ProLLaMA_Stage_1 / README.md
nielsr's picture
nielsr HF Staff
Improve model card: Add metadata, abstract, update GitHub link, and refine usage
2886b73 verified
|
raw
history blame
4.54 kB
metadata
license: apache-2.0
pipeline_tag: text-generation
library_name: transformers
tags:
  - protein-language-model

ProLLaMA: A Protein Large Language Model for Multi-Task Protein Language Processing

Paper on arxiv for more information Github for more information

ProLLaMA_Stage_1 is based on Llama-2-7b, so please follow the license of Llama2.

Abstract

Recent advances in Protein Language Models (PLMs) have transformed protein engineering, yet unlike their counterparts in Natural Language Processing (NLP), current PLMs exhibit a fundamental limitation: they excel in either Protein Language Understanding (PLU) or Protein Language Generation (PLG), but rarely both. This fragmentation hinders progress in protein engineering. To bridge this gap, we introduce ProLLaMA, a multitask protein language model enhanced by the Evolutionary Protein Generation Framework (EPGF). We construct a comprehensive instruction dataset containing approximately 13 million samples with over 11,000 superfamily annotations to facilitate better modeling of sequence-function landscapes. We leverage a two-stage training approach to develop ProLLaMA, a multitask LLM with protein domain expertise. Our EPGF addresses the mismatch between statistic language modeling and biological constraints through three innovations: a multi-dimensional interpretable scorer, hierarchical efficient decoding, and a probabilistic-biophysical joint selection mechanism. Extensive experiments demonstrate that ProLLaMA excels in both unconditional and controllable protein generation tasks, achieving superior structural quality metrics compared to existing PLMs. Additionally, ProLLaMA demonstrates strong understanding capabilities with a 67.1% exact match rate in superfamily prediction. EPGF significantly enhances the biological viability of generated sequences, as evidenced by improved biophysical scores (+4.3%) and structural metrics (+14.5%).

Usage

This model is compatible with the transformers library. Below is a quick example of how to perform inference.

Input Format

The instructions which you input to the model should follow the following format:

[Generate by superfamily] Superfamily=<xxx>
or
[Determine superfamily] Seq=<yyy>

Here are some examples of the input:

[Generate by superfamily] Superfamily=<Ankyrin repeat-containing domain superfamily>
#You can also specify the first few amino acids of the protein sequence:
[Generate by superfamily] Superfamily=<Ankyrin repeat-containing domain superfamily> Seq=<MKRVL
[Determine superfamily] Seq=<MAPGGMPREFPSFVRTLPEADLGYPALRGWVLQGERGCVLYWEAVTEVALPEHCHAECWGVVVDGRMELMVDGYTRVYTRGDLYVVPPQARHRARVFPGFRGVEHLSDPDLLPVRKR>

For a full list of optional superfamilies, refer to this file in the GitHub repository.

Quick Inference Example

import torch
from transformers import AutoModelForCausalLM, AutoTokenizer, GenerationConfig
from tqdm import tqdm

device = torch.device('cuda:0')

# You can replace the file_path with your local path
tokenizer = AutoTokenizer.from_pretrained("GreatCaptainNemo/ProLLaMA", use_fast=False, trust_remote_code=True)
model = AutoModelForCausalLM.from_pretrained("GreatCaptainNemo/ProLLaMA", device_map="auto", torch_dtype=torch.bfloat16, trust_remote_code=True)
generation_config = GenerationConfig(
    temperature=0.2,
    top_k=40,
    top_p=0.9,
    do_sample=True,
    num_beams=1,
    repetition_penalty=1.2,
    max_new_tokens=400
)
model.eval()
print("####Enter 'exit' to exit.")
with torch.no_grad():
    while True:
        messages = []
        user = str(input("Input:"))
        if user.strip() == "exit":
            break
        inputs = tokenizer(user, return_tensors="pt").to(device)
        generate_ids = model.generate(inputs.input_ids, generation_config=generation_config).to(device)
        response = tokenizer.batch_decode(generate_ids, skip_special_tokens=True, clean_up_tokenization_spaces=False)[0]
        print("Output:", response)

Citation:

@article{lv2025prollama,
  title={Prollama: A protein large language model for multi-task protein language processing},
  author={Lv, Liuzhenghao and Lin, Zongying and Li, Hao and Liu, Yuyang and Cui, Jiaxi and Chen, Calvin Yu-Chian and Yuan, Li and Tian, Yonghong},
  journal={IEEE Transactions on Artificial Intelligence},
  year={2025},
  publisher={IEEE}
}