFIETGTEATVSYTYGKARATVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTHTVQVETEKHAQRATERVEKTGIDVEIRFRGGRVDLSLG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKETRDVEYKNEFKTVRDRLTQEGGEAYAKRTGRTETFKIG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEHNVTVTTRTRATDVTERVRESGVELELHTRKGEFEIKEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYREDTYKTTEKFETIENKAVNRTITLTAKREGRRVEARAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.139999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETENKVTNEEKVEEALYYFWRQGNDAKAEDREGNATVTRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.990000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRTIKIKEDEKFTRAAYELRDEGEPEKIKRYGGDRRARAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTESRTTTKTRVLTEILRTADELGWRVQLYNEGEKAKITIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRTVTIEETEREHDANDRLEERGFRVEAHKETGRIEVELR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSENKKEVRDTQYLNKAETSISTEGTEVNTFEETGTLVVKKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNRQFEVTEYTELTTAEREVNDLGKTLKVSKTEGKVKIREG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGETRRVRRSEQLETAKKTVKYHGTDVTFKRRGTDVTVTEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEETKKLKHKTTFRSWTNTFQEKGREATFDTKTGEVDVYAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYTTNTIDKPTKATDLVNNFEEEGRTAYIETRRGEVTVSKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEERTVEYTTDLQKVVEYKEREGQKARAKRRGETVELDWR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTNNTTADTKKEFNTFLETVRDRGAYIRLTKETGTLEVEVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREEKEVKRYQKINRALEDWENTGETVKATERRGNVTIETN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRREKTIKDKTEVTEVEEEFRKRGRYATFEETNGEARARKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETRTEVPYRRSVETVETEAYTRGIERELTKQGPTNTLDLG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQSYTTEKEPEKIKEARTKVERRGEEVTFEDNRGEVTIDKH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.4900000095367432"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRRTSFRTREEAEKVTNRVTDTGREADFRKETGYKNVQQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETRDKVERTREKKDFTTRVRETGRTWTVYSTQGEVNAEVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEEDHTKKRKKLNTAEEEIRTEGWYARATTEEGTVTVDIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTTKDVETTEDARTIETTFKNLGVTLEFKRRQGEAEAKRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKTVKLTKRDKIQQAWNRVTDIGIREDLDTETGYATLTAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYWERRVRYNKYIEEAIDKAKRTGEPKKATKATGEETVRTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHRTKTVERTYTVDRWVTTLEERGKTFTAEDRGTEATATFK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKKTQVPYSTTVTTFATTADERGKSVEVKQNEGEYKAKRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTDKIKIENKRTVTRATTTFDRHGTKVRVERERGEARIEAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEENLEVERTKKIRTLERTVTERGFTLTRENSGKRLRVDAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEETDRTTKKYELRQVQRRVKKTGTNVYANTRGTEVKAEEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKRARATEYSTFKTVLDELEDDGEYVDIRTTGKERRVELK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRDKFRAETRNKIDEIHNRLTQRGVNIHVRTEEGEITVQAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTRQKKKRETYLERAIRTAEEDGIEVEVEYDGYRETATAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEHKNVEEETEWDTAKRKAKRKGIEENTSTKTTRLYFDAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEENREEREEERWRTIYRYAESRGAHLTVERKEGTARLDVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKNSEARTKTRLERVKTTFYTTGNDFREEHEKGEARIKTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRYTTKARETTEFEKVTTRANKEGDNVRTKVTGGNVRVHVS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTEVKAHKKRSITTAINYLQEYGAENKVRTRTGEEEVEID, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTNKRLEYEDKVENITKTVRQEGIEAKITTATGTKYVEED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.080000042915344"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEHATVTTYEKVKRIIDKLNKEGREVTVTSKGETKDAHTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKKERRRTTTTAETVLREVTYNGITAKFEDTEGHFTITIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.019999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTKRTFEEEKRVTDFAETITTENRRVTIETRGREFDAKVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKVTVEAKETEKIEHADQEIKERGREITIRRRGTTIRVDVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQREVEVERREEANRLTRTFEDEGRRPDLKRKTGRVQAEAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRNDNNRTTYEKLRTAATTIRRDGLNIEVTTTKGELKVRVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDKKKTVTNTKSIKTVREVITEEGRNFTVEATEGQATAEWR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHRDLKFETPTEITNVKKKVERTTIKVTTRDEEGEANANFE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEETKDVEDKEYIRRLLQDVQRKETEYTLTTHGNEITAEKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRRFEARETKTFTKFATEANREGFRLTRESKGDEVTITVG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRRTTTETYELRYFTREASYNEPHTLEAEDKGEEDEIERQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.700000047683715"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTTEKYTDRYKVTTWAKVVRYTGEEVYTREENGQKQITAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREKVEATTEKAVEKLATEFTKRGTRITVTEDGTKLNITKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.9200000166893"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTRHRAKEKETFEDAEREIDNTGDPFTKEKTGKEAKWEIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTTFTAKEPKTLTTLVTRIDRNGKKAEADVQGDEFKVRVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8600000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTKETKRKRERAYRVETEFKTYGEDARETKRNGEDTFEAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERDKTLRYEEHLDELASKATKTGQRVTYKRQGRERKVEER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNDTVRVENTKTVETAVDKIRTTGETAHLKYEGETTRLHVY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKKTTIDTPTKARHFKNYVTKTGVYFETETEDGNLEVKVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDTDDKARERTVITKAETTVKHTGLRLRITTEGKEATVKIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTTADITKNDVVTKLRKRLTEDGEELRTNTTGKKIEVQVQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEERDQTDEKVVRTTATYAATKGLTVKFDETGYEAKVTVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQRRIRARTKEDIETFTNDLTEKEDKVRVDEKGRRVTVTAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDTEEIETPNTVEEAFRTVRNKGVYATVNTNRGEITLRAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDNWKVKRRYELTTADRTVKYTGAELELDNKRGHAQVEFN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNLDIRLDEDERVTKLEEEITTTKANIAQRKYEGKRTVRFE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKNERETQRPTEAYHVQRRAENEGVTLEVTKEDGKFTVKLY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRKIYWTRNKVFHTALKAATEKGKETTFREEEGEADAYVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYEKYEAEYKTKVKDWFESLKKKGSTTTTRTTGHEITFKQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEKEEKNRTTYWYTVIKDVKYSGVEFKAETKTGQRAITFE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYDTLRATTERLDTNAQRTVHNTRVREYTERHGERERITIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTTIYIDTNEELNKVVTERVETGKRLQWKKTTGYANAEIG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTNSEYTYERDTVRTAVREAKTEGEKWRWTETTGKIYAREK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYNEKHTTYKYHLETLAETAEREGDRAKLEYTRGEKRVETT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRRTTVRTDNEVETLAREVNTKGETVKLDKKKETATWDWQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTEEELRKRTNVDKWTKVIRHTEAEVTINREGETVYIRAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEYEAEIRETTELKTFAKEVKTTGRSERLRQTGRQVNLRLD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQQKFRVTRKETIRTADTLFTSKGVTTTEERTGDYVNWEAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYEREQDERPDNWRTWVYRAIETGAEAQTTENTGRLKVERK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDTTEKFNTKKYAEEIVRKVETTGAPFRHTERGSQLRFRKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKETEKLTEQDVVREIRRDFERTGATARLKYHGTDVTVTAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKTVNKKERRELQTIIDRVTKTGTDFTAERDTGEVTANIT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.009999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTREEETNPKKFYEVATEANKTGRNIYATKTGERIEAEIG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNQKRNAKTKHTVDRVETEARKHEQRVEVNQTGYKVEITVN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.680000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHLRVTATTDTAFETAEKNFTKVQKDARTTTKGYEETVKID, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.330000042915344"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQQRATITETTRLRKVFTKLETERDDVENTEKNGTWTVNAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSESEEKKYTPDTARDVKNRITRDGTELTAKFEDGDVEVQVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKETQKKYDEKTAYTVAERIDTDGRTIEVDRKGRTKEAEAQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDTHEYLTDPETVRRTAKYITTTGAPVEKRTYGTEVRVRFR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTTKSVTKETAVTELFTTATKQGEKAEIEERGTYFRFDDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRANITAETTNILNWVKTWWKTEGGDATVKEQTGERDLYVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTETEHADEETTVDTLREQARELGVYWYLKKRGKTLRVRFE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRNWTAKEDRKATKLLDEVKEKGFTAKADQDGTTVTVTIY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKAEATIERKRRVEYIVRNIYTEDEENKADNRDGRKTVEIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEHTTRRTRTEKIQEAAYYVKEDGHEAKKTDHGTEFRVRAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTRTEEDRDHKVTTIVKTATNRGAKVNAEQEEGYAKLRWE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKYARLERRKTIETFADRLETRGKQKQARNEGEYATVEWR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHSERYKPRTEKADTAQEKVYDYGGTVEVETRGTEIKLEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKELRIKKPTNVRTQTKEIERTGENFETDRNEGRVRFTAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRQFEAEHPREAEKVLKYIRYEGTRSEVKTTKGNTNVETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREKEDAKETERAEKVFNRAVRYGETVTATQKEGYFKVTWT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKTATLETTENIREWRTTAKDEGKNLRVREFGTRVKFTTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEYDDVKTNERLRKFAYSLVQTGAQATAEKTYGRDFVSRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQKNEDEYYEREITTWVTRAEEEGKRWRVTQEHGRAEAYTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRTKRLQQNTTVEEWAENLYSTGRSAKVENTHGDFKIKDD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKYEDIEEYRKATTIEKVVQETGGEIEVNTDTGTRRAKWR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETTFHWTQTTTVEYVITAIRKTGGDAYATDTGQTEKVTFQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKERNTEEKEERAKRVDRQAYTKGVTAKFKTSEGEFELTVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKQTRDKNETEDVEHALRNIRHYGIEVTTTTEGPTAYFRAH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKDLDIRSRKAIEKARTTVEEEGARVTVKNISGDIWIEVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQAKITETKEDEIERIVENVYKTGWTANTKKRTGEATITLK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.240000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDRDATVKKRNNVTTATETINNEGVTATWYKQEGRLEVTFK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTYTTEARDNTFVNYVFREVTEDGTTVKWTARRGYAKVTAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERYDYTRRREAVRTVVYELVTTGHEWQANKLRGELAAKQD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETRRYTYKPTAATEAINKVSTQGFKIEVRERKGNLEADAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDTEVRVRTPTKAHTAFETVNTTGEEAEIRKTEGTVNFKVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGKETTTTEKTEIKTVTDYAHKTGITIKARTDGSKFKAEFG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSENTLTLTQKEEFNDIEDTVTKRGHTLYWKKRDKELAVRVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRERKARETKAITERTEEAEERGETWEVEYDGYKARVRQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKVDREFTKTNRIEDIRTRAEKKGETAEAKEEKGKITFTVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTERFETTYTNEIYRAEKRVHDRGATLTRNKEDGTEEATLR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDEKTAKKETRATTWVETIKTNYLKTNVYQEDGKATITVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKNEKTVDEPERANTAVYRVNREGETVEWTHDGTRVTVTWT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHNTITLRTTKRVKDAIYELKRTGVTVTTTTNRGEVEVEYG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRTFKANERDFITNWETKVTTNGVEFEATTEGRNVEAETT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETNRTVESTEELRRAAEEFTEEDFKINFYQERGRLTLRRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGTEKKLETTERLTDAKDTFEHTGFKFEEYERGKRAKVEIT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSSKKADLSRPTNFTTVTTEIERRGTKVQAKEKGERVDVTVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNTEIKLYSQTTLTKVVKEATENGIDARTTTTTGTVEVRLK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTVKVRQRRNTKARQFKTEIEREGETANVKTETGTIEVEVG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDRTDTINTTTKAETVLRTVLDEGAYVHFREKGKEVRATLD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTTYDETTRYEAKKLVTKTKSDGFTADAEYTGKTVTVKLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEETKTVPRPRTIETAEKYVATEGDQWKLSKTGRKVTNEAY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKEDEIKEEEVATNAERTVEHRGRELSFTDRRGTLTLKRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSENERREKRERKITYATRYAREEEHPVEVTTTGTDEKVRIT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTRVTETKTRTIRYAEKEAKEEGETFTATYDGRTRDVRIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTERVRLKTRDEVERLDHELKDEGGTVHEEKHGRKITLRAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8199999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKIEATVKTPNEAEKIVENARTEGTKVDITETNGEVTIRVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRDNVTVRQRRDFTTVAREAERTGLEVEITTKEGELNLKVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKSVEFRDDTFLRRAQEALRRRGTNFQWEEDEGEVQLTVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKEVEAREQERLKNAKRRVLYEGNQITLTEEDGYDRVEET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNHDIEVQERTTITKVATDFTKTGVKFELKTRNGDLTIELT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKDLRAKEETTITDLLRTARQTGIEVEVYRTGRNSEVTKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHEEDRATDYKTLKTATKTLRTTGVKLTLTQKGEDLTWRFY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKKITIRTERTETDALTRVTKRGEKFEVTEEGERVEVSIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.4299999475479122"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSGETTKAKDRTKFHYFQEYATYEGRKLESKTEGGEEEVRTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTDTATVKTTRRVRRVETELTDRGHKVEITKEGEENYAKIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTYTTAKKKDTFKSIVKKVEDYGNTAKARHEEGDEQVTAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTDVKVKETEKARKVVTTITTTGDTLTVTEKGEKARIKVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREDAEQKTETTAKDFYDRFKKEGLELTERENGTNWTVRES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERRRETTTNERLKTVIEKWEKYGDTVTATEEGRDLTVTER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDKEVNADTRYRVHNALKTLRTRTFTIEHNQDEGKKEFKVG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRETTTLYTQKQWNKAVTEAVELGTTARVENTKGDAEWEVG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRRTTRLPQKTQVEELKREVTEKGEEVKLTETDGEWNARTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSHLRVYAKERREIYQVLNAVETGGRDVKIHTQQGEETADAH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTNDRTVERNKTANSALRRATYKTVEFEFKEKRGDVTVELK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKREFEIEQRELLRRVKTEATDKGTNARNEWRDGEVTAENE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQNEIKLKTPEQVSYITHSVTEEGLKLDKKKTDGTVRADQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRDAQVETEEKVNKLLTAATEQTVPTKWQTDGRYAEFKIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRLDLDEKRTTTAKEIKREWENTGKEAYLNHQKGYLTANVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYTERTETETKNIRTFVETVKEEGIRATATNEDGRLYLKRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTKETRATQTNEATTFTTNVEEQGKRITFRTRGDDLTFTER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRDTVTIRETQVLTEELETLDKNGLKAEAIQTKGTNYIRAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRKNEETTERRRATRFEKTIYNEEAEADVERKRGETRLYVG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETTYREKTKRETDTLKTEVRKSGVTFKAEDEGGTVEFRFY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.680000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRTRFTEEDERKIDTVENRVETKGAELRVQKQGRTAYLRAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSREKRYANTPETAREVTKEVETTGLRVTTTIEGETLTVKLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEVRIRFERREYAQDITTTADKEGAELTLRRTGEHSTIEVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTETSKVEEQTTIEKLVYRANETDNTRKATKYGKEAELRID, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRDRTLKTETEVRRIATHVTRTGDTLRATKYGEQLEFQNT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSERHLRETSTRDATRVEREVETDGKTFTVTYYGKKAEVQRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEKATLNEETTLTRATNEVEKTGLTVEAKDTRGKFEWKLG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRDQLTLEENRDFETATRDVRNTTAEVKITTKGKRFEITAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYDDITKEEKERIDRATETVTTKGIRFEVTREGRAERLQVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQNRVRVEHEKRFENITRTLETKGAKVKETRNTGTLTLKIT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEQFKAKETTKVTKVSYDANTKGGHVTETERGREKTLTET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8199999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEERDTARKPYTVQKELKYIETEGRTVDVWNKEGTVNAKRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEEKAEVTQKHVIEEAAEKVYRRGKTFTIETRGRTLQVDLG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRQREQARDDYLVREFVNTLNTKGVEAEWEKEDGQLAVKVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSNTKTQNTYTETITEVIKEAENYEEHLELRRRGRQARATKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKERDKREDYEEVRTALTKLRETGVNFEKYHEEGTATFTAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTQRKDTTEYYVERAVKKVDTKGTQINWKKENGTIKARAT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.949999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQESWDVEQRETARRATNVWTKKGWEWHIRREEGEFRLRVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEDRSTLERKKNTNKVRTTWTDKGESLLTYQEEGRIQVRHK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.980000019073486"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTNYETQTEKTALKYVNRTIEREGVELTVRRTGTKVTFEAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.9200000166893"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSETTAKRYRKTRLTYAEHEVKEDGLDLTVRYTGSEVEVTRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYHTEERTEEKRLRTIVNTVSTEKLQVKAEVYGDKFRATVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEESEAKERTEWDQLVQKVRYTGTNATVTKTGSKFTIRTT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTNKQKFERERTVKQAVTKAQDEGFNADLYERTGHETAKVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEKNIHVKNTERITRWAREWEKEGTYVKTRTEDGKVTATVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKKTITTEEDEKVTRVREEVKNRGRQAKAESKEGEVDVTWT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSYRTETAHERDRARKVIEKVREHDKPSDVTNEGEEIKANIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKQDTERRKTKKVEEAWNKLREVGNTATIQEREGTVQVYET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTAEIRTTKHEELTEIFRRAETEGEQVKIHTEGTRAKIEVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTTKDEVKETYRVRKAVENISRRGIKLTATNKTGELEVDEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTRRRRTEETTELYTAYEEWKERGTYVTADKTGTTVELTET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEETQRTKTETEITEAREKITTYGVRIDITEDGDRLTWKAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEARDTWEKPREVENIETEVTTDGVRLTATRKRGEITIKVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSRETRRTRDEKELTTAKETLKTEDAYAELNNYTGRFRFEVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKEYTTTTKETEVTYAVETFKEYGARLTTRKDGPRFDLKAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSTEKITLRRTYKLTTAAKEITQKGVETRAEKDGENVTIKIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRTKHTDRPDAFEDIVRTAEREGYHAKVREEKGTADATLN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.740000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDVYAKIKSTTRLKELAQKAYTRGRDETVATTGSEDYVKQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSQRYSRARTTQEFKEAITEIQREGFERTAERTGQDVTARLK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8399999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEETATVTEQHDAKDWVKRIVTSGATVEAKERGTRRTLYIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKTKRYIKSRNTLKDAVQKVRTTGFQITARDTNGEATLHWE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSKRRTTVDTETTLEELSRRLEKTGVTARFEYEGKRANLEVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSDESERARKDYVVTTVDEKAKTEGTTIKFREEGRTAEWTKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSESTAREERTTQLYDLETKVREKGLKATLDTKGETVRIETD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8999999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GSSEYTIKAETEDRLKEIVTRIETKGRPRRAETRGDYERAEVT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TSQDANEAEEYLKRRKNIEQSGSDLENREPKFKSRLYEAAKEF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.939999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RYVEERLSEVEETGQESADVERRRDANKENVRYAKSLIRQAID, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ELKSVFRSAKRIRETGRPAEIGELRAESEKDLTQLENTATESE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.829999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKEEAKEINRIVTNGKQARIRRELDVRPGDKEFENELSTLAKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEKERNAAKQLVQNKETVNKKGAKVEPKSYKIENAIERWTKLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKETEQVALRFWDTDYPVDRGELRARPNENEAKKRLEKANNNN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.990000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SKETSSAVQSAIRKGDDINARGERAEPYKTEVEKAFKRIEEER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7300000190734861"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENKSEVASKLVETGTEELKESGVNVKDTSPKLEKRVQYAQKDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEKQLYKIVNVAKDRRRATWGRTQYSVQEPRVDEDAQKLKNEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETYSAKFALEWEKEGRPARLTGTKWKPTNSEAYKFIEAESTII, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PETQWEKFINANEEGEELNIKGQYNGPREPEAREAKEYKYKAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEQAQKWAADATDNGVENAEAGTLRWKKPRKFEKVIKRIDEYD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PYSYLKVLEKARRDQKNLEYGRYEAEAGNDELKRVEEATRYAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TEAERAAYYLENEGEKKLKFKGKSQRIRDPNKLRNFITWFNES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RETEKSKLNTDLYREERAKVGSEEYKVGDEKATEFREKLSDAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRERYRKTLRTAVEEGEPLSWGKFEANREQLAQEAITAVQERI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEQRANLAAKALQSSDEIYAKGTKVPPQTRTLERWANEEKRIL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETTFQYAEEALDRGKKDADNGQKKFELRRYSWAESLDQDVRKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RNESERKFEKKLKSEGYPLEIAGRESQKNDKASEAARYTAREK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PYKAEEEALELELEGYRQDTYKGDRAEAYRPHFQRKANNRKDY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEREKTFLTRAVEKEDRFTAGGDKIRAEKDKIKERAKRAFEDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TETEAEQRIEKQIEKGYDANLKGVSLENTRRTDDMVNNRQSLL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RADRLQRSLDRVVTNGETAKAEGIDIETPKELYEAVNKKRKEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7300000190734861"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKARQDLWQVANRGTTQASVGESELKLKEPTWEKDWDRAFRRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EYKIKKVTYKAQESDKKVKVGNKRAEEDESNDESRVRYRADDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GREVQRIVTEAYRYGASETENEGFYIDLREPKALNRADEIRSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TREQIAKYLRNAKNEKREVEAGQQRVEEEESIKYLQTWVKERR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKKEEASDIKNRLKTGRTVSATGIELKQQRELTQADRTLEEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDDAIQEFEKVKYYGERVQLYGDKLRAGEDKAQDAFTAKYSEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NRNSRDDIRKLVEEEWEELDWRGDEWQRKYRETFSQAQNEAKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKDKEKEAEEDITEGDTAYVRGERVKGGSRDWIREVYRKAKQR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EVTYAEKDLNKIAKQDEEVRLVGAKLNTDRRVETALERAESIV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RERASVALKFAKDGKSSARVKGKEFEIGNKKAEEALTEFRKLR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.220000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EPNKAKQEVEYFLDDDRSYEARGINAKRRENATSVYRFTKEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.829999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PETYREAWNQWWREGNRATEQKTEVKAGDEKVRRVADKAEEDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EATQEWREINKKLQKGTSAEVRGAEAERPRWVSTAKTLINTRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERKVKNEIRQQVEDGRPADAGRDRWPLGREHAAEELYEIATKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NARTIRKTAQDANSEGKEVRIKRGLKINESREAKKIADELYRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YDETEELLRELLNSGKPARAQGVTFSPREPELYELDKRNYQEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEERITRRLKEWIDTGTRVEAGGLKLKETNTAEQAERIIRQTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8999999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERTLLQNADSAIEDGFRQFSASGKRFRAKEEEKVERWAESEKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EARTQVHEQLDTQGLSEFRIGNEEFELSKPEEWSRVEQAKYKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETKERTVEQVLENGSQKAQVPLGVNVQRAYPSDVSQAKRKAQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.980000019073486"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PRRKARRVWRAWENGANSQEVEGLEAEPGYSLDEYVDSYAEEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence HPEDKAAAEAFERGRTQLEVRGKENVRADEEKYWKRAVSKSEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.120000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PQEVYDELEQDVNEGRPLDLGKESAKGGSRRKARKVRTDVDNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RPDTFVNKFQRKFREGTTLKAGEITLKREEEAKTIQRRADEKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKKATDSVKTVDQRGVKNIEVRGVDFELEKDSDANKLAEDVRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EPDASEVKYSLEEAGVQRLNVEGIEAQPRSPEAYKYKRKLSQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.320000052452087"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKRAEDSAKEFFEEGKPAKLKGDKEDSPYKEYAESFVTDRDRH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TSETQTFVDKIEDKNKYDAEIQGDNLNAKKKTIKSIAERATKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TWNKDAKKLSEDFSQGKKIEADGKQAEQEKQLREARKEAEREV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSDQKKNLYNKAKKGKTLRASSDDKISPEKQNVTSDIKEILDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DTISRSALSELEGGLKKFRLPSGDEIKVDKRTALDKAKRDAER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RPEHRDAVEDAERKGYPVNLGEKTLDAEKPDFKERLRRVTEEF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EPQDIDKKAKRAYRYGEPWEIKGKEKKKFEDLVRALDEAVKRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QPQKLTKLIEELNEEGKDVRVGSIRAEEENKVKRIAERASKDI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAEKAESKITYRKYTGEELRKYGEKLKTSSELDKVAEAITSLN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEKEADAILRIEEQSNRAKAYGRTWQASNKTLQEAFERWQRET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDYTEKAAKEWVTLNKTTYYGGKYAKAGTYDVNTAARQKDQEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SERVVNKVNRVLERGADQAEIYGIRWDAKRQKKNYDAYEADSQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEEEKWERLSKEVENGTKARAGTIQVTQPEKLRERLYKATERR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRREKVAAKAFNYGLSDWRAGDQESERGKEEAENAKKDLERWV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQRRYFEWAAEARSQGYTLREGDIEASKEEEVRTWDKYANSAI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKTNAQEELTQWTQKEEKIQLNGLEADENRRIRKVLEDIAERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GNAIRKITEKAQNRDHEQYSAGEERVKAKRDENIREVYRYLQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKNTQATEIEKIISKGKPLEAEGREIEEPRKVTKAAERIESRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERKLENVARKAEQRGKKAEIGEAQLKPGDEEVLQSLATLKKEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESQKALRQWKEEFKEGKKAEWGPAEITRERTAKRVSNWVYRQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KIREIRTEWKTDLESGEEFRLQGLKVRRKNAAENVAEDNERTS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAREKWTQAEKKVRNGREAELGRAEVEEKKQVNSLVEALSEKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKLRKVREDVEERRIRELSISGVEAELENTEALTEWARLLREN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TMKYSTEQFTRLRRSGHPLQWEGVKLRKQDELQQLNEVWQNEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DRREATEEIDRILTEGTNVEIKGIEIKSKKTAKDFVDVAYQDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PIRTAKEEVTRIFRYGDGVEKDGQQLYRTEKANRLKRTAKDET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERERELEQAESEADKGYKWNVAGWSIKRKKYARRFLTAAEEVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KVKKAKTKAKEQVRESKRVSWGKAKWTDRNTADQAAEVLEDEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKDKLREFLKDANEGDQVKARGEKIEPGNRAVSEWTDKVNEAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKEKENRLEKNVKQTGTEAQIKGRTLDKPKEALEFLLTQDETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PRQLNDVRYEAKNKEKESSKATGLKAKWDYKKAETAYKEVQSD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.870000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TEEQAKRRANTLRREGYRVEVGREELEDSEEFYKAAKRLEQRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PLTYELDEAREILTKGGEAKDKGEKLRRPENAKNAFKQLDKKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GPKELRTEAYTRLRRGQKAEAGTVRADEEERAKEALETNLEVR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NRERAKRVKRFVETREKVNLRGWDASAGDQKLENATTYLDEEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DDKKSDKAETFAKEGKKVQAGGRSISPYEPHLDRRAKSARYEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEEEAREDATKEADRGRKVEVTGIEFENEKNVDTIWQLARDQQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RSELRYVVEKFENGARKVKAGPLHWSKTQEKLVDEAQRANDRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KVKSARDKLSKIKNERHPVKLGGIQAEQNEAAKTADEWAHREQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEQRRERKIRTVKNYGRERSLEQEFTAEKRSRFQNAIDLWEER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RREDSYTLIDAKTSGEPVKAGYDQASARRKTWKEWLEEIKDQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.949999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PPREVKKEAKNAADDEKYIYLPSGLRLTENKRVTEISKKVQEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TFNEEIRELKKRVTEGQEAKAGEVKAREPREAREAVRELEKER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENNDRKKKAEKVESEDKKIDFTGAYVRQRKALTEIKQRAQKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEEKYAAARALTSEVPKVRDPGDQKINKNSEKLKDLFTNRREN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DVSEIVNRATEKVRKEYNINLPKGDTLKSEKSLTDLESRIEKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RERQDRKAIEAIETGVEDWSVNGEKYNLKKEQAQKRWTEAEES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RREKVEETFKNELEEGDPVYIGKVQAKYPTDIRNLQKAWKRTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NQSAENANTEARRNEAKRLRLTGLQVELGEKKRLEKVFELLEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKEDTVESELRRERKETVKAKGAEIRFKSNTINYRAAKALKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8199999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DYEKELRVARRVQKKGNPIDAGREEAKEEERATDLRTYEKKAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RYYKERAAYKAETEGKPAEATGYEVEPKDPRLDTIVEDKEKKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.240000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKERNAEDLTKAEEKGGRWEAKGRYVEKEKELDQFKETLKRRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKQTLRSFEKLRDKKSNVNADGYEKKAKTEKANKEVKNARESL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETEENRDAEKRATSIEEQLQAGTKNAERTYEIKTLAKFWVTDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.080000042915344"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEERKVSNIVTQAKEGKPAEIEGDEAESPRKFRQAEDIIERRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PNRAEKIVSEANKREEEIRAEGIKVTINERELEKDARREADEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDDDRAKKADEAWEKNEPARAEGSEATEPEQIEKIVKRFRQND, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRNVNRRLVKEADDGVPKASIGKASVEVETPEDAEHFIRSLIE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RYEREVLVKAENRGRDELDIYGDIRIKAKTPRSAEEAQSEERY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RYRRDVLDLALERGKEYEKRGRRRLKDDYRDVEEKATSAQEEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PNRAEREFERLLRGQVKEARAEGRKIRVEKPDNDRDAYEIEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRKTLRQKASDTLDNGDPANVEGATVEERKELKEVAKEAVKRL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EPRKKLDRAEKIIQEQKSLEVNGKTAEQEEDLKKAADEFKERL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QQKKRNAAIYAAEEEQEKKVEGWRWGPSKEKADKLANKFETEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.120000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAEKLISRAKYALKTGETEKIPGGDKAKSPQRVTKIYTTVEKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESEYLKRIADARTSGEEANANGQEEPLGEQKIYRALKEWQEAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAKRALKDWKSRLEQGESLEVKGNRVEKKNRLKYAVTLWTEAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.810000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PLRKARKKAESRVEEGQTIYAIGVKIEERRVAEELARLERELE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SESDTLWIEFIKYGVRNADIRGNKKRLTTREIEEALKRAEQRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RQTADSVLQRISKSGERLEEKGYEAPPGRYEVKYWAERKDRKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PNDEINKWLDALYEEKRAKADGLNAKPGERKIQRAWRIFESAQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AITSLTRRLRTQVSEGNYWRVKGVNEKEPRDLEELAEEAERQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RSIQEEIDRASKKGVEKIEINGQKFDLRSEDEKRKAKKAAEED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.850000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KHDETSWVWNWIEQGKEELRVKGARAQINRYTANDLASREEQS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TARQITDTVKTEVKQGEEIKAGKLRLEKKRDAEEAIRVWEQSV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NSKKLRKSLKEVLDEGKDWYLGKAEITKKDKWEQVKTLAKNVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DIDSIDTELERVLREGGKLEARGLRLNNKRAVKNVDQDAEKEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.059999942779541"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSRTKKAIASVAKVGRPFKAGEYSLKPERERWEDLARETQEEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TIRKEADYAKKIATRGGKATASGRETYEEEDLKEVIDKFKNTN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRRKDVIEEAIERGLKDISLDGTDKEKDEYQAEQFENSARSTF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TWDDADRYLEEALQQSRPAKIGGKRIKEPTEARKIVNTIRKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SRFISRLEEELEEGAKKLKAPGGAEATAREPHRIRRILSEAVG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REEKELRRLKRAAYKGKPQSAKGRYTTEPETLSRLANKLEENL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENQKTAALTWQRRGEEEASFEKRQSVDVGYYDAENLSKYRKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.169999957084655"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKEELIRELRKSAEEGRDATVEGADAEERQRIKEIITKATKEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RYEEVDTIDQAKKKGADRLEARGQRWTNKEYAKEFFNEVEELA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TPKDAKDKAQELLKKGDEAKVVGAYFRDQSRLETAEKREKSTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKSIESALEKLEESEAKSLYIKGRRLEKTYPQDLRNAVRKNIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEESREAIKKLAKTGEYASKEGIKVEEQSYTLDSVKNYYRKEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KENKELADEAIEEGIDELKVKGAEIRKTKERWNRVIRRISRSG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRVTNKLIKSLKEGARYAEAGDEEFKWRDEEFSSEVKELYKRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.190000057220459"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEDKNLRSANSVWKKGTKAEIKGVKAKDKDQVTKADTLVKQKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEKVYDIADTITRQSEKDHVKGAKATANKDKAIRKLLKLADRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.850000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NKKYRDALRKFYEEDDRAEVYGNEVNPGREEAREARTNYEETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KYNESEDKADSKVKEEERRKVTGITEERPKNFIRIARKTQEDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PERDARSAQRLLYNKRTASDGEATLNITEPREIENAVEQLLKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDREKKDNANETARKERPAKFIGASAQEKEKLQRVIKVVKEDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKQLDAAFRVNDSGLTKIQLGDERYKNEYEKAYKWRDEISYES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAENLREKWEKRIENGRKADLRGVQLEKPKTVNRVVDEATEQL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TEEEQREFNEQAKRIGPNAEARGKDVQSPTEIADLIVKKRQEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RNRARDYVEKANERGSPADAKGDEEEWRYEERAERLIKVIEDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAKDWATRLKTAKKRKNPAELGGEEAREPRAFSYLRNRWEEKF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKEEEANSLETKFDNKKQFYVEGSKIKEPERVREAANDAYERS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DAQKAKEDLRRVLTEGKNWREEGATVREEQYIRELVKTLRKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RENQETVFAEIFTQGKKLRAGSKRADPEEKRVDDVVREWNSQQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.790000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PVKRASEYVRKFANNGKPLDKKGDEARREEEWQEAARKITEDY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKKLYDNLKEATTNEIEKLTAGNRRAKRQEPEYVIRLIKTALA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PREKETREAKTVVTTGRQIEIPGNVELKSIEELKEIAKNAQEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-1.350000023841858"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAKEKLTELKNAAYEGKKLEADGRSQDEEQLRNIVRDLTKDLR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YNENVRWAEEVTRERQEATLRGYRLSPGRKADEELKKEWDQEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.9599999785423272"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEQDEFEKFEREFDRGEPLKVGEARVKEREQVSKARKEATERR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DETREKEKAERQLKKGDPLRAEGKRIREPTNFQRAVENWAEKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YQEKWEKAADVVETGAKKVNIRGTKEDADERRARKDLEYIAND, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TAERTEKSLKESIRRGERVTLGSARVQKREIFEKAAEAVKSEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.949999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDSAEEELQNIREYGEPFNVKGNYAKPGRYTWREAEERATREA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YNEKEYIIEADKKGARKVKAGKKKTDATNDRLYSSATRLNEKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RNQDRKIYKKLEQRGASEFEAGNDRWEAEDNRLIEKLAERVDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TVKTEVETVKTKAETGREVQAKGIKFNRRKRLEQWARLAEEDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKQRHKELAQLWRNGKEVEFDGTRAKPGKTWLKDLAQAVSKDI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence STNLEDAIELWRTGITELEAGKDDYEINKRQAKSRLKTKWERR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8600000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKEAEVFYTIYERRSQQLQAYGLRWEADSKREAREALNEFEKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QDAREAYELAQKLGKTKVTYGGLTLDATSEEVRREIKRAKKED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKAQKLKRLIDSVGETELQEGGAKARVEKYKATTTAERLEYDD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.019999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RTSTAKREVKEIADEGERLRWGSIQINESEKVEEILNIAAQRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence HRAQIKAAYEAYRLGLDEYKLGNYTDRATSDEELKEAKKKWES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TTTEVEESFQEIVKRGKEARKTGATFKKSKEAQEALRKINKWR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.169999957084655"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DTKSRELYEAITNGITYAEQGEKEFNVGTESIRNVRRKYEKER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EVDSAVQKIESLLKRGEQANWKGARWEKRKLANNLKEAARQEI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QERNKYAVVKAVDDKQKAETGGTDLKAGDKSVKKALSKFSDKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YEDNLKSIWKALEYGKTVEWGKERRKPGDQELTDLDRSARTVK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKQEFKTEAKQVLRNIGPLRANGEKLERPRRAFRILDERADEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SPDEVRYKLEKNSKTSNKVELGEKEAKDERDARELIRRVEEYT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TVYELKRDVTEAFETGYTVTDGEASAKRKDEWRRLKRVIEERV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PNKKIYRTAQYVLSEGDDKRIGKTNARKEYEAKELITQVAQRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESERLSETLKKALKQGEKAEADGRREREKTEIRDAATKLLNEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KLKKDAYEINQVLETGKSIELAGREVREPDTARRAKSEATEAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKREEQFLIKALEWGEDARRDGREAQPDRKDLRKVASRWETEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TKDSANELKTKLENVNGPLRVGEEKIEQPRQAENALYRAVSEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KPENQILSWANQKSFEQDTVGNHKAKIGSRRLKDAAEYWESYK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SNKTIDQIEEQLKTEKERIKIRGKEISKKRSAKEIATEAYEET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QEYETKTLRTIAEEESNFEALGDDVSPKRKKRITDAREDASNN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KREKQTNKANKAIRRDEPIDLEGVEVYETEQANKVQEFSENDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DPKEVKREWDQRATKGEKFSVTGRQLNKETEVEELFKLKATKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SAIKKLLDALAKEGANRVQLGKSYSSEPYSTKAQKVLKEISDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QDKLNEQLDKAWRQGEKARVGKIEAEVETPNQLEKVRSAAKRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKYKKQAWETLERKGSPAQEDGQNKRPDERYAQEAIYQDFDES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEKDLKKAVEDFREGKNLKAKGESAPPGRKKIREVEEQWEKAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKTLNTIIKRALYKGTEVRVKGATADKDKSTSVNTVAEALLDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.680000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETRDAKRTLSERWKKGRKVRVHGIEAERNNEASEVVYQVEDRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKRSLSQELDKLRQKGYRLSWGRKEATEPTEAERVHDEQRERT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.200000047683715"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RARTEVTEVERTVKTGEEVELGKWDIKTSRALKSIETALREAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QREDVEFWARVAEEEKTLYEGNKNATPGDRSWERAARNLKEEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKEDKQVLTYLISGATTAKLKGEENRLREEDVTRAADKWSRNY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEETREEIERKATRKGRRYVGREFEIDYQSEVKTAERDTNEYF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PYSDAEKIAELLNEGKPLSAGRREKKPGERKIRRAREYREEAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDDEEQLWADVVREGSPLKAEGARIRFNDDRATTIAYEDKSER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDKKAINTLLKDEGAKEVELSGKKIHLNTPSAFRRLLDALKYQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKKVDDAAESASKKTKKWKLGGFTVDPDREDEVNRIRTALDEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKDEIYISAAAAKTGEPNEAEGQERKPLSERDKTYLRSRETRV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EESKVENNAKSLLQEGTPVTAGELELEERRDLRQLVRAAIKRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKKDSNQDLKEKAEQGTEAELQGEKIEKPNNIRRLAKKQVQRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDKVIKILKQFIQSGASKVRVRGAEFEAGKPLIEDADTRLDKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TADRAASKLEKLVRNKEPYKVRGTEVNQREAWESIEQDAYEKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EYKRAEKIQQIVKKDNQWEVRGDDFQPGTTNIKEKVRKADNEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKEERAQRLKTLLYQGKPLTAKGEERNTPKRLSQAADEAEKIG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEQEVNSLFEYANKESKPINWGDQRAKEPRRLEQAAEEKRQEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EESAEALLEVAKKGVKYADWGRLQAETKKPYAKRVVNSTEEQN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KLEEIEDEVDTKLKRGNKFSAGPRKIREEYEVTYLADRATRTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEKWKIWAEAITTGLQKLELGSNRVDLQRPDREDEAEEELKRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KLKYSLYRLSREVEEGEPAYRGRTRAKKPEKAEDVENKVHQES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REREKNELVERIVEREEPAKVGRKKLKEPREATSALQRIDTEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence STKRFETNAKQVEKNERPKEFGEIQIHKEKKLERVLSALEYSD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKNWEDQVRELKKNRENLRAKGKRISPSKPDNLKEVTEAAQKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDNEKKRAVYKAAEGLENIKAGSLEVKLEEPKVKKTVSRKDRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8600000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KIKEIVQRADSHADYRGPYKAKGTRLEEPTRAEEELEKFLERA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KVREATRELEEEIQKGKSLQFKGARIEEERNANTAWEVVTKRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKAYHADETADYRGIREVKEGYRSWELRDNRLKQEARNADTKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KPERAKLLWKLAQEGAERVEIGTKEAETRNEIQTLVKEDKYIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.009999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QSKTEKLRYVINRGRNNLEVTTETRDELERRDAEKKVDEVKSG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRNLSEALQALREGKERLDAGEQSWKWGEQEVKKLATKVYSLT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEEIIRYVAKAAERDYRFKAGRASKEASEPEFKKLKDNVKNKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PERAKNELEQLIEYGDRVRLGKTQFKNKQPKELLKEASKANRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SDNSEAWIQAAEEGVEKVRLKGEYAKARYEKFKQLFSEKEKRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EVREFRNKATEQLEEGEEVEAKGFEARRRERLTSALRLVQKEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AEEYREVEEELERSGKPATAGRRKARGEQYIWKRALRFWKDNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ELSSKARTVRRVAESRNRLKAGNLKVKEKTDLTKAVEEAREKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EYRRQVREDAKQVANKVEWEKEGKYLRRKEEIDTLARDWANQS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKSDELRQRVRELAKNAEVEYQGYRVTDEEEDRKWADKWIKNQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RYYRERQLENAREKDKPFKLGRSEERIGESTARNLEEELKEKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PENEAERAIKILRETKQWKANGNEARPRDDQFTEFIEEAKELK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERDRIEEVNDEANQGTKFKLPGGAYQRDLRPERISRAVEEERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKRVERLDRVVNKGANNASAEKNATIEIDRTEEIKDVVEQARK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.939999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEKNIKEELTKARKDNEPLKANREVQVEQTQRWTKFKKVAQTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SARELVNKIKEASKKQRPARLNGNRLNRQEEVKEAIEEIENKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKRKELNELRKEWEEGKQKYVEGEYKKDPTKAQQAIRKISKKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQSASKYLDYALDETETSNVKKDTRDTEPKPYNATKVAKIANR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KPEKITEKVKEASERKRTIKAGTFEINDKRDAEDLRSAAQTDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KAKYWKEKARNIVQKGEPTESGSDDIYTKKVVEYAAREAEKNG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TAYEAVTQVKEEAEEGKPATIGENEIYEQKKAETLWETERNKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EQYSAKERIEREVRNRRDWEAGRRQVEEEREVNRWAYVYVTER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.169999957084655"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSKERKRYLVETLERVGEEYALGAKWKRKEEARELLEEVADAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EPRNLLRRLQEVLKKGPVEFPGGARWDREKEAEEALTAIDKQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TEERKASTAKEEVQKGRDIRIGEAEVETKERWKELINALTRKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKEELERKARQLRSQGKYVEILGAEAEEPEKATKVRRKIQREA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESSNERAVAEWTQERQPVRLGYFEAKVEYKSARRVSSYESQAA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TAKKITETAEEKVEKGSPVRWGENIELDERNEVTDAWREWARR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRRKFIEKLKEVANYESQLTEDGANANRTEEAERLAEDVDTKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQQEQVEYAEDAWQKGKEAEAGKNRTRTPYRAQHVAREWLREK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GQDNWTNRIQEKLEDRQPAKLRGLTAEKNEELKQVAKKIRKEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KATTAEEIVTEIENKGEGLEIKGARAEKPYYWTSVAKRRESKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KPSNVIERVSRVLTKQQTIKVEGDRLNKEKLAEKLAKKAERDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NRSVEKVLTKATRKDLTTVEIEDQYFNAGKKEAAKRAEEIANK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEKTEAKQAQRYVEKGRRAEVGPTRLEDSQKVDSWADIIEKET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEDDAEKIIEKVEKTGNKLRIEGLEAPKDTRLERVAESLAKRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8199999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PENEAKRKAYEIVKKGSPLDVTGIELKEQEAAKSIFDNSNKSR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTNTEKVQKSRTEGFYEFELGQARIERATKYYWAEIFSKVDTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEKKELRRVKEAASDTEPADFGKETLRRETDAEKVRQEFEKYR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRTDLEAATQFTTQGRPWEVGEVSVKRKKPSARENRSEAEREY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PYKTKVIVSLRRNGAEKLEEGDATVEAETKEEAYKLRKRDRKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSIKDALKKLREKGIPKLSIGEAEAEVRRPRLSNKLKQANEDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESRAEKAFKKVNDRNTEKNLGRVNVTPEYETIARELLKKNIEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKKFKERAENVVRDREQLKVGEATVTGSKSRADQILSKAVQER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.699999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PPVEKVEQSLTSQGRKKKTLDGWTIRASENRKIEKLLEYAENN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDTTRKAENFAKTGIDRMKRRGEELEARKPSVQEFVHKINRTI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKNQLEKLIDRAYRGEQIEFGENKLSPGDPKLYKLAEEAEKAN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEKKLERTINDAVQRGTPAELGEAKLDKTKRAREAWTKFIEEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETETANKQLRSLIKKGNQIEVGRYSVTKPKERASLDYELNEEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence APAAEKFVRQLDHRGDEIEVTGVEVKPERQNAWHQAFEVEDRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRAQTLRQAVEFAKKGEGWEANGSDAEKTDLLKDLKTTAREVE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PNSAEKRLKEIKDEGEKYEYAGRSIRPKKRKEADDALEAIEKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRRKAINEADTSASEYERELEDYQRLNSPREAKDLVNSVETKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKRTAEEEWQSIVNKGEEISLGQRKAQYLEKVAEAWERVKEKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KQQDSSALFYAAKRTNKADVGYYKASKGEPNWKKFINTEKQKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PPEKVEREAREIAKYGEKATLIGQQIRDKEEVRSALDEAQKDD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QERKYAEFWANVDERGEEKATGQKLDGYQYRFQRALDERNTEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EPQSYLETARRTVKKGRKATLIGADVRKEEEAERAVTREAEER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7300000190734861"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEDEYDAVAKAETDGINELKSRGETWRARSKNIKKVIREAKQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKIEQLARSILTRGSTEVEAPGGAELRLRDDTKVKSVLEEATE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PQENENRAREILNEEEPLDIRGVNVKAKRPDKIKQAIRKAKTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DEKEEITEALESARSGKRLKVEGVSARNTKEASKLFTEVEEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESQYEDFKREWDEKGKRAKLKGSTKEPESTTEFRNWAYAALEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PPENEAKELRNEVRRGQSVQREGESVEEREKIEKIAYKVTQKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.680000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TPNERVNDIQTIIETGGRWKLGQLEARRRDEADEVLNTFEQLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESSDKEAMKKAKSENEKATAEGNYAYIRRRELEEVWRNWEHTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TETTTLEEWLSDAKDGNPLEVEGERIRKNEQLRKVQKAAKRAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PVRRALEELKDVADEGRTLEAENRIRATNKELIKKLEKDARDS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VEQINKLVKEAKDYTANKLSAQGIDITIKTQKRAENVVERLEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.790000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence STEEWARLYEAARERPRVNINGITDERGSEEYKKAEEYWRKYQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NDWKDKVEDAAQRGAQSVRIPGGAKIEASEETEARNVIEYLLR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDEFKRIIEKFIKYGLRDAEAGSAEVDGAQPQEAKQKVRNLEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KLEEARSRVRKRAEEGDKIELAGAEITDTERVEKLKSLIKKVQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KETADTVITRIDRDNAQKLKLSGAEIDWENPENATKIKRILKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QEKTEEEDLHEAERGREVKDGEYRRRPERSKADNRVRNIVKEV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NKSVKDLVKEISERQSKAELGRARLDIKNERAAEQLENDAKET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDEIQEIIQRFNYTEEPKNVRGKHATIKSKREREDAADAARED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EPENEAKETLREIQDGTTAEKDGERATRPENVKRADKRWKSNL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKSARWNEKFRSEERDRVEAEGDDVELRTRYAYNDVEEANRYK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PERRFDDLIYLAKRGESRRLTGQEAERGEKDADDELEEYSQEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DERTASKKVRRVEEKENPKKARGNEEYSNNKKLRELIYYLNTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.9599999785423272"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRKVNEELNRTAKEGEDIDVREKLNVEPTKPEKLREADRSFRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TEQRKIEEARDIAEKDRQIELGSLKAERKHKANSVANQAETES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8399999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TKTRNAREIETRIQRGRDLEAEGAEAEKPRRLKKFIEQINDNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PNRKVEQEAREFAEEGTRAQNTGAELTEKDELERVAYKYKERV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YEVRRATRTAEQRGVEKIELPGNKTFKEPEPYQLLEAAKTRAQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKYKNLNDIKRLAEKSETAKAGKAKVRREENIREAKQELESDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QPKKVVSEVKEAKRTGKGLEIGKAELDTQEQLRRIIENAQKRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESRVVKYVDTEAEYTGEKAEEGKRKAKSNRNFREALERISEKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKNEEARTVQRAAQYGEKIELRGKRTEEPSEIEELKREAQKIL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GEDNLEKQVRTALDNKTTLKDVGAKVRKEKYAKTALEEENREG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PRNEIVKSWKQLLEREEPAKAGEIKVHKREKLKRLTEALEEAA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LNSVYEAKEDLKNETQPAKLGKERAYAKQPSTWQKLIKVALKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NNSRLEDEIETLADEGKQKQATNKIELYRRQRVNRILELAEEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EPERQEAVDKAVRDGLTDRNVEGLNAYLTYPNANKELQSLSTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKEEATNLEEHAYDGNPFELQGQRVEPDSPSIKRRARERLENA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKITKVAKDAKKKGATELSAGEIDLQLSNPKDFTEIISRVEER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRREEKAIKDAASRNQTLDAKGERANWERPKVENAWKKFKNVD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TVRRIEREVKEIARQGSTLKAAGEELYRKKRLEEAAERVTEDA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKERSRQKVTDLAKTSEPAKFGRYRWNEQTNASKVAERLEEEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TIEKAREKFETKWNEGEQARVAGAKIRKREEITELVTKAKEDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YPERASKLLKTAEKRGKEVRKEGKYAPKFEKVKKEWYTAEKYN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDEYDEWLVSVLQQGRNARKGELEAYPRERRARKVIDDTSREK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PREKKVAEEWVDRGEKSLRAGNREDKDGRYEAREVANEVRKKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QYTREKRAIDKAESRREEVEVAGADLKEYRRIERVAYRSQDTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TPTRAQDIYELEEEKREARAGGARVTLGTPKVRDLNNRAYEIA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEKNNIEELNQWLKETKPVKANGAELRRPEYAHNVAEEVKKKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEEQEKNKAIREAKRGKRIEITGKQVEEKSKIKNFKSELEDRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NPTKLSKEAQRLIETGENATRLGEYVDRKRYVEEALDYRLQQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEEFAKKLDTVENQGEEAKVGGEYARKFQPERWRTVARKAESR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEYERNKEEKWVYQNKEAQARGETEEVRNPQAARILQTYLKRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EQKRKKFAQSLNTDPGDNADRGRLKFDAESKKKLDRAEREKSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEDEAAKNIYRIAKRGEPKEATGERLKTPKYAREILYQVRENK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SARTIEREAQEIIETGKEVKLGGLRAKKKENIREAVKDVERRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKETALDEARKRARQGYPENAEGDTLNRPKEFEEEATKLRRQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SYKRLREVYDKAKDRGPPVDEKGKRSKKPTEIAKVAEDVAQEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EDRKASEELNQRAEETGPLRADGRKSTKREKFETVAEYEIQYK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RPAVKVVTRARRSGEKSAEAQGNKEKIEKNELQTEAYDAERKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5500000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VPREKTLRRAVDRGINKARIGEANLEPDYKSKVQTAEKEENRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TEDKAKKVATADEKNKNYRTGDKSAYPGREEWRSILEQLQKAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PSKNTANSAKEAAKYEPEIELDGSEVEEYKKLSYKFTKAEEKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RIEEKIKRARRKVRSGQQWTVGELRLEEEERLKEAFTLAEEDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YLKRDADKLERYAKEGSPREIGDENRKKPNSLYRALEEAERDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QLTDLRKWAEEFEEEGEGANVRGRKVQEANTWDRVVREKKEDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QENESVIARALKKGVESAEAGKLKWDEQSDEAKNAFRRLSRSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KLSSAKESIKDIRQQKRRIKAGEIEAEERRRINRLIEEAEKED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TAHSQANDIYKEAYEGKPASKGKRERQTPKAADYKIKEKKETD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PQRYLEVAKDVEELGKKATAGKKDLELDQKDLVETAKNEANNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KETRWYYRAREVVTKDGYANAGYEDVETEQSAAEIKRKLLKER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEQETKRYVEDAISNGERVRVKGEQLKRDDAAKEAIRLIERKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QENKEKLSDKAENASGQRIEATGLKIETPRNREVRELETSERY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PTKLKAALILTNKGWDKVKLYTNADLEVKRPYKANQFAEEERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RIERFKKLATKVRRKEEPAEVKGVKADEPRKLEEIAQEIQNDN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETKSKEWAEEAFEYKEQVKAEGREDVKGGRSRIDKANTTANRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEEEARKALKWIQKTDQAKIGNYRFEPGKEKWENWSRRLKRAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.470000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REESIYDEAEEEAKKGRPAQVRGRYKKDEQTANELLQETARKH, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RLRKAQETAQEILSRGTSAEFEGIKLDKEQKVEYAEEDYTKNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8199999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETRKRADQLDRALRTKRPLEAGKANANEPEKIDNAVNDINTRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SRRISYKIRNADKDGRKLTLGNAEAGPRKPTIAKDIEEQLKKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.049999952316284"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKRVDTVADKLTKDKRTANVEGVKANITKEKIASELAKALLKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DSEKNEAFEAAIKERKKWKFEGERLHASEREIRSRVNKALRQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKSEIQEARELERKETHPVTFKGKYVEESRDARYIAKRADRRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EQQELNRKIKEQKDEGYRFEAGQQEAKRTQRASSIVRDLKDER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RPDKWKEEVTRAVEKGREAYLGQEEAEDTRRLKRLANEFAQKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QEQATDRARDIATEGPDEADKIGVELETRKSAKYIVTRLREEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDREENNLARYAKKGAREAKVKGIKVTVDKESRKSDARDAVKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SRERRDLVKVLASANLKEFDVKGKELKSEERTLDKLANTANQG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.75"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NIERYAEKANTAAETRKERKNDGYKWNRPSEVKSALQKAEEEL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PTHWRRTLSQAEDSGWTKRYIAGSELDPKKKTSVERLAYKATE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKRSKDLVKEWIKEGREKKVRGWYIQIEKEEAEEKADTAEKEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.990000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EESENSAINIIRKEPGKETDKSGEEFRLSQPYSAYQLKKEAKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKKRNAKTVEEEANEGEQAEARGYKFKRPEQVRKAVTRFERRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAKEEAKKVKREVKTGEEANLGRAEWQQDEYAKKVDTIIRKNK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.419999986886978"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RQEAERIADRLTTETERADVGQVNVEQPKPKELDRWVNQATKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8999999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERKYSTKLLTRADKGTPLKAGDEEEEPGRKQVEELQENAREAQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YEKEDTEYARSVATEGNEKQAKKTTQNNKAKEVNYALDKAKRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PHKDAEESIQKVTKEGEQLKANGIKINETKALEDAADYQLEKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TEKEKEEQAKKLEEEGRPLNAKGIEANKPTAVEQADSRIQRQL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EPEEAKEEARRAITRERYVEAIGKRIEKDNQADNAIEELEKSE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKEEKAYDLRDDIKKERPAEAGDKNYEKPRKVTRAIRSNYRQD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DEDTAKRTLREAAYQGEPINITGSQIEQREKFNDAEEVWTRKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.769999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEQQFDYVKRALKKGYEKTEGKKYKEPGDEQIENIAEKAREKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.02999997138977"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PENESDQHIKYARYSGEDARLEKNNREKERYKLDDIAQKVNRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.059999942779541"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERTKIYKLAERAFKREEQANAEGKSTQKEQRIEEAANEYFDKS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKELSKLKQALNSGLPYAKLNGREKDKEQPRAKENATEFSDKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PPKLRSLAKQLTDYKLEKAENDGIEVDVRETRSLEEVATNALN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDKQKRAAYEIEEDGEEAEVRGAELRVEEKELSKKIRRFARSG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKREVRTNIRNVAEREYPTSLGKTEARQPEEAERIAEKIKNDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KENKFDYRFDEILKSGRFLDAQGIRASEEKAEKKIKERTNDRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDDSLEKEAERNLRNGEATLGTRKAEDNEKAEKLVSKILYKKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6700000166893001"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PPSARERAEEEADDRYRASKKGIQLRLEQTSVETELYNKIEQS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RAEERENQWTNDVEEGSQATVGTTTAKRRKSIEEAEDVLYKKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RSEKARETIQRWWKSEYEANVEGSKVKKPEKVNRAANDALEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QDDQEDILKKFVRIGGEAKADGQELKLDSPKARKIAKKDQYER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RLQRDFTNATRRWEEGDQATLGRIEATQRREVEKIANLAKTRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KASNIEKKLSEAVERGKRIQIGGYAEAEKSDDWQSVVDLRKEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KIEKEAERAKKFADRKRRANVGNVQASEEEFWRKASRVLKTQS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VRTKKSRVRDEVEEEQRPVEAGTAEATTEEEAQKVWYWLTDEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TKEAKETLNRIAERGRQKRLGRVRVDKEKPSSARKLAEEARDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETRELKAAFEAVSEGETAKWGTRDWDPENEYIRDQLSRAASKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GKEEAREWIKYVRTGTDVRLGGKKDQSGESDAEKAANRLERIK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRENLDYVIKELERGEPIRRRGERERPEEDEAEQEVRTELNDL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QYTDRAVTRLQKDGIYKAEVGPADVDLKTYEHLSDLEEAYTNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EENDKAKEMKERIKYGEPAQAGDEESKTDKTVRTALKAIEDLI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PRRDKKVAEKLARYGRSLEVGKRKANVEQPDEEDTLTNLANEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KDYNELLRYWYRSGIRKVKLDGTEQTQVESEQDEEEARKAADS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KERKLRERADKVLYRGEQAYAAGTKARESERVEEVATREYETE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EERRVEYKIERSANQGEPATAKGRKDKNKQELRNLITEAAERL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PNYKFERLRKAADRRREAEARGQKESLSQTEIREEAETANREL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NTYEYARQASEAIRNGKQVKETGLKAKYEELIRKASEFAEEKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKSEEWNKAEEELTETGYEKAGKLKARRQKNVRTAVRRFAEQD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RESEEESFKNVITESAEKLRIGRAKLKRVNPETIRRLVDEARN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PAQSISYEAKRAEDEGKEERIVGDQLKEQDYARKLEEEARTAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TEEERDNFIDAIIERRNGVKIGEANVKRDENAKKRVRTLEKRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RQRKFEEQAEELLKKRKKLSREGKDAKTREAAYKALTEILKDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERKETAKEVDTVLSNGRELTAKGYRLEKPKKAKELQDDVKRQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.9599999785423272"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DYERVRDAKELANKKKEVELGEQSIQPGKRNASQVVTSLQNEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEVSKLAKEILKDGVEKWRLKNNRKATAKKHNNATYIIQDVAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KERNLQEAKRALRSGEEIEAGKASAQPGERLIKEIKKKLKRIS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTKAYSFAQRAKKKKDRANLYGEEDEIEKEKLSQRASEAIENN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.100000023841858"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERRNWKKLARIATNGASSVEQEGLKVEVERPRAKSYARKFESY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NDRYLQKEIEQASYKYTKAEIGGQKRITDPKDAINIKREVKDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKETFERFAKDLRTNGKDAQLEGRKAEDPREIKQIAEKSAEEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EITKAAKTVYDKVKNGEEVRWGNEQATTQDKLREAAEAVKEKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TWKKKASTAREAVTQKEEAKLGKVELTENEVAKSVKRAFNKEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEQAKAISRANENERKNAEVGRAEVYLGKKYVETAWSDLRKKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence AKSERNWAESVATERGKAYKGGKEVRASEPQWRKFADKIQEQY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTTKIREQASTTAREGRKIRAVGFRADSNYLIEQLVEKEREEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PNRKTRRLIKKIRRGVDELTAGGAEIDYGKSDVEEWAEEAEED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.050000000745058"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QREKDVRRLIYSQKEKTASLGDLTIKKENKKIATELWEVWENA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8399999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KATRAFEEWERNAQNGEPLKVRGRTITSPERIKEAVNKVEEEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SRNKWETEAERALNKETTLKFPIGVEVEEENSIQELIKRAERG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PIEDIEDLVKKVLKEGDPAEIEGAKLTKKKQATELKYLLEDTR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PAYELDEEAEKAVRKGERTESGQATIKYNEELTRIATTRTYKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence HEKRIEKILEAVNKEDSFEAGEDRAKVSEPRMKNQINQLKQTA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.7599999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENEEQYLITTVVSEELERIRAGRARLKLRKKTYADELKENASE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.25"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRRRVRTEVETFVDEEGRWKIKGAYAKEEERLKQWAEALDEKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.110000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETQWNYEVSKAAKTGSELEADGLKAERRDPKRVDYKTDDIENR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NKKKAKEDVYRYLKRKEQLSVEGKRLTEPSQAKEVAVENIDEE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SERKAYERAYSWEEEGNEAKIEGEREPKVSRIARELTDRAEKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAKNAEEELENVKKYNKPLKVGSRREQKPDRAKRAVYEFSERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VQTLKYKAEDNVERIGEKLQAVGAKAEKIEYAESAVKKRITEK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.430000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KETYAKEAAKLVKKGRPFQQGYTETRPGKDEAKELNENFRKIW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence FEREVERVAKEADNRRDPAKAGEEKVKEVSYARNLWERAEKRW, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LTNLRELATRVKSEGKPIELKGLDIRKSEETTAKKVARDLASK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PSREQWEKADTKAKDGNEFTIGREKKEEPQKAYSAADKLATRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EARERVKKLDQNLKSGYPDDISGANADRSELWQKATEEVRKLT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.11999999731779"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence LPQEQVLRKVEERGAESLRAGSDRVNLKDERALDKWRKEVREA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DADEIIERIDKAVKTGTPANLGRTEIQSRKYLESIREKVRNER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KPERKTREAQKLAGGEYANWDGQDAELEKSRLVTREAEFATEN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKQIKALAQLITTGRDDLKLGGKSDARAEKDRVSKVAKNIESI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8399999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDSKFETLAKEAEEQGPKWYAKGREEDYVTRAANLQLKIFKKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.350000023841858"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKAAKLVTTIEKKGATRVRIDGEERQPQENNISYEAESWDKDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.720000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKKARERADSAAEKGITEIRIEGAELSVNTEKLLRDAEREVDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDNRELKRVIKEFSRGRPLQAEGDRAEEKREARDAKSILEEAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PQKANEEIKRLANNRKTVNARNQLKWQKARPEEIEDIAKEADR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KVRDKIENLDSLWQRDGKLRLGNAKIQNPQKADTVVEKAREEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PPKAKKDAIQAFQKGESASRGGKRARPYYQKALDEFSKEVEEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RQRDQKLKDEVSSGIDEKKLKGFTFEAKDPEIAYNAKDAADKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RNQNANDKILEKLNQTGPEENKGEELSYPEKISKAAYKLIQKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NLEYVEKELSKAAKENEPAEVGRSRAQQPEKLTRAVKLATENS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TNDQAEAIRKAESEKRPAELGEKQFEPGERKLYDLKRDAYYRA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PREKSKDAKEFVRNGERVEFETNAKARHAKRKKLDDIAEEIDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.889999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EPSSVEFVRYLVSDQERANKGKAEAKEKTPNFNEAAKERNEKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.439999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKKEEKNVAKEVAREKRQARIPGGLDVKQTTKITKILKEISDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEKKEKVYDEVEETGNGLEAYGVTAPPRRKALQEARTFWTKYD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEENELDETLRRVLREGPARIEGFEANEERSIRRLLREAVNED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PSENYWIKAAAEIGLEEEKKKGQKARIRRERLEYSARDVERNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NEQNVYKAWRLAREKSERRRGRARAEPGSEWIEELKQLAYSLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PTKKLEEVLDEVDRAGYRASIGNLRAKQKQRLTSVAEEFEREG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TDKDDAVYSAVRRGEHEITRPKGLNLDLSYKRADRKAKEEDES, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKKNRAKRVLTAAEEGRQIEFGELEVEEPKRVKEAENVVKKSL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.850000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PNKKEALDKAKRSGVENLYVGRRDFKFKYEKAEEEVERVERKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EETAELIYEAIKKNEEEKDAKRGKRRSAPRPRDAYNLVNYAYS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SRVETEIDEILKNGIRRLKARSNARVEGKREEAASEIATKIRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.349999994039535"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KPDSDRRIAEKAENREEPIKIGEIRAEEPRRVKSILRNVQQKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REEADELERILENGISYVRVGGREKLKSRQPRSLRDVRKNVSQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PRTEVSILAEILEKGNSRARAGSLRAKVKEKKKREDLEERLDN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7300000190734861"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ETKRDAEKVEKRAKQGEKAKVGKKYLSEEKNFQDVKKKVEKEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEKAAEIAKEWKSKGEKIDSGRLRVTAGNEKVKTLRSKAEEYN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRRYKQLAEEAVHKPGRDVKAGSKRVEAGEPRLKKIANSVQKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TEKNLRSKAKNFAREGERLQLGRESVKRETRVTKITRDAEEDR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERELQRVEQEWEKAGKPLSIGNAEIDGGKRRVWEELWNAVQRR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QEQLRALYWAQKRDLRDKYAEGVNVEFTRPSVKEREKNANSDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.159999966621399"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IKKIAEKATEQARETGRDVKAGYEEAKEENSLRRLLREQKKEG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence VNEVRSKVEYAVQEQKSLTIGRLRLNKWRPKTLAKLAEEIEKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.120000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YNKERKEVARTLKEEYYRLEDGERNDNRPSRAKRLADKEITED, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.209999993443489"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTEKRIRREAEEVAKTGEVRIEGLEVRERRRIDEFLRDAATDK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PAKSVIEEATNLLEQGEKVRTEGAEIERRERAKKALYEIKTRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKNDRVEKATSKIDDGEPIDVGEKRLNYENKAEELEEILRRTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QTEKVERAKKLLEKGQPVDLGNLTLSPTDESAKRKDDELQRKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5899999737739561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence IEYEKEQLEKKKNYNREKAYIGEKDRNQPRRWIKKYKEEEEDE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKQKEEVQSLEEEVKKNPWEAGGADVRDKQALRKIIDALEKKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.6299999952316281"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PETVKAIATLWEKGVKTVDWQEEKNARKGKPAWKTVTRTLDKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.680000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EPSQEAKKVVKWAKDGENLTIEGKYTNDTKKWRRTAHRARERG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NPEEKIRRAWKAAENGRTVTVDGKTYTDRSKDHKQWEKAERKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDETKEAVEKWIENNKEVKAQGWRAKIDRKEVKEVAEKADSRN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EPNEAKDLEKSAREEGEPVQIRGIKLKRIKEATTIAREVEETK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERRSRETKATEKLTTHPFYADGGEDKEKPKKALEIAEEVRERQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PATNLARELKKEAYDGKPVKVAGEKIKEREAARSIERIIKREY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NKERKQRAWKRAESGEPADVGSKKLNPTQKEAQTKVDRIDERG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEEQQEILREALKEKDKVSVRGQYANKYSPKADYAATRDKEEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YTKLELVETLDNKKAQYDKANTSINAKIRETEELRNVYDKERN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7799999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TYKERDERIHTRVEKGEKVNAGKLKIESESDLKELFKALTRAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence REKWANEVETAQNTERKLRVGKDKFEVYSKDAKKIFRKAADQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.120000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NAEKARKEANSLVRDKDPWKAGKKETTKPYTWQTEVYELKEKQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.7099999785423271"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KERTKVLEKADRGTIKEVDAGKRANIRGHRSEELSTANEIVNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.540000021457672"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PPYTLRRAIEEWTRRKKQLEVGNTEAEEPNTLETVTYFAVEKI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.059999942779541"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DEYKLRTKIDKKWERGENLSLEGKKRDRPDTAINAAKEAATTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.009999999776482"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PATKKADEARKLWKEKKKIEFRGEEAPRARQWENFAERLRQQV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEERYLYEVEKAASKGKPLQAGKRKVERPTRVEQAAQEARRNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEERTKLWEDIDQDGKPAQLGRESRQPYKRKVAQRAAEALINS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.129999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PDNSEEVRKDANETRKPATVYGENLKAKTRYKARRLLREAFKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PSEDKKRAERKVENRKTEHKPAGARIDTYTDKALDTVYEVAKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KPSDNRAALKWANTGKKVTREGENLEFEKPRVSKIAEEASNKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8600000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GEYRSALQEAAEDGAEEVDIYAGLQVQKEEVKYASQLTKSRRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KPNQANKDARRFVQEKEDEDVKGAKARKKELWNNVYNEIEQEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.939999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERTSWKQVWRWLTDETPASANGEDIRSIDERRKENVEKALRTD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTEKKERAAKDLADNGEPLDVEGKEFRRPEYLKRKWKKAKEKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDRNEEIIERALREGESIYTGELDLRPEPTIDRRARERENNRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTTAEREIETLLEEGIREAEASGINIYARKEREASRVLTERRD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKNKKAENVERFWQDEEPAEADGRELRDPRRAEKAIQEAKREK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNHAQKLLESARKQGEPLDLGKKEEKPGNRYLEEAIKRVAKTQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KVQNAKETIEKDAQRGETLRVKGIEAKEKEEVRELLERVKEKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QRSNLKYDAKNKVDEKREWNVGSVKLKEKETAEEVLERRERTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.239999994635581"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRRLQEFAEEASKEGEDFEIEGRELEPYRPKDRQKLDKAAKSG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.289999991655349"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence GQKRAEELKEAVKRGDPISIKGDDIASQEREEKSIREFAERAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KVRDLREKLKTADQENEKVKANGAKIKETEEVEEAQTLITDAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNKKLDEVETDAKQLGPDATLEGRSIKKPQEFLKEIKQYETNE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.370000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ERRAKQFIRTADENGNTKRAGGWTLPGRYSAWEKAYYEDDEEY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKNRIKKIKEKLKREEELEVDGAQVSRESPRVFKKIESSAKTG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KRTTQEEQVDKAESEGQKAEIGEFKVERKKAAQTVIETWKRKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.120000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TYRDLFRKAKYATENGKKITLEEDEEVEKSNKRQDIRYKVNKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.090000033378601"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TTEFDKAKYEINERKINSLRIKGARLKNNNDTTAYTEFEIEAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TPRIQEKAEDDIEEKGELSLPGGAKVKDRNTATRLVTKLKKEQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PSQKEENLRKTLETKGPYAEVKGEQVTRPESVREFVKTNERSR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.070000000298023"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRKARDLIEKVEETKEELEVNGVKAKVDQPDAENRARRELSRG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.379999995231628"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PSTAQKDVRNALSKEKDVRIGSWEIKDKKQKELSKAINALVTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.600000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SKKKAKLAVNLVEDQRSDAEAKGQKIEAQRPKLKEALNLLDSL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.280000001192092"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKENEIIKSLYKDGIRKVNLRTKETRELEEPREIDKAIYIAAR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6499999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKRETAKQASEKVKEGEELEAKGRRANDPEEIKEILKRATNDG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.46000000834465"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TSDKSERITSRAKEAQRKARILGWEVTKPEALNRIAERDRDET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKTKNLYREAEQAKQEGTKEFKGERWTERSELDKLEREAKTEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EIWNKVRRKVTREGANKAKAQGQAKIEIREDSTIDEVLKELKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.169999957084655"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESNDERNALRKAFTGEKVKLGKVRARPEERDVKEKLSKAEESR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENSEKVTKAERAAEETDDVRFEGYRQIERPKTAEKELSRAKNR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.469999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SEKLEVLSQLLDKGFREATIKGSRAEEDNRKAEEVKERFDRKL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DTKRDVRTFNKAAKTGEPIQAGKKEANYPDRAKRLVEYERQKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.310000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NSEDDRRAQKTWSTTGPPIRLGGNRIEEADEAVELLFEKVRRQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KPREARREVQEALEEGSEIRAGEIRVRKENRARKAVEEAEKRT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.519999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EERKRAVTEALHSGTEKKRIEGDRSADLKEPYYLSKLVEDANK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.769999980926513"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DADRATQTIRELARTGRELRAPVGEEAEEKEDIKRVLELMYEA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.6899999976158141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KREEEHLTEEAKYRGRVKVPAEGVKAESEQDLTTAIRLIAEIR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PAKKKLKKLEEAATEGEPASIGTEEARQRYRLQEALRNLKNKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DNEELSRDAKEEASRRKPWRAAGAEFEEPRTVNEVVDLVEKKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.189999997615814"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DARTLKKKLKKWREKKDPAEAGGVEADYNQRASKVDNLWEETI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNEEEVLESINKDGLKEVQTGKANADAGKKQWERIRRYLEEKY, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.270000010728836"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DVKKAKEKAENIIKRTDPIKLGNAQAKNQSLLKQIVRALEKTK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.639999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PNKSVDLWEYAARDGKPAEYEGIDAEPKKQKAQTVKRKKYERG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.070000052452087"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EQSEKKWVERADYKNARYSKITGFEASTYNRDAYEVLQRDSKE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KPEVAKRAQKQINQGVKQWTLRSNAKVEETEEATKIRDKTESN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QRKNAKDEAQEILTNERPAEAKGIEATQLSRVKRVWEYEATTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.579999983310699"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKETAKYAVYEQERRGKPLQLGSIKKKRPSAVESVREAEDSKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKREAEELVNKWQRTGKPIKWERKTKVETAERARNLLENYKRS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.220000028610229"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TKDKNSRKAKDALDQKESVEIGELRIKDNTRFKEIVEDARESR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKSDRKSAREALEENDDVQLGRQEADPGKESKIFQVLERAKKR, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.340000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence HEEEDLIEDAVRVGLKQYKIKGAQVKARSPDAERAQDEWKESS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.330000013113021"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EREKSQAVEAFVNLGEEKVRAGELEAKAERPTIKREAKELNKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.409999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEKADNEVEYILNTENRISLGRENIKAKEEEKIARSAKKILSD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence APVWKAVYKIQEKGQQEAEIGRVQADWKQPNLQEQYQRAEESN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.109999999403953"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ITKHADDTVDELIKYGGEIKVGNYKREKNSEIEDVITEAKTNA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.02999997138977"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence QKNKYIRKIEETAKEGEPKKAGELKAEEPTEVTKVEERAYQQT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YKSKTYVASEIEERKNEAREKGNEAEFEKREADTNARKIDETK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.319999992847442"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YRQYWERALKALEKGKPIEARGTREQVSPTVQESIRNQEESAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEDVKRNLKREITRRGGEAKIYGKTLQRNEELSEALEIAEKQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.259999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKQAETRFRQVKREGDELTIEGAKAPGKPEAANVIKELVNKLG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKKEFRQKLKTRQKTGDYVKAGDDEIERWERAAYSAREKAEET, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.179999947547912"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEQREEKQVEEEIDNGTRARIKGAEWEKPRKITELAERKRSYE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5699999928474421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KPRKTIRTAQRLFTEGRELKLEGENVEQYKRAETAANKATSRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8600000143051141"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KEEIEEVLREASRAGERYNSEGAKVGRTKRIKETLESLVYSAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TPQDSEVAKEARRQKEDIDLKGKKADLSDKEAVRRFLEAAKTE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.660000026226043"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YAKRWTETARTRIDKGEEVEENGWEAEQEKRAKDIDSLAREER, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.170000001788139"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KERNFLRDAKRAAEETRPAELEGDNIKRPKNAREDIERAKEQQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KSTRKITNIEELVREGGEFRLGTWEAEEKDKAKSAAEWVTQKN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.0"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KNTQETQAEDAVTKKEEATLGEYKRRWDQPKVERKLSYLADYE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.490000009536743"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RREEKVSNWEEFAETGEKFRFGRATIRKNEAAEYLETVVEQQK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.009999990463256"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRSLSKQAKQAENRRKNANARGEEWEADKYKDIEELSYLLKQE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TATREQEDAKKILYRGKRISAGQEEVEQNKDIKKAAKWVERSA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PEDYKNFATKALRRGGEIEVDGKEWSLTKPSWQTAKERVDYDV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.090000003576278"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence YTRRLESAAEDIKRRGTIDLEREETNNKKERANTALRYLAKKF, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.100000023841858"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EAKKLARRLANTQNGYELSLKKKQEATLDYPKRFEHFLDIALV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.07999999821186"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKSSVKNEADERIEEGREATAEGLRINTSEKVKKLVKELLERE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.360000014305114"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KTEAKSIVKNAENRSNKWELGELSIGYEPDVATKLEELARTDT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5299999713897701"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KKEKDEKTIDRDVSRENKIDAQGWSADTPREIIRAIEKNRSKK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.850000023841857"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PWSKSVADIAAENGLRNQQLGGRLTLRINSPNLERYIKEVDRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ESEEYYIVKLIKKTKKEITKDGARARLGKPDFTKVEHQDQQQA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.620000004768371"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence SFREEKKRVKRIVEEGGDLTVEGAQLRKKEAVDEAEKFARNAD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.180000007152557"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence NPKDIARQLQKVLEKGKDFDAGRAEIKERKKSESAERELKRKV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.5099999904632561"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PRKEFSLIDILYTEDAKTATIGTTKAKAENIEKADDDFKKVKD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RHRRAEEKLQNEADEGEREEAEGERYIQRRKIATYIVEVLRKT, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.019999999552965"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PKREAEKLEYALDRGEPAEARGTTNKLEDPEVRRQIERFRRKA, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.03999999910593"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PPREAEDELKDKIESGENIDAPGGRKYKSEKQLKTIAKLADQS, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.300000011920928"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PQQEEKEFLKFAHNGRQANVDGSKFEAEREEAERDARRVEREQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.479999989271163"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence ENKRSSAAREANRRYEKIKADGKKFEVTRYKADQQVERVREDQ, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.150000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DTEITNELQSLLDDTEKLRVNGLKLSETSPRVKRRLEKALESV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.389999985694885"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DPTDFENFKEVEKTGADRINAEGDKKYAKESETRKEVAKYAKG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.200000002980232"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EYKEENAVSELADKKERAKVSGRVQAKPTRPDAETIFKKLNQD, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.230000004172325"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence PIENAREIVYEARETKNQANAGKKKWREPRKVEKFANEFEDRK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.100000023841858"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence TQRYIAKRALRLLDDGEDKEIQTLAEQWGYTVKDLEEARNKAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.159999996423721"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKKASEKLEEAVSSGAQDEDWKERIKKYGLDQEYADRLAEKLE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.400000005960464"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EPQDAREELKRLAERGNKKKAKDIARYIGDEDEKINSAIKKLK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.8999999761581421"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence KERRASREIEYALRRGRDEAWEKLADEIGEDPNQITDLIESLN, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.100000001490116"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RKNKAKERAYELITEGNEKKLRTIIDSVGSEEEQAEEIADDAL, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.140000000596046"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RPKELKKDVKRLWRKGKREYFEDKWESAGLERNAFKKAENEAG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.059999998658895"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKAREEVDELAKKLGGQTETVKELLEKRGARRSDLSRALEKLI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.560000002384185"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence DKRNLSKTLRKAIESGEEKEAQYLAERIGTQEKNAEKAAREIG, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.699999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EEQASKAVSEADEKGENPQKILKALYEFGLRKYKVKKIKSEAK, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "1.350000023841858"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RRSERAAEKILEELKGRWEDLRKLVEQDGLKNEELKKLAQTAV, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.8000000119209291"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RPEQQENRAEEAINDGEYSELKEDLERAGQRPEKLEKLLDYLI, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "0.219999998807907"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence RDRRESAQDLIKALGLEPENAKDLIYELGLKPEEARKKAKRRE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.029999999329447"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EKKKDKAKEAAEKLGVSESEIQRFAKDIKGRIEKLKDLANKAE, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.449999988079071"}
{"question": "\n【Task】Predict the thermostability score of the given protein sequence EQKRDEDRLEEVLYRGRESEASTAANKAGEKPREAEKLIEYAM, which reflects its ability to maintain proper folding above a concentration threshold.\n【Output Format】You must return only the score number, wrapped in <answer></answer> tags.  \n", "answer": "-0.090000003576278"}