Fill-Mask
Transformers
Safetensors
esm
FusOn-pLM / README.md
svincoff's picture
Update README.md
483b89f verified
|
raw
history blame
2.52 kB
metadata
license: cc-by-nc-nd-4.0

FusOn-pLM: A Fusion Oncoprotein-Specific Language Model via Focused Probabilistic Masking

image/png In this work, we introduce FusOn-pLM, a novel pLM that fine-tunes the state-of-the-art ESM-2-650M protein language model (pLM) on fusion oncoprotein sequences, those that drive a large portion of pediatric cancers but are heavily disordered and undruggable. We specifically introduce a novel masked language modeling (MLM) strategy, employing a binding-site probability predictor to focus masking on key amino acid residues, thereby generating more optimal fusion oncoprotein-aware embeddings. Our model improves performance on both fusion oncoprotein-specific benchmarks and disorder prediction tasks in comparison to baseline ESM-2 representations, as well as manually-constructed biophysical embeddings, motivating downstream usage of FusOn-pLM embeddings for therapeutic design tasks targeting these fusions. Please feel free to try out our embeddings and reach out if you have any questions!

How to generate FusOn-pLM embeddings for your fusion oncoprotein:

from transformers import AutoTokenizer, AutoModel
import torch

# Load the tokenizer and model
model_name = "ChatterjeeLab/FusOn-pLM" 
tokenizer = AutoTokenizer.from_pretrained(model_name)
model = AutoModel.from_pretrained(model_name)

# Example fusion oncoprotein sequence: MLLT10:PICALM, associated with Acute Myeloid Leukemia (LAML)  
# Amino acids 1-80 are derived from the head gene, MLLT10
# Amino acids 81-119 are derived from the tail gene, PICALM
sequence = "MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQIQFM"

# Tokenize the input sequence
inputs = tokenizer(sequence, return_tensors="pt")

# Get the embeddings
with torch.no_grad():
    outputs = model(**inputs)
    # The embeddings are in the last_hidden_state tensor
    embeddings = outputs.last_hidden_state

# Convert embeddings to numpy array (if needed)
embeddings = embeddings.squeeze(0).numpy()

print("Per-residue embeddings shape:", embeddings.shape)

Repository Authors

Sophia Vincoff, PhD Student at Duke University
Pranam Chatterjee, Assistant Professor at Duke University

Reach out to us with any questions!