Update README.md

README.md

@@ -18,8 +18,8 @@ tokenizer = AutoTokenizer.from_pretrained(model_name)
 model = AutoModel.from_pretrained(model_name)
 
 # Example fusion oncoprotein sequence: ETV6::CDK2AP1  
-# Amino acids 1-52 are derived from the head protein, ETV6
-# Amino acids 53-73 are derived from the tail protein, CDK2AP1
+# Amino acids 1-52 are derived from the head gene, ETV6
+# Amino acids 53-73 are derived from the tail gene, CDK2AP1
 sequence = "MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRIIHARGLVRECLAETERNARS"
 
 # Tokenize the input sequence