domain stringclasses 17 values | text stringlengths 1.02k 326k | word_count int64 512 512 |
|---|---|---|
s2orc | parameters are frozen. In test phase, they make their networks available at any intermediate level with their own interpolation methods. These steps are derived from the observations [12,33]. The observation shows that the fine-tuned filters are similar to that of original filters which makes the interpolation space between filters linear approximately.
To achieve general, smooth and stable results, CLL algorithms have to satisfy three conditions. The first one is good adaptation (Sec. 4.3). After fine-tuning a network on the second level, since it contains parameters for both levels, the performance might be lower than the one trained only for the second level. Therefore, CLL frameworks have to be flexible so that they can adapt to the 3.4). Since one of the main objective of CLL is to use a single network instead of using multiple networks trained for each level, requiring too large memory and computational resources is not practical for real-world applications.
Most of the prior approaches on CLL fail to satisfy all three conditions. AdaFM [12] introduces a tuning layer called feature modification layer for the second level which satisfies efficiency condition by just adding simple linear transition block (depth-wise convolution). However, the linearity reduces the flexibility of adaptation. Therefore, AdaFM cannot satisfy good adaptation condition, then it is not appropriate for more complex tasks such as style transfer. Deep Network Interpolation (DNI) [33,34] interpolates all parameters in two distinct networks trained for each level to increase flexibility. However, fine-tuning the network without any constraint cannot consider the initial level and it might lead to degraded performance on intermediate levels. Therefore, DNI fails to satisfy good interpolation condition. DNI also requires extra memory to save temporary network parameters and requires a third interpolated network for the inference. To satisfy both adaptation and interpolation condition, CFS-Net [32] and Dynamic Net [30] propose frameworks that interpolate the feature maps, not the model parameters using additional tuning branches. However, tuning branches require large memory and heavy computations up to double of the baseline networks. Therefore the efficiency condition is not satisfied. And these heterogeneous networks can cause oversmoothing artifacts because each branch cannot consider the opposite-level. This side-effect will be discussed in Sec. 4.4 In this paper, we propose a novel CLL method called Filter Transition Network (FTN) that take convolutional neural network filters as input and learn the transitions between levels. Since FTN is a non-linear module, networks can be adapted to any new level. Therefore, it can cover general image processing tasks from simple Gaussian image denoising to complex stylization tasks. FTN trans-forms the filters of the main network via other learnable networks, which makes the fine-tuning process regularized in stable parameter spaces for smooth and stable interpolation. Therefore, the good interpolation condition can be satisfied. For efficiency condition, from the observations in [12,33], FTN directly changes filters then it becomes data-agnostic. This prevents the increment of computational complexity, which is proportional to the spatial input resolution. Additionally, randomly initialized FTN makes the training process unstable since it directly changes model parameters. To solve this problem, we propose a method to | 512 |
YouTubeCommons | feel more like nitpicking especially as the main characters lines are delivered perfectly and so I'll end my review by saying that this is a must buy for any ps42 owner that can handle horror games onead Studio are officially on my radar now and I really can't wait to hear about the continuation of this game October is jam-packed with PS4 or two releases but make sure you don't lose this one in the crowd that is it for this video Lads and ladies thank you for watching and thank you to my channel members for their continued support they are the following Muzz dead eyan chopped PPE no one knows move Master Mick Esports commentator for hire Dej the Pumpkin Patch Kid Pete Hawkins crom Superfly AF moonshot Armstrong million blister ac6 the Matt hassard pass leading Fox Jr Horatio Ward deran Brown prophecy 777 Jason Yuan Roy Schwarz Mikey Moy Danish in act virtual Dan sock fans 96 wman days Nate Diaz Gino deero patre we have always lived in the castle Mary cat tree smoker Shadow XJ Diego Darko VOR Shape Shifter the Amorphis Gamecast vodka 101 Jack Namo freps nominal Skeletor Rudy Tay Mr tortoise the game Turtle Infinity Lefty edify till I die Mr 777 and Lone Wolf VOR thank you very much for that support it is greatly appreciated if you'd like your name added the list you can do so by hitting the join button beneath this video for additional Channel perks that's it for this one Lads and ladies I'll see you in the next one please stay nice and moist
[Music] my next guest is a beautiful and talented musician her fourth album Color Me free is available now please welcome the adorable fairy Willie Willie Willie kind of lovely I think she's very attractive very clever Josh stone everybody [Applause] [Music] [Applause] [Music] [Applause] I'm good first you look great look at you you look fantastic you're like a big sort of like one of them English period dramas is a blonde Percy I'm sort of yet I thank you very much I'm feeling kind of in that mood are you are you feeling quite willowy yes I am very willing thank you put your jewelry in your neck you weren't shoes yet I'm not when she's nice I'm gonna saying say all right you know run oppose me off I can't sing when I wear shoes I turned into like Marge Marge Martin or marched yet it leads me and you know the shoes I need anything nah that's all right position you're very talented you reload these eccentricities of the same things we have have same thing with Underpants and interviewing people [Applause] [Music] hopefully P was that I was pretty creepy with it yeah I mean yeah it shows the left of professional courtesy you have didn't teaser me right there it's you know hey this is you this is your URL your album that is my album yes it is how did you do that getting nothing | 512 |
reddit | that is the time crunch, but I feel like most of it was the writer transition and feeling like they were responsible for keeping the series alive.
I'm in the young overpaid techies crowd, but I totally understand where some of the /r/frugal -ers are coming from. Some of those people legitimately struggle with money and are barely scraping by, and it's probably disheartening to hear some kid wander in and say "IT'S SO EASY WHEN YOU MAKE >100K A YEAR! BE LIKE ME!" It's like going to /r/foreveralone and saying "I started dressing slightly better and have *sex with way too many supermodels now.* It helps to be ridiculously good looking. It's pretty exhausting being me, but theoretically you could do it too!"
I've said it before and I'll say it again. Popularity was the main criterion considered when Riot made these price tiers. By reducing ~70 barely bought skins to 750 RP and and upping 17 popular skins to 1350, Riot is making a lot more money for absolutely no improvement on their product. Fifth Age Taric wasn't reduced because it's a popular skin, but it would make their money-grabbing too blatantly obvious if they were to raise it to 1350.
What if you had a free period in the middle of the day? That's 40-60 minutes you're out of class. But you can't be out of class for more than 30 minutes so you have to leave but you're not allowed to leave so you have to stay but they won't let you stay so you I've gone cross-eyed.
I dont mind going out of my way to toss a gun, that I can manage. But it's way too easy to just right click and destroy everything you come upon. I do agree choices makes the game better. But it isn't as black and white as you say it is. What you're suggesting is making it so much easier to make the choice. Hiding weapons and food takes work and time. Careful planning as to where to hide it and if it's worth hiding at all. Right clicking to destroy, too easy.
It depends what you're looking for. Make sure to do your research, as different breeds have different temperaments, energy levels, etc. and it is important to get one that matches your lifestyle (not just now, but for the next 10-15 years as well). Always consider adoption/rescue or REPUTABLE breeders. NEVER get a dog from a pet store (these come almost exclusively from puppy mills). Try to avoid backyard breeders (those that don't really know how to produce healthy puppies, do not health test their dogs, are doing it for money or just to make cute puppies, etc.).
Hey guys, I'm in the market for a new 65" 4K TV. My budget is about $2000. I have been looking at some open box Samsung 8500 and 7700 but the new P series seems very tempting. I have been on rting.com, but it doesn't seem to help narrow it down. The TV will be used for about 50% video games and 50% movies/TV | 512 |
ao3 | older sisters worries, “need a lift?”
Alex just nodded as she ran to her locker to grab her keys and wallet and let Supergirl fly her home, leaving her bike at work until tomorrow.
Kara dropped her off and Alex went to work trying to get herself presentable. She brushed her teeth and hair and put on a nicer pair of underwear before putting on a nice top and trying to wiggle into a pair of skinny jeans. She literally was on her bed trying to wiggle them up when Maggie walked into her apartment and stared at her for a good 20 seconds before laughing.
“Babe, what are you doing?” She asked walking over to sit next to Alex who was still struggling with her pants.
Alex took a deep breath as the bed beside her dipped under her girlfriends weight, “I’m getting ready for tonight.”
Maggie raised an eyebrow at her, “what’s tonight?”
“Oh thank God! You didn’t remember either?” Alex said as she started laughing.
It took a minute before Maggie realized what had happened, “oh shoot! date night! I completely forgot.”
Alex sat up and giggled before pulling Maggie in for a proper kiss, “I can’t believe we both forgot, But all’s good because I’m honestly so tired. “
Maggie ran a soft hand down Alex’s cheek, “I know babe. It’s been a rough few weeks. Why don’t we have a nice night in?”
Alex nodded and smiled, “That sounds great, anything particular in mind?”
“We could walk down to the market and get stuff for me to make dinner and then we could sit down and watch that new crime documentary you’ve been dying to see,” Maggie suggested.
“That sounds amazing.” Alex told her before leaning in for a quick kiss, “let’s put on something comfy and walk down there.”
The two got up and worked on changing, Alex hanging her nice cloths back up before grabbing some yoga pants and a comfy top. Maggie changed out of her work outfit and slipped on her favorite pair of light jeans and a flannel.
“Ready?” Alex asked walking towards the door.
“Always!” Maggie told her as she tucked her side arm into the back of her jeans. The two joined hands, locked the door and walked down to the market at the corner of the block.
As they walked into the market Alex pulled Maggie back before they went to find ingredients, “You get dinner and I’ll do dessert?”
“Sure! Meet me at the register?” Maggie asked and Alex nodded before kissing Maggie’s cheek and turning the opposite direction of each other.
Maggie went to produce section while Alex sneakily went back out on the street, turning into the alley and pulling out her phone.
“Alex Hey! What’s up, how’e your date?” Kara asked cheery on the other end.
“Hey Kara, it’s good. We’re just going to stay at home. But I have a favor to ask- are you busy tonight?” Alex asked her sister pacing the alleyway.
“Hmm, nope. Mon-el and I are going to watch Game | 512 |
reddit | speak for a lot of men here when I say that I'm perfectly happy sitting back with a beer and watching the world burn. Women and the cucks they control let this happen and they can deal with it.
A lot of people seem to be unaware that the spam filter is far from perfect, and it often likes to feast on perfectly non-spammy posts. When this happens, the post disappears completely, and unless one of the mods catches it in time it will never see the light of day. **If you think your submission might have gotten caught, please tell the mods by sending a message to [/r/berkeley](/r/berkeley) with a link to your post.** We try to keep an eye on the spam bin but things do sometimes get missed, and if they stay in the bin for a day or longer then even if we rescue them it's likely that they'll end up too far down on the front page for anyone to see or upvote them. So let us know if you think something's wrong! (Note that the mods can only move posts to and from the spam filter to help it learn how to identify spam - we can't turn it off or tweak it ourselves.)
​ **Timestamp/Album:** [ZT 0450CF](https://imgur.com/gallery/X7WeV2W) **TRADED** ​ Hello everyone. Today I have up for trade a ZT 0450CF in good shape. It has some scratches on the blade that are visible in the pictures and some wear on the MXG Gear deep carry clip. It will also come with the original clip. It was just sharpened today with a Wicked Edge. ​ As far as trades go I am not looking for anything in particular but I am a lefty so anything lefty or ambidextrous is great. I have been looking for a Bark River Bravo 1. I will add funds for the right trade as well. Thanks for taking a look and let me know if you have any questions or would like any more pictures.
You will enjoy it, it was a pretty straight forward build and then a nice canvas to paint. The cockpit is a little sparse and as far as I could tell there are no detail kits to improve it. That being said the photos I found of the real thing so the cockpit to be really sparse anyway. I picked up some Eduard seat belts that looked right and added those, glad I did as they are about the only thing you can see in through the windows.
Thats fine though because nowhere in thr constitution is it allowed for the federal governement to dictate what a states land is to be used for. So even if it all goes to oil and coal, thats up to the state to decide not the federal government. No matter which way you slice it that land belongs to the state to do with as it pleases and never should have been a "national park" to begin with.
If anything i'm speaking of matches where I'm first/second picking a stronger hero that is | 512 |
StackExchange | data comes from a database.
I populate my combo boxes using data validation with the following code:-
With Selection.Validation
.Delete
.Add Type:=xlValidateList, AlertStyle:=xlValidAlertStop, Operator:=xlBetween, Formula1:=list
.IgnoreBlank = False
.InCellDropdown = True
.ShowInput = True
.ShowError = True
End With
where list is a comma separated string that I have built up from the database recordset.
This all works fine. The problem arises when I re-open the workbook later on. I get an error
"Excel found unreadable content. Do you want to recover the contents of this file"
You say Yes and Excel then gives you
"Excel was able to repair the file by removing features"
And the data Validation from some of the Combo boxes is gone
I suspect from some internet searching that the string I'm using for my Data Validation is too long?
It isn't an option for me to add the recordset values to a hidden sheet and set the Data Validation source to a range on the hidden sheet as the combo boxes are dynamic and chop and change depending on user selection. I really just need to be able to set the Data Validation to my string that I have built up at various points in the user interaction.
If it is a case of the string being too long is it possible to append to Data Validation or is there another trick I can use to get around this issue?
A:
I've manipulated validation lists before in some of my Excel projects. When you set validation to Allow:List, you can set your data Source to be a workbook-level named range. In this example, I've defined a named range "listrange":
With Selection.Validation
.Delete
.Add Type:=xlValidateList, AlertStyle:=xlValidAlertStop, Operator:= _
xlBetween, Formula1:="=listrange"
.IgnoreBlank = True
.InCellDropdown = True
.ShowInput = True
.ShowError = True
End With
You'll never get an error for that formula string being too long.
I put all my validation-referenced named ranges in one worksheet, and make it hidden. Then my code manipulates those named ranges, which in turn update the values available from the validation drop-down menus.
It can be tricky to dynamically update the size of the named ranges while they are being updated, but it's not too hard with VBA, particularly not if you're returning sets from a database, where you can get a record count. The alternative is to go the ActiveX control route, but I like the clean, native look and feel of the data validation drop-downs.
Q:
Does DNA polymerase I require a $3^\prime$ end?
DNA polymerase III adds nucleotides in the $5^\prime \rightarrow 3^\prime$ direction because it can only add nucleotides to the $3^\prime$ end of the previous nucleotide. This is why it requires a primer. However, does DNA polymerase I operate by the same criterion? Does it require a $3^\prime$ end of a previous nucleotide in order to bind successive DNA nucleotides?
If it does, then how can it do so for Okazaki fragments when each Okazaki fragment is unbonded to each other? It is the DNA ligase that finally catalyzes the phosphodiester linkage between the $3^\prime$ end | 512 |
reddit | when it comes to death. I completely understand how you feel. The thought of the unknown and the uncertainty of what happens after death can be frightening and there's so many different debates on what happens after death and many of the different beliefs on what happens at and after death stem from religion. But the truth is nobody knows other than the dead, and if there's nothing after death but nonexistence then even the dead don't know since they're dead I know it's scary and hard to think about. But see a doctor before this fear gets worse You can message me anytime if you need to. Best of luck we are all in this together I hope you find peace soon :)
I'm still trying to find which tone and style etc. I like. I'm looking at the Bullet Startocasters (with an HSS setup) but I've both heard people say they're great and that you should stay away from them. So now I'm here trying to get some new suggestions or recommendations from people for an affordable guitar
The problem is that the plateau occurs in the MMR system, while the ranks are in the LP system. This can cause you to be facing people in higher ranks than you while you are still trying to climb to the rank you're supposed to be at, which can be a huge problem, as you'll only win 50% of the games at that MMR, but to advance, promos require you to win more than that. In a perfect world, you would always be paired with people of your rank, and so it would make sense win rate wise. However, that isn't the case because we have two systems of measuring rank.
I'm from Poland and i always use couriers to get my packages to work. Much faster and easier. 'Paczkomaty' is a cool tool, but i still prefer couriers that will get stuff to my hands. And you can get your packagade after work from Paczkomaty, getting it during the day is a better option IMO ;)
I don't have snapchat or any other popular social media apps. However, I do frankly enjoy the ability to carry on interesting and meaningful conversations with people. Especially if I'm considering having a serious relationship with them, potentially even for the rest of my life. You do you. But me? I'm not seriously dating people who don't have anything interesting or engaging to talk about ever.
Omg seriously?! Totally made my day haha you are amazing thanks! :D Actually I've got finals until around ~6:15 PST and I possibly may not be able to trade until 8 PST or so but I should be able to at around 6:30 PST (I believe that's 8:30 your time zone) I will leave a comment here when I'm sure I'll be able to trade :)
And maybe if we wish hard enough, pollution and global warming will just, you know, go away. Truth is, some people are shit patents who in a perfect world wouldn't be trusted with raising a cactus, much | 512 |
ao3 | soulmate. He found him.
It’s funny how Namjoon can tell when people are with their soulmates even though, he doesn’t have one himself.
“I think you guys can leave now.” Namjoon says softly with a small smile.
Their mouths hang open and one manages to stutter out, “Y-Yoongi found his-“
“Shhhhh. Yes. Yes, he did. Now, can you leave and leave him be.” Namjoon says and they usher their way out in a clumsy fashion, hands still linked. People who found their soulmates are always more cheerful than ones who haven’t. It’s to be expected. They found love and experience affection.
Namjoon knows how happy Hoseok is and Namjoon is so happy he found someone like ‘Yoongi’. He hopes that Yoongi is a good person who will make Hoseok happy. After all, it’s what he deserves.
Namjoon goes to the back and pulls out more blankets for the two. He doesn’t want to wake them up and plus it would get a little chilly at night. He doesn’t want Hoseok getting sick and uncomfortable when he wakes up. He carefully places the soft blankets over them and tries not to wake them up.
“Okay, let’s close up now.” He gets up while, talking to himself. A habit he developed when he motivates himself. He closes the lights and locks everything up. The only thing is to go home so, he pulls on his scarf and puts on his hat.
“Let’s go, home.” He murmurs and looks out the window, hoping to see the color of the moon one day. People say it’s white-ish, but he wants to see it when it’s the blood moon or the super moon. It’s the same routine every day. Working at the flower shop and going home with whimsy dreams. Who wants to see the a celestial object that bad? It’s not even that. He just wants to see it in its true form with all its colors.
He jumps and his heart races when a tall, broad-shouldered man appears out of nowhere from the door. He looks funny yet handsome at the same time. His strikingly good looks somehow goes with his wild expression and tousled hair.
“I’m very sorry but have you seen two men that’s been looking for a ‘Yoongi’? God, I feel like a dad. I bet they’re going to make fun of me when I get home after I search for them. it’s not like I can control whether my back hurts or not-”
“Yeah, they were here a couple of minutes ago and I think they went home…” Namjoon’s eyes are closed with tiredness. He’s not trying to show it and takes deep breaths to stare into the man’s eyes. He doesn’t finish his sentence when his eyes are exploding with _colors _. His eyes immediately snap up to the sky. Staring at the moon, so soothing, bluishly radiant, lighting up the dark night with hope that radiates through the dark hours of his life. There’s no way to describe what he feels.__
____
____
His head whips to look at | 512 |
s2orc | with 0.5% FBS and plated in the upper chambers. The lower chambers were filled RPMI or DMEM with 10% FBS. After 16 h, the medium in the inserts were removed and washed with PBS. The inserts were filled with 3.7% formaldehyde for 5 min. Thereafter, the inserts were incubated in methanol for 30 min. The filters were stained with 10% Giemsa (Sigma, St. Louis, MO, USA) for 15 min. The inner side was wiped with cotton swabs. Migrated cells were counted under a light microscope.
Caspase-3 assay Caspase-3 assay was performed as previously described. 21 In brief, cells were lysed in 80 µL of lysis buffer (50 mM HEPES, 100 mM NaCl, 0.1% CHAPS, 1 mM DTT, 0.1 mM EDTA, pH 7.4). Then, 20 μl of SOX9 expression decreases survival of patients with intrahepatic. . . X Yuan et al.
cell lysate were incubated in 70 μl reaction buffer (50 mM HEPES, 100 mM NaCl, 0.1% CHAPS, 10 mM DTT, 0. mM EDTA, 10% (w/v) glycerol, pH 7.4) and 10 μl AC-DEVD-AFC caspase-3 fluorimetric substrate (Biomol, Hamburg, Germany) for 90 min at 37°C. Subsequently, caspase-3 activity was detected by fluorometric measurement using Tecan infinite M200 (excitation 400 nm; emission 505 nm). The caspase-3 activity was normalised to protein levels and reported as relative fluorescent units per minute per mg protein.
Immunoblotting
Immunoblotting assay was performed as previously described. 20 Briefly, total cell protein was extracted on ice using radio immunoprecipitation assay buffer with freshly added protease and phosphatase inhibitors. Protein concentrations were assessed with a Bio-Rad protein assay. Twenty micrograms of total cell protein extracts was subjected to 10% or 12% SDS-polyacrylamide electrophoresis gel and transferred to nitrocellulose membranes. Five per cent non-fat milk in Tris-buffered saline with Tween-20 (TBST) was used to block nonspecific binding. Membranes were probed with primary and secondary antibodies in TBST according to the manufacturer's instructions. HRP-linked anti-mouse and anti-rabbit Abs were used as secondary antibodies. α-Tubulin and glyceraldehyde 3-phosphate dehydrogenase were used as a loading control. Signal was visualised by incubating the blots in Supersignal Ultra (Pierce, Hamburg, Germany).
RNA isolation and quantitative real-time reverse transcription polymerase chain reaction Total cell RNA was extracted using the InviTrap Spin Universal RNA Mini Kit (Stratec, Berlin, Germany), according to the manufacturer's instructions. For first-strand complementary DNA (cDNA) synthesis, reverse transcription of 500 ng RNA was performed with random primers (Thermo Scientific) and RevertAid H Minus M-MuLV reverse transcriptase (Thermo Scientific) according to the manufacturer's instructions and subsequently diluted with nuclease-free water (Invitrogen) to 10 ng/µL cDNA. For
Faster Convergence with Lexicase Selection in Tree-based Automated Machine Learning
Nicholas Matsumoto
Cedars-Sinai Medical Center
Sydänsairaala Hospital
Tampere University
90048Los AngelesCAUSA
Anil Kumar Saini
Cedars-Sinai Medical Center
Sydänsairaala Hospital
Tampere University
90048Los AngelesCAUSA
Pedro Ribeiro
Cedars-Sinai Medical Center
Sydänsairaala Hospital
Tampere University
90048Los AngelesCAUSA
Hyunjun Choi
Cedars-Sinai Medical Center
Sydänsairaala Hospital
Tampere University
90048Los AngelesCAUSA
Alena Orlenko
Cedars-Sinai Medical Center
Sydänsairaala Hospital
Tampere University
90048Los AngelesCAUSA
Leo-Pekka Lyytikäinen leo-pekka.lyytikainen@tuni.fi
Cedars-Sinai Medical Center
Sydänsairaala Hospital
Tampere University
90048Los AngelesCAUSA
Jari O Laurikka jari.laurikka@sydansairaala.fi
Cedars-Sinai Medical Center
Sydänsairaala Hospital
Tampere University
90048Los AngelesCAUSA | 512 |
ao3 | wishes he'd been slightly more social in his high school days. This is a casual form of physical contact, isn't it? He certainly thinks so. But Jihoon is positive he won't live much longer if he's blushing like a nun when Seungcheol so much as touches his shoulder. He wants to scream.
"You know, I did promise to make it up to you." Jihoon frowns.
"What?" He asks, confused.
"From before, when I knocked over your work. I want to make it up to you." Seungcheol's voice gets closer to his ear, and Jihoon shivers. His head is still slightly bowed, his gaze directed to the moonlit water of the pond in front of them. Seungcheol's hand is still holding on to him, and Jihoon feels a little dizzy.
"Cheol? Can you- oh."
Jihoon snaps his head up faster than he can blink and the warmth on his shoulder is suddenly gone. He feels a little disappointed and tries not to show it on his face as the owner of the voice is glancing between the two of them from the now half open door, looking a little distressed.
The boy has long black hair tied back in a ponytail and eyeliner smudged across both eyes, a cocktail glass in his right hand. He's not quite pretty. His features too soft, too elegant. _He's beautiful_.
Jihoon doesn't recognise him but Seungcheol does, rising from his place next to Jihoon and hurrying over to him.
"Jeonghan? What is it, are you alright?" He looks the other boy up and down, concerned. Jeonghan only shakes his head and takes a few gulps of air before his eyes flicker towards Jihoon, who shifts in his seat uncomfortably.
"I- can I talk to you inside? It's urgent." He says, eyes still on Jihoon.
Seungcheol frowns, opening his mouth to reply but Jeonghan cuts him off before he can say a word.
"Please?"
That seems to do it for Seungcheol. He reluctantly nods as he follows the boy inside, turning back quickly to give Jihoon a brief apologetic look as he goes in. Jihoon blinks. This was not how he expected things to go. Then again, he's not entirely sure what he expected in the first place. The sight of Jeonghan pleading with Seungcheol made his stomach twist painfully, and seeing the captain look at him in such a worried way only made it worse. As if Jihoon can even think of having a chance with campus's most desired when someone like Jeonghan is around. Jihoon shakes his head, trying to brush off his frustration. _Seungcheol is just a dumb crush,_ he tells himself. _I'll get over him._
Heaving himself off the bench resignedly, Jihoon makes his way back inside the building. He can take a taxi home. Soonyoung and the rest will want to stay and watch Mingyu further degrade himself, no doubt.
Instead of bringing her hands up to touch Lyn, Florina leaned to kiss the exposed flesh, her mouth leaving a trail of kisses leading to her chest.
Lyn’s reaction was to grab onto | 512 |
gmane | displays the fields from the message file as
input/output) to display various information on the signon display
(tip/joke/recipe/pathetic inspirational saying of the day, corporate
strategic direction statement du jour, news of upcoming company
picnic/BBQ/golf tournament/fire alarm test/Saddam Hussein
look-alike-contest, daily winner of the "guess the mystery meat in the
cafeteria special" contest, phone numbers for support staff, poison
control center, etc.). The top part of the display could also be used to
put the company name, web site URL, etc. on it, and I added the date/time.
I always leave the signon display for QCTL alone.
...Neil
Hello,
I set up a vserver by simply copying / to /vservers/test and making a
/etc/vservers/test.conf, and after entering the vserver changed the root
password ;)
After some testing I tried cfdisk. To my amazement inside the vserver I
could change my disk partitions. After removing the disk node from
test:/dev this stopped working. Is this a feature or did I forgot to
read something on /dev nodes?
Any insight is appreciated.
Floris
There's been some chatter on edu-sig (python.org) of late regarding
Python's
capabilities in the "edit/continue" tradition, meaning debugging
tools, and/or
IDE tools, that give the developer real time write access to running
programs.
I think a good design would be something like the ZODB, or the ZODB
itself,
to save the entire working environment, like a Smalltalk image, at
which point
a "supervisor Python" (a whole different instance, perhaps on another
chip),
could do "brain surgery" on the "hibernating Python" (like a patient
undergoing
surgery).
You basically simulate or emulate the "operating table" version,
without putting
yourself at its mercy. If you break it completely, while doing your
brain surgery,
just abort the instance and roll back to the previously saved
version. It's like
sitting on top of a version control system, while never getting to
directly edit the
currently operating version (the supervisor).
The alternative, allowing a developer to undermine his/her own running
platform,
seems to unnecessarily conflate a runtime and design time mode, which
isn't
just some stupid prejudice.
We need that separation, just as we keep distance between production
and
development copies of things.
Don't fix a running engine if you can fix an emulated running engine.
Once you're
happy with your changes, commit, and set it running for real. It
still might crash,
which is why you're glad for rollback capabilities.
Smalltalk images meet CVS?
Python atop Mercurial?
Kirby
Hi all,
I am having a problem with X Windows on my RedHat Linux 8.0
installation. I have installed the OS twice already trying to figure out
what was going on. When I try to start X Windows, whether booting to a
graphical login or using startx, I get to the part where it shows the splash
screen (after login) and it freezes. It has never recovered from this, and
I can't alt-ctrl-backspace out of it. Can anyone help me?
Thanks,
David Smith
If I do an internal redirect within a web2y site, such as though
http://www.example.com/app/default/test1 below, then changes to the
session are not saved.
The flash message | 512 |
gmane | and I am willing to backport all bugfixes which have
accumulated since the last release of the library.
Best Regards,
Julian Taylor
Hi,
I have installed MySQL 4.1.7-nt + Apache 2 + PHP 5.0.2 + PHPMyAdmin
2.6.0-pl1 on my Windows XP Pro SP2. I am trying to solve the problem with
MySQL PHP Old Clients using OLD_PASSWORD instead of just PASSWORD.
How can I set on "my.ini" to start MySQL using as a default the
OLD_PASSWORD?
I tried to insert:
[mysqld]
--old-passwords
and
[mysqld]
old-passwords
but both didn't work.
Does anybody know how to do this? Is any other better way to make PHP5 work
with the new password format without recompiling (It is easy on Linux/Unix
but not on Windows XP).
Thanks for any help.
Andre
Hey all—
Being primarily a Ruby hacker, I run into a lot of git users lately.
(Git is the current shiny thing among Rails developers.) Git users
seem to like the `rebase` command for a lot of different reasons. I
know various Mercurial equivalents for `rebase` use cases have been
discussed here, but I haven't seen them collected into one place before.
So I thought I'd document some common Mercurial workflows, and at the
same time stimulate discussion about the relative merits of `rebase`
vs. `transplant` vs. mq, etc. with a blog post: <http://kbullock.ringworld.org/2009/4/24/on-rebasing
>.
I'd love to see some discussion here or in the comments; maybe we can
turn this into a page on the wiki (if there isn't one already?).
Pacem in terris / Mir / Shanti / Salaam / Heiwa
Kevin R. Bullock
I had someone ask how to determine what their RAM config was on their system, which they were not physically near.
Here is the shell script I was able to locate that does this. I am not sure how well it works on x86/Solaris, but it works fine on SPARC systems:
http://www.zill.net/memtest.sh.txt
Save it as memtest.sh , then run "chmod +x memtest.sh" and run it.
If someone knows of a newer version, please let me know about it.
--Patrick
Hi List
I have successfully deployed ITM4BI 5.1.1 to a hub spoke TMR environment.
However I am picking up the following problem. When deploying the ITM4BI
resource models onto an AIX 4.3 server the java process consumes a very high
amount of CPU and memory. In some cases 50 % of what is available.
I have searched the list and I have noticed that there have been CPU and
memory problems with ITM 5.1.1 before. I am running FP5 which I have seen
has fixed most of the other members issues. I am also running a relatively
late version of JRE. 1.3.1_11 and Tm aver 109.
Any ideas ?
Paul Wiggett
Hello,
I'd like to ask you for considering UI feature freeze exception for the
following bug:
https://bugs.launchpad.net/unity-lens-applications/+bug/1231556
This change fixes an inconsistency in naming of "Search plugins" filter
option vs the corresponding "Dash plugins" results category.
This should remove any confusion among users. Since filters are
collapsed by default, I believe this change has minimal impact
on screenshots.
Kind Regards,
Pawel Stolowski | 512 |
ao3 | beside the hospital bed. Kidd sits there, resting his head in his hand and gazing wearily up at the deathscythe.
"Where's the girls?"
"They're gone," the teen speaks, broken and tired sounding. "I.. got slammed into a wall. A couple of times, actually. Finally it just knocked me out cold. I woke up and they were just..." a small hand gesture, followed by Kidd staring down at the bed, "gone. She got them. The witch." It falls silent for a moment, Spirit taking a seat on the end of the bed. Kidd turns his gaze back to the window. "...Can we get out of here, Albarn? I have a hotel room at the place on 4th street-"
"Yeah," Spirit cuts the boy off short, running a hand through his hair and standing up. "You got it, Kidd." The reaper nods silently, hopping off the bed with a small, pained cringe. As he walks to the door Spirit stands, following close behind, and sets a hand on the young reaper's shoulder. "Hey."
"What," Kidd mumbles, shoving his hands into his pockets with an attitude that brings memories back to Spirit of his daughter's snotty little weapon.
"Don't... Don't worry to much, alright kiddo?" Albarn's hand moves from his shoulder to the reaper head, ruffling his hair despite the noise of protest the teen makes. "I'll help you. We'll find them, alright?"
Kidd pauses for a moment, staring up at Spirit with a frown still set on his face. Slowly, though, he nods. "Thank you, Deathscythe."
A Sadder Story
**Author's Note:**
> Set in the future not too long after the end of A Dance With Dragons. In this story, Meera and Jojen left the cave without telling Bran whilst he was undergoing training in his last chapter and began a slow journey south. Sansa has returned to Winterfell.
In the three days she had been at Winterfell the girl had barely spoken. Every so often she would open her mouth and breath in deeply, as if she was about to say something important, but after a pause she would close it again or murmer something distant about the food.
When Sansa had first seen her she had thought that a different girl was crawling over the snow and rubble towards the castle. But her hair was too light a shade and her gait was all wrong. She looked the right kind of mess though. The men’s britches that she wore were faded and worn through at the knee and one hand, swollen and missing a finger, was wrapped around the three pronged spear shifting from side to side in front of her. When the girl had seen Sansa standing at the window she had seemed to recognise her, lowering her arm with a gasp of relief that brought the Norrey guard running, although Sansa was certain they had never met. Her name was Meera, a Lady Reed from the crannogs of the Neck, the daughter of one of her father’s old friends, so the girl had told her.
She was more a woman | 512 |
ao3 | way before he entered, his only intent was to greet the low spill of members as the morning went on; honestly, it was to justify his extended trip into space.
Izaya tossed his phone to the side, but left it in his vision while he rested his head upon doubled forearms. Every few minutes he would jostle the thing awake to make sure it suffered along with him. At the least it was reassuring to have an additional sleepless partner than just the one in the other room denying him company.
* * *
**Notes for the Chapter:**
> A shorter chapter. Some of them might vary in length. XD;;
4. Chapter 4
It was Kevin who spoke up to finally dispel the tension in the air. “You could've talked to the Smiling God through me plenty of times,” he insisted. “And I'm still here, I'm still me.”
The group seemed to collectively hesitate, unsure whether that was any kind of blessing—but, no. There wasn't such time for judgments like that. Dr. Kayali took up head of the group once again, but only for a long enough moment to give it over anew.
“Alright, well, you know more about what's going on than any of us, Kevin. And we're running out of options. What the hell are we supposed to do next?” she asked.
Kevin hesitated, his face turned up toward Carlos as if to look to him for advice, support, something. Carlos took his hands. That was all he could give. It was enough.
“...alright. This is going to be pretty unorthodox but—I lost my bloodstones. Has anyone else here got theirs? I'm afraid I'm going to have to use them.”
Four sets of hands went fishing through their pockets as everyone who'd come from the old Night Vale tried to pull out their own set of bloodstones. Unorthodox, definitely. But there wasn't a soul who'd refuse in a moment of desperation.
Roger pulled his set out fastest, and tossed the pouch into Kevin's lap.
“Don't do anything to piss them off,” he insisted.
Kevin could do nothing but force out a laugh, nervous and still trying to fake that smile he'd always worn. As if it would really make him less nervous, after all.
“Oh, I'm going to piss a lot of things off. Sorry.”
**Notes for the Chapter:**
> so, sorry it's been about a month since my last chapter. also, sorry if you got two notifications? I accidentally posted this before I was done fixing it up, before. but... here it is now.
46. Ritual
**Summary for the Chapter:**
> Kevin begins a ritual, following a plan that only he is sure of. The others, meanwhile, are forced to wait and wonder.
**Notes for the Chapter:**
> no warnings but I so can't promise that for long. hahah.
Kevin couldn't see Roger's bloodstones as he spilled them out of their pouch, but the energy they gave off bristled at his touch, unwelcoming. He traced his fingers over the carved runes to tell them apart, and slid delicately onto | 512 |
Pile-CC | with the company. GM has taken the lead on the negotiations and its agreement may be used to set the pattern for the other two companies.
The contract talks will determine wages and benefits for 111,000 union workers at the auto makers, and they also set the bar for wages at auto parts companies, U.S. factories run by foreign automakers and other manufacturers, which employ hundreds of thousands more. The contract talks are the first since GM and Chrysler needed government aid to make it through bankruptcy protection in 2009.
Ashton wrote that “difficult restrictions” have been placed on the union and company as a result of the bailout. GM nearly ran out of cash and needed $49.5 billion from the government to survive, but it’s been making billions in the last two years because its debt and costs were lowered in bankruptcy and its new products have been selling well.
To get the government funding for GM, the union had to agree not to strike over wages at GM and Chrysler, which also needed government help. Also, unresolved issues can be taken to binding arbitration, and the union’s new contracts must keep the companies’ labor costs competitive with Asian automakers such as Toyota Motor Corp. and Honda Motor Co.
“As you know, several difficult conditions were agreed to in order to obtain financing during the bankruptcy,” Ashton wrote in the note to local union officials. “We are confident that we can reach an agreement that will meet many of the goals we set at the beginning of negotiations.”
The union has been seeking bigger profit-sharing checks instead of pay raises, higher pay for entry level workers who make $14 to $16 per hour, signing bonuses and guarantees of new jobs as auto sales recover. Ford and Chrysler want to cut their labor costs to get them closer to Honda and Toyota, while Chrysler wants to hold its costs steady.
The Associated Press and WWJ AutoBeat Reporter Jeff Gilbert contributed to this story.
Automotive reporter for WWJ Newsradio 950 and CBS Radio News...
I'm now celebrating more than twenty years at WWJ, and have the honor of being the only broadcast reporter in the U.S. assigned to exclusively cover the auto industry.
What more...
LMB has received word that our bicycle safety legislation will likely be put to a vote when the Senate meets this week!
This great news is a result of the thousands of emails supporters like you have sent to legislative offices in recent weeks. Thank you! We need your help again to continue to advance these bills. Please call your Senator TODAY to urge them to vote YES on this important bicycle safety package. Just a few minutes on the phone will allow your Senator to hear in your voice how important this legislation is.
To find your Senator's name and phone number, use the Find My Senator search. Most offices are open from 9 a.m. to 5 p.m., Monday through Friday. Voice-mail messages are also encouraged if you cannot call during office hours. Below is a sample | 512 |
StackExchange | "correction work", i.e. the work that consists of correcting something. PIV has another good example: "la korektaj reguloj de presejo", i.e. the rules that a printing house has defined concerning how to correct manuscripts. Note, however, that this regular meaning of "korekta" is only very rarely needed.
Also note that while it is right to say that "correct" cannot be a regular meaning of "korekta", "korekta" has been used in the sense of "correct" by many competent Esperanto speakers, including Zamenhof himself (in his late years). So one can say that "korekta" does in the actual usage have this meaning, even though it is not a regular meaning.
But also note that many competent Esperanto speakers avoid the usage of "korekta" in the sense of "correct" because of its irregularity, as they want to contribute to Esperanto usage becoming more in line with the general rules. The most respected dictionary (PIV) and the most respected grammar (PMEG) both recommend avoiding "korekta" in the sense of "correct". Instead, one should use "ĝusta" or "senerara", depending on context.
A:
According to PIV korekta means:
1 Rilata al korekt(ad)o: la korektaj reguloj de presejo; korekta domo (establejo, kie oni provas korekti k plibonigi junajn deliktulojn).
2 (evi) = laŭregula, ĝusta: via desegno ne estas sufiĉe korektaᶻ; paroli en iu lingvo korekteᶻ.
Thus korektaj reguloj are rules for correcting things: ‘correcting rules’, not ‘correct rules’.
Note that the second meaning does indeed coincide with the meaning of ĝusta. However, PIV marks this as evitinda (worth avoiding).
Q:
using SignalR with document onload instead of jquery onload
I have used the signalR chat app (as laid out in this tutorial http://sergiotapia.com/2011/09/signalr-with-mvc3-chat-app-build-asynchronous-real-time-persistant-connection-websites/) in a standalone test site and it all works great.
I'm now trying to incorporate it into my larger project.
Now unfortunately my larger project has a body onload function defined, so i don't use the standard jquery $(function () {}); syntax for executing stuff on page load. This hasn't been too much of an issue so far, most jquery plugins and scripts get executed in the function called by my body onload and its fine.
But for some reason, my signalR code just isn't executing.
Its the exact same code as laid out above, only its called on my body load.
The page loads, does a post to /signalr/negotiate (which returns the url and clientID)
In my sample app which works, it then does a continuous post to /signalr/connect
In my other app, it simply does a single get to the page im currently on.
Its not making the post to connect.
Is there a way to manually call this?
Here is the source of the page not working.
Please note that the reason im not referencing JQuery itself is because its loaded in my master page. JQuery is present.
<script src="/public/javascript/jquery.signalR.min.js">
<script src="/public/javascript/json2.js">
<script type="text/javascript" src="/signalr/hubs">
<div>
<input type="text" id="msg" />
<input type="button" id="broadcast" />
<ul id="messages"></ul>
</div>
<script type="text/javascript">
function ExecuteOnLoad() {
// Proxy created on the fly
var chat = $.connection.chat;
// Declare a function on the chat hub so the server | 512 |
s2orc | dê, o autor apresenta o caráter paradoxal da condição humana, o ressentimento surge da impotência da vontade humana confrontada com sua finitude, esta representada pelo sentimento do "passar do tempo". Impotente para confrontar diretamente sua condição, o homem parte para criação de um além-mundo metafísico, o qual deverá dar sentido e justificação a sua humana condição. Neste quadro, o sofrimento decorrente da finitude é significado enquanto purgação de uma culpa original, o pecado.
A terceira subparte traz a autossupressão como tema central. Nela, o autor investiga essa interessante lógica aplicada ao fundamental problema da vontade de verdade. Primeiramente, observa que a dualidade verdadeiro x falso repousa sobre uma avaliação moral e crença metafísica na existência de valores absolutos e imutáveis. A tese epistemológica da verdade e falsidade tem sua origem na convicção moral de ser mais valioso um cosmos ordenado e dotado de uma hierarquia última de valores. Tal moralidade, que deposita substancial valor na verdade, desenvolve no homem um dever de busca pela verdade, que levado a cabo promove, justamente, uma investigação genealógica das origens e fundamentos da verdade. Inexoravelmente, essa análise genealógica, motivada pela vontade de verdade, leva à conclusão da arbitrariedade dos fundamentos da própria verdade incondicional, essa revela então: "seu condicionamento e sua relatividade a condições de conservação e incremento, ou seja, a relações de poder, que são o contrário de exigências incondicionais" (p. 165). Ainda que a filosofia transcendental e o idealismo alemão tenham pretendido uma mudança de foco ao colocar a questão das condições de possibilidade do conhecimento, desviando a investigação de seus fundamentos, o dever moral da busca pela verdade é sublimado em honestidade intelectual. Esse dever de honestidade força o homem a aceitar as conclusões de sua análise genealógica. Neste ponto, tem-se o momento culminante, pois a honestidade intelectual e a vontade de verdade forçam a reflexão a voltar-se contra seus próprios fundamentos e, em última análise, contra si próprias. Como conclusão, o
Além de sua importância epistemológica, a autossupressão também traz contribuições para analisar o ideal ascético e sua possível superação, tema que o autor aborda logo em seguida. Novamente o ponto de partida é a natureza paradoxal do homem, em especial o sofrimento e sentimento depressivo que carrega em decorrência de sua natureza animal ser podada pela "camisa de força do social". Os impulsos violentos que até então eram extravasados, postos para fora, são agora forçados contra ele mesmo, interiorizados e fermentam, no olhar bilioso, o ressentimento. Diante desse quadro surge o sacerdote asceta trazendo não a cura para tal sofrimento, mas uma explicação, significando-o enquanto sofrer necessário para a purgação da culpa -o sofrimento é dotado, então, da causa imaginária do pecado: "A culpa é, no limite, compensação para o impensável, ela permite que o homem se inclua na perspectiva de um sentido, tornando-se, por essa estratégia, aceitável para si mesmo" (p. 142). O autor aventa ainda, o que seria uma solução não nietzschiana para o paradoxo do humano, transcrita no ideal budista e na passividade da doutrina de responder a agressão "dando a outra face"; de modo que, através de | 512 |
goodreads | unique, ambitious science fiction epic that was a slow-burner, but very rewarding in the end. Vinge introduces some creative concepts and bold characters that seriously impressed me.
I love this series. Simon and Chelsea's story was great, and brought a whole new cast of hotties in for more of Lexi Blake's stories.
This is the first book in the Born to Darkness series by Evangeline Anderson.
This book is a mixture of Anita Blake and Sookie Stackhouse worlds.
You first meet Addison an non-glam which means no vampire can glam her and make her feel or image things in her mind. She's also a auditor for government to check on vampire owed companies or bars etc.
Alec Corbin is a very old vampire who owes Under the Fang nightclub and has loved Addison since she first checked his premises 2years ago.
Really good story just feels at times like its a bit long but a lot does happen and the struggle between Addison and Corbin doesn't feel rushed and develops is a lovely romantic story. Looking for to Taylor story (Addison BFF).
Our library director had the administrative team read this book. I never would have heard of it otherwise. This is a well written book that I highly recommend to anyone. It is an eye-opener when it comes to what is going on in the publishing/book selling world. It will be a rare day when I buy a book from a chain after reading this book. And be prepared to add a whole lot of books to your reading list because every chapter has book lists and often discusses in depth the book store's favorite books.
Curiousity got the better of me and I picked it up from the library :)
******Spoilers could be ahead*******
Hold my tissues while I tell you why I LOVED this book.
1. Lia's character development. She becomes a BADASS, moreso than she already is. General Lia. Prophet Lia. Lover Lia. Friend Lia. Daughter Lia. Sister Lia. Queen Jezelia ! She is so wonderful.
2. I loved how the prophecy in the song of Venda comes together.
3. Kaden and Pauline :)
4. Lia and Rafe's angst that hurts so good.
5. Die, Komizar, Die!!
6. "If we can find a way to end centuries of animosity between the kingdoms...surely...we can find a way for us." Yes Rafe!
As with my reviews for the last two books, here are the clues I found that we are the Ancients:
Page 331-CDs, hood ornaments and coins
Page 428- More advanced weaponry
Page 491- ALCATRAZ, ANYONE?
Page 528- the Ancients traveled in space!
Page 576- Maybe Mt. Rushmore? Not sure.
Page 627- "They flew among the stars. Their voices boomed over the mountains. And this is all that's left."
Page 662- Mention of a blue sphere that is a map of our world, like a globe.
This review gives a better explanation that I was too exhausted to relay for what didn't work for me, Bubu's Review
3.5 stars
By the time I got to book 3, I really wanted to like this one, | 512 |
gmane | reference Eu2O3 structure could be taken).
Regards,
Sumit
I sent this in two weeks ago as an attachment but perhaps it should have been inlined. This is the patch with all the changes suggested by Robert Krawitz. If there are no issues, please incorporate this into the current baseline. If there are any issues, I am here to address them. If I'm being too pushy, forgive me, I understand.
Steve Letter
Datamax-O'Neil
Hello dovecot users,
I have updated the MANAGESIEVE patch to apply and compile against
dovecot 1.0.rc28. Not much has changed with respect to the functionality
of the previous version however:
ChangeLog vs v2
- Updated source to compile with dovecot 1.0.rc28, tested with rc27
(debian package)
- Daemon now uses the same location for .dovecot.sieve as dovecot-lda
This is typically ~/.dovecot.sieve.
- If .dovecot.sieve is a regular file, it is now moved into the script
storage as dovecot.orig.sieve, preventing deletion of (important)
active scripts upon managesieve installation. Otherwise, it would
simply be replaced by a symlink to the new active script.
- Changed error handling to yield a BYE message when the managesieve
daemon exits unexpectedly (upon login) before any commands are
entered. Horde-ingo would wait indefinitely for a response.
This patch still includes (yet another) instance of the CMU Sieve
source, as explained in my previous mail
(http://dovecot.org/list/dovecot/2006-July/015016.html).
It can be downloaded at:
http://sinas.rename-it.nl/~sirius/dovecot-1.0.rc28-MANAGESIEVE-v3.diff.gz
Have fun testing the patch. Notify me when there are problems.
Regards,
I am new to databases.
I have table 1, a primary source, which generates a serial number to make each item unique.
I want to use this number to generate a row in table 2 linking the two rows and allowing specific information on each item to be developed..
I have a number of books, including one specifically for Postgres.
What I don't have is the language to look this function up.
Concepts like JOIN appear to used to create views not new rows on other tables.
Help will be appreciated.
Bob Pawley
Hi
I am trying to make a new FS which includes the DHCP client - when
I select it in menuconfig and then do a make, make fails trying to
retrieve dhcp 3.0.3. I FTPd to the site myself and see version 3.0.4
and 3.0.5RC1 but no 3.0.3 (hence the failure)
So my question is, how do I get my buildroot make to go for version
3.0.4? (assuming that is the correct course of action)
Thanks
---Raymond
I want to customize the way errors are displayed on the JSP page. For
example: I wish to place each action error next to the field that it is
assigned to. Is there a taglib out there that will help me do this. I'm
able to access the key but I am unsure how to resolve the string to the
proper value in the ApplicationResources.properties file. Thanks in advance
for your help.
Thanks,
Brad Gibson
Hi all,
I have just pushed some patches which add support for stand-alone
'deriving' declarations. The main motivation for this is to allow you
to use the instance deriving mechanism | 512 |
gmane | Anybody interested?
Noel Rappin
All,
This is probably better posted to the sasl user group, but I'm hoping
someone can point me in the correct direction. I'm relatively new to
the whole linux world, and would like to learn about the different
security mechanisms (ldap, pam, sasldb2, kerberos, plain, etc...)
especially regarding sasl, and how sasl implements/configures these
mechanisms.
While configuring Cyrus (and I love it), the security was a big black
hole that i feel uncomfortable not understanding. Any links, README
docs, or books you would recommend to gain a better understanding with
how the whole authentication/authorization process works would be
greatly appreciated.
Thanks,
Unfortunately we seem to have missed a change that was needed because of
the ABI change in 3.1r3. We have not noticed this until now because the
old kernels were still included in the archive and on CD images. With
3.1r5 the old images were removed which brought the issue to the surface.
The result of this is that for some architectures (i386, hppa, ia64, s390)
an incorrect kernel may be selected during base installation.
See also: #412295, #412909.
The changes should have been made in some default values included in the
rootskel udeb. Updating the rootskel udeb now would mean that we would
need to rebuild D-I images, which is obviously not very desirable.
Fortunately an alternative solution is possible: correcting the default
after it has been read from the debconf database.
I have implemented this solution in base-installer (1.13.4sarge2) and
uploaded that new version to stable. As base-installer is not included in
D-I initrds for the affected architectures, this means we "only" need to
include this new version in stable and rebuild CD images.
I understand that a 3.1r5a was already being considered, so this fix could
be included in that update.
For the mean time I have added an erratum item in the appropriate places
on the website (will be visible after next website rebuild):
- http://www.debian.org/releases/sarge/debian-installer/
- http://www.debian.org/CD/releases/
Cheers,
FJP
Dear Chris:
I would encourage complementary, weekly meetings on Reaction Grid. Perhaps one could extend the idea a little bit and also encourage hypergridding logons from OSGrid to Reachtion Grid (and from Reaction Grid to OSGrid) to get more activity on hypergrid links between grids as part of this meeting.
Of course, I would also encourage an additional meeting or two on Wright Plaza or any of the other plazas on OSGrid for various activities and groups as we continue to push the stability and reliability of OpenSim regions. All of this is to our mutual advantage.
Charles
Hello,
I'm receiving quite a bit of spam to the address dedicated to this
list, mostly nigerian spam and other kind of frauds.
Now, without musing about the intelligence of people harvesting email
addresses off a list devoted to network security, I remember that,
about a year ago, someone expressed interest in getting these
messages.
Is it still the case ? If yes, where should these messages be
forwarded ?
Thanks,
Stephane
What methods can be used to walk a Hpricot::XML tree from the root all | 512 |
gmane | in the way
current transforms do, and "soft" tf's, which are run through a filter
if there are conflicts. It might also be a way of solving the "4-bar
link" problem that someone raised earlier on the mailing list. This
shift from deterministic to probabilistic paradigm would probably
require an overhaul of the whole tf mechanism, but the advantages are
obvious.
Ivan Dryanovski
Bill Morris
Set out for a ride this morning on my Fold Rush, got about 2 blocks
from home and my rear tube exploded - there's a tear about 16" long
along the inner circumference of the tube. The tear is not along a seam
or flash line. This is the tube supplied with the bike when I bought it
at the factory a few months ago. The tube is marked "Sunlite 700 x
28-35". The wheel is a Shimano Deore XT disk hub 32 spoke with a
Velocity Razor rim and a Schwalbe Marathon 700x35 tire. I can't find
anything in the tire that might have caused this. I also notice that the
rim has a bit of a wobble in it now but I don't know if the wobble was
present before the explosion. Any idea what might have happened?
Followup: I replaced the tube and set out again. This time I got about 3
miles before experiencing a virtually identical failure. Thinking about
it on the way home I came up with the following hypothesis: the tire is
slipping on the rim, allowing the tube to escape between the bead and
the rim, thus causing the tube to fail catastrophically as it no longer
is contained by the tire/rim combination. The tear is centered along the
inner circumference of the tube, which is where I would expect it to be
if this hypothesis is correct.
So here's a new question: why hasn't this happened before? This
rim/tire/tube combination has been on the bike since new, inflated to
about 80-90 psi each time I ride the bike. The sidewall says minimum
pressure of 50 psi, maximum of 85 psi.
And another question: how do I keep it from happening again? Right now I
don't trust the bike which really takes the pleasure out of riding.
thanks,
John
Hi
Site local IPv6 address have been depreciated for over a year now (RFC3879). Last month a suitable replacement (RFC4193) was published. I suggest we change /etc/rc.d/network (and rc.conf(5)) to reflect these developments in the solidifying area of IPv6 standards.
I propose we add a new variable "ip6uniquelocal" to be used like "ip6sitelocal" except for FC00::/7. Additionally, I recommend ip6sitelocal be removed.
Jonathan Kollasch
Hi ,
Im trying to change the default boot animation in Honey comb code
base. Have searched entire code base to find the "bootanimtion.zip",
but unable to find the exact location in the code base. Eventhough in
the device, under the path "data/local" or "system/media", there is no
"bootanimation.zip" file.
I have downloaded one bootanimation.zip and placed in the "data/local"
and "system/media" path , but after init logo display, blank screen is
shown instaed of animation until HOME | 512 |
realnews | the driver to the smell of smoke.
"I was like, 'We should get off," Arcese told News 4.
Flames quickly spread and engulfed the entire bus within minutes, ravaging the entire front of the bus and burning the seats inside.
"I saw burning rubber falling from the bottom, and flames," Arcese said.
The driver and the boy quickly got off the bus, and responding firefighters knocked out the blaze. No injuries were reported.
As soon as they were safe, Arcese called his mother, who at first didn't believe him. Then her son's cool demeanor helped calm her nerves, she said.
"He's such a calm kid, and I knew he was OK," Stacy-Perone Arcese, Rocco's mother, said. "And I was OK 'cause I knew he'd be OK."
Arcese said it's not the first time he smelled smoke on a bus. His mother hopes it's the last.
"I think they all maybe need to be revamped in some way, shape or form," she said.
The fire is believed to have been caused by a mechanical problem, according to the fire chief.
It wasn't the only scare involving a school bus across the Tri-State on Tuesday morning. Five elementary age children were taken to a hospital with minor injuries after their mini school bus careened into a house on Long Island. The school bus driver was also hospitalized. The cause of the crash in Amityville was under investigation.
The Sports Xchange
By Paul Harris, The Sports Xchange
Avalanche win on Benoit's overtime goal
DETROIT - The Colorado Avalanche didn't play their best game on Thursday night, but they made it work.
Defenseman Andre Benoit's goal with 31 seconds left in the overtime period gave the Colorado Avalanche a 3-2, come-from-behind win over the Detroit Red Wings at Joe Louis Arena on Thursday night.
"We found a way to win that hockey game. We were sticking to it and found a way to win," Colorado coach Patrick Roy said.
The Avalanche trailed 2-1 after two periods, but right wing P.A. Parenteau tied the game 5:48 into the second period when he scored on a backhander from in front after Detroit goaltender Howard's stick had been accidentally knocked out of his hand by teammate right winger Johan Franzen. It was Parenteau's 13th goal.
Benoit scored the overtime goal on a one-timer from the left circle off a pass from rookie center Nathan MacKinnon. It was Benoit's fourth goal.
"That was a great pass by Nate MacKinnon and I got a good shot off, " Benoit said.
The assist extended MacKinnon's point streak to 13 games and broke Wayne Gretzky's record for longest point streak for an 18-year-old. Gretzky set the record during the 1979-80 season.
"It's pretty cool. I want to be as consistent as possible. He (Gretzky) probably doubled my point total in those games," said MacKinnon, who has five goals and 13 assists during the stretch.
He also leads all NHL rookies this season with 22 goals and 51 points.
Center Matt Duchene had a goal and an assist for Colorado (41-17-5), which won its | 512 |
reddit | of you. Maybe clear the air with an open talk about how both of you feel on the matter? Be as open and non-defensive about it as you can do. If either of you get defensive, it won't work.
I'm on a 970/fx8350 playing on high@1080p. Finished campaign and never dropped below 60 once that I saw. I am surprised at how well it runs while also looking very pretty. I thought bungie would screw up since they've been console only for so long, but they have done a great job as far as I'm concerned
I do recommend it :) I was free-to-play for 2 years and then subbed (been subbing for 3 yearsish now)...I like playing all the classes through their stories. I do pvp but not seriously...just learn to use the "ignore" feature, and you will enjoy that much more ;) I like to just chill-play too..not taking anything too seriously but seriously having fun :) Hope my opinion helps! PS: loved KOTOR I and II...also, I think ROTS Episode 3 is the best of the sw movies, so take my opinion for what it's worth ;)
Start with exercise. It will help with several things. Then write a to do list and circle the five easiest things. Do one, then take a 5 minute walk. Then another, repeat. Once you're done all five, you'll feel more able to take on the harder tasks.
When I started Dark Souls 1, I kept going immediately through the graveyard with the skeletons in route to the catacombs and getting killed very quickly. They were so tough it was ridiculous. Now I look back and laugh. This game forces you to learn timing. If you don't or refuse to learn, it will give you no mercy.
The concept of religion is stupid. There are millions of Europeans who go to nude beaches daily. You think they burn in hell? You think the native Americans ever gave 2 shits about what politics Muhammad was going through during his time? You think the other thousand religions that come and go are all fake and the one you happened to be born into because you happen to come from a part of the world where it was founded, all of a sudden is the right one? You think such an omnipotent and watchful God would write such a pile of shit that is any of the "holy books"? You think a baby " goes to hell?" Even goes to heaven? You think Neanderthals went to heaven? How about homo erectus? They lived on earth for like 50 thousand years, what about them? What about all the fucking dinosaurs that lived on earth 300million years ago, did they ever give a shit about some stories? This planet is billions, fucking billions of years old. It has been dominated by many lifeforms and communities for hundreds of millions of years before humans even figured out standing upright. Now we live in a very recent, short time of human dominance. And oh all of a sudden God was here all along. | 512 |
s2orc | the ancient tombs that are crowded by the pilgrims every day. One of the tombs that becomes the landmark of Tuban City is Sunan Bonang's tomb, located in Kutorejo, downtown Tuban. This tomb is in a very strategic location, behind the Great Mosque of Jami, the Tuban Square area. Until today, this cemetery area had become Tuban's icon with its slogan as the Bumi Wali.
Sunan Bonang tomb area in Tuban is a tourist destination and one of Tuban's economic drivers. Every day, pilgrimage activities in this area last for 24 hours. As a result, in the center of Tuban City and surrounding areas, various trading activities emerge in response to the tomb pilgrimage tour. Another impact can be seen from the life of several roads around the center of Tuban City. The movement of pilgrims causes this to the tomb area that lasts all day. Sunan Bonang's tomb area gives a new meaning as a religious tourism area and provides an identity for the city. It is necessary to observe the pilgrimage activities in the tomb area's management and development as a tourist destination. The influence of pilgrim movements on the tomb's formation becomes important to be investigated, given its massive role in reviving the area. From that observation, it can be known how a tomb has a deep meaning for pilgrims can even carry the city icon. This research is expected to provide knowledge about the role of belief systems, socio-cultural factors, and pilgrimage tours for regional development and urban planning in the future.
LITERATURE REVIEW
The Making of Place
A place becomes meaningful because it is created from several important components, such as space and people. Space and place are dialectically structured in human environmental experience since our understanding of space are related to the places we inhabit, which derive meaning from their spatial context [1]. It means the making of a place is driven by the close relationship between people and their place. Dovey explains that space becoming a place occurs because of the relationship between people with a deep meaning [2]. The place has a physical view, spatial experience, the character of the place based on space experience, and the depth of meaning for those who feel it. Since the 1960s era of urban thinkers like Jane Jacobs, Kevin Lynch, and William Whyte, placemaking theory has developed. The term placemaking is used as changing a part of the physical environment, which is occupied by people and objects, embodying a shared view. Placemaking is the process of transforming space into a place. This placemaking is then understood as an actionoriented process to shape the environment [3].
Movement as Placemaking Process
Placemaking is a social space process. Lefebvre explains that social spaces are shaped by social actions, both individually and collectively [4]. Social actions explain how a spatial space is conceptualized by those who fill and animate the space. It means that one space can be determined as placemaking by user actors that shape the place. One of the placemaking projects called People for Public Space (PPS) illustrates that | 512 |
StackExchange | one $j$ at $1$. This would not be a big deal since I could just apply an index shift to one of the two series but then the powers of $(-x)$ would not longer match. Further, I am not totally sure how the author of referred proof dodged or accomplished this step.
My question is split up into two parts. $(1)$ Is my approach to the equality from above - beside the part where I "cheated" by asking WolframAlpha to expand $f(x)$ as a series - valid i.e. the usage of Ramanujan's Master Theorem here, the simplification of the RHS, etc.? $(2)$ How can one derive the series expansion of $f(x)$? Is it possible - without knowing the explicit power series - to deduce the pattern given by the MacLaurin expansion as values of the Polygamma Function $\psi^{(2)}$? Can we apply the Cauchy Product here; if yes how can we take care of the unsuitable indices? I would be interested in a whole derivation of the series expansion for $f(x)$ as well.
Thanks in advance!
A:
Combining Maxim's suggestion to define the $0^{th}$ coefficient of the Trilogarithm series to be zero and ysharifi's given proof here on AoPS it is rather simple to obtain the given expansion. Using the Cauchy Product leads to
$$\begin{align}
\operatorname{Li}_3(-x)\cdot\frac1{1+x}&=\left(\sum_{n=1}^{\infty}\frac{(-x)^n}{n^3}\right)\cdot\left(\sum_{n=0}^{\infty}(-x)^n\right)\\
&=\sum_{n=1}^{\infty}\sum_{k=1}^n\frac1{k^3}(-x)^n\\
&=\sum_{n=1}^{\infty}\left[\sum_{k=1}^{\infty}\frac1{k^3}-\sum_{k=n+1}^{\infty}\frac1{k^3}\right](-x)^n\\
&=\sum_{n=1}^{\infty}\left[\sum_{k=0}^{\infty}\frac1{(1+k)^3}-\sum_{k=0}^{\infty}\frac1{(1+n+k)^3}\right](-x)^n\\
&=\sum_{n=1}^{\infty}\left[-\frac12\psi^{(2)}(1)+\frac12\psi^{(2)}(1+n)\right](-x)^n\\
\end{align}$$
$$\frac{\operatorname{Li}_3(-x)}{1+x}=\frac12\sum_{n=1}^{\infty}[\psi^{(2)}(1+n)-\psi^{(2)}(1)](-x)^n$$
Q:
Invalid cursor state, SQL state 24000 in SQLExecDirect
I need to call two stored procedures in sequence via ODBC in PHP:
#run stored procedure 1
$query = "Shipped_Not_Shipped_Rep ".$_GET['rep_id'];
$result = odbc_exec($dbh, $query);
odbc_result_all($result);
#run stored procedure 2
$query = "Shipped_Not_Shipped_Account ".$_GET['account_id'];
$result = odbc_exec($dbh, $query);
odbc_result_all($result);
I'm getting this error in PHP after the second stored procedure call:
Warning: odbc_exec() [function.odbc-exec]: SQL error:
[unixODBC][FreeTDS][SQL Server]Invalid
cursor state, SQL state 24000 in
SQLExecDirect
If I re-arrange the order I call the stored procedures, it is always the second that errors. Is there a way to, idk, reset the cursor position between calls? A little out of my element here.
A:
Open two handles to the database. ODBC probably maintains the cursor in the handle.
A:
Something to try for people getting invalid cursor state with SQL server:
SET NOCOUNT ON;
At the top of your stored procedure or SQL script.
Found here: https://social.msdn.microsoft.com/Forums/en-US/f872382a-b226-4186-83c7-0d0fcadcd3eb/invalid-cursor-state?forum=sqldataaccess
I had this problem just running some very average SQL in SQL Server 2017
Q:
PHP telegram bot: send message all users from in id.txt
I created a php telegram boat. In this case, I will store the user id in the id.txt file.
$message = $update->message;
$text1 = $message->text;
$fadmin = $message->from->id;
$baza = file_get_contents("id.txt");
$saqla2 = "$baza\n$fadmin";
file_put_contents("id.txt", $saqla2);
Then how do I send a message to every registered user? So you need to send a message to all the minorities.
$text2 = str_replace("/xabar","",$text1);
$response = file_get_contents("https://api.telegram.org/bot".API_KEY."/sendMessage?chat_id= //there all user id from $baza // &text=$text2");
A:
you can store user_ids in a text file :
for example list.txt :
108926499
108926497
108926496
now send a message to all users index.php:
<?php
$apiToken = "XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX";
$users=file_get_contents('list.txt');
$users=explode("\n",$users);
foreach ($users as $user)
{
if (empty($user)) continue;
$data | 512 |
reddit | work. You're the one who has been lied to. You're just another one of the many, many people who tricked by promises of easy solutions to tough problems. I know we get sloppy with the science a lot on this sub, but that's because we're just so fucking in the dark about it all, medically speaking. We're poorly understood, not completely off-base. There's a difference. **TL;DR: All I'm asking for here is legitimacy. It's not my fault you don't have it.**
> When you return to Fort Trinity in the final step of the level 70 personal story, you talk to the largos before you talk to Trahern. She was never introduced, and you talk to her like you've met before. She does show up in the cave at the beginning of the level (at least in my storyline). But you talk to her about how you're in her debt because she helped you out with Apatia and Abaddon's temple. Woops
Hey guys so I just got off school and as always when I have time off, I binge watched the originals (Im on the side of the originals, idm the prequels but only watched them once for context and never bothered again as I wasn't ultimately impressed) and I was planning on watching the prequels tommorow. How do u guys do it? 4-5-6-1-2-3 or 1-2-3-4-5-6? PS- RIP Darth Vader man what a fucking character. Everytime I watch the originals as i get older and have more respect and critique for films, I appreciate how perfectly done these films were. PSPS- Films shoulda ended at ROTJ, the new films are tacky imo and I agree they take away all the victories that ROTJ had at the end. Shows how having different directors for each film in a set causes the story of those films to have no fluidity whatsoever.
Ashes, Ashes, We All Fall Down. Bunch of kids and their teacher get trapped in a house that is run by faceless, silent men. Anytime they try to escape, they are tortured or killed by booby traps. Read it around age 9, never forgot about it and it's never explained where they were or why.
So I have contacted the good folks over at AFK Tavern (http://www.afktavern.com/) and spoke to them a little about a possible event over there. But for this to work, I would have to show them a high level of interest from players that are looking to be there for a grand time, for this to be a profitable venture for them. Now, I'm not saying we have to be there for every day, but I think the day of the finals is a given, and possibly one, maybe two other days?
Some time ago Microsoft got in trouble for dictating too much about what OEMs (aka, vendors) could do to a Windows installation. In the consent decree MS gave up much of what they could control and basically promising to let the market work itself out.
One of the downsides to letting the market work itself out: sometimes the market makes bad | 512 |
gmane |
using mod_proxy, pass other requests via the load balancer again to the
three apache/mod_perl/catalyst servers. (We did it with mod_proxy_balancer
for a while, but found the hardware load-balancer did a better job).
The front apache servers are configured for maximum threads, with Keep-Alive
on and very high connection timeouts. The mod_perl servers are configured
with the usual pre-fork and Keep-Alive off. We maximise buffers in the
front-end to release the mod_perl process as soon as they can to handle
another request.
We generally restart the mod_perl servers in turn, so although there's a
slow restart that's invisible to end users. Should there be a problem with
all the servers the front apache gets a 502 proxy error, so we replace that
with a pretty page.
One of the advantages of mod_perl is that you only have a single instance of
perl running, so you only have code in common to your apps loaded once (so
that covers everything from core and CPAN as well as bespoke common code.)
If we want to run a slightly different version of a codebase we use
"PerlOptions +Parent" which gives you a separate perl interpreter for a
particular vhost.
Now I wouldn't say this is a good setup for *everybody* to use, but
certainly there's a class of users where this type of setup will work very
well.
Carl
I have definitely been here before, and I'm sure I will again. I think that
the replies so far have covered all the relevant ground, but I just wanted
to add my moral support.
But that said, I do a unit in the beginning of each class about the
difference between an "opinion" and an "analysis" or "position" (basically
critical thinking). So when moments like this come up and I am not knocked
too sideways by them, I can remember to come back to the question, "Well, is
this an analysis or an opinion?"
Good luck!
Karen
Hi,
Should we bid adieu to the HTTP11 connector (the old, non-Coyote one) at
some point in the near future? It's been deprecated for a while, and
given the default settings (Coyote) and active discouragement from using
HTTP11 to user, I think it's safe to assume it's not being widely used.
We can remove it from the distro, and/or move it into a CVS Attic.
Thoughts / Comments?
Yoav Shapira
Hi,
restoring the database only from pg_dump/pg_restore
seems to be impossible if one uses foreign keys much.
The tables referenced are most of the time not available
by the time the referencing tables are created. Even
restoring by OID order does not help.
How are people doing this? The only solution I found was
editing the restore script by hand and transform all
constraints to ALTER TABLE statements at the end.
The other problem was that there are apparently no user
information in the dump to restore users too.
What solutions are available?
I've tried to go thru the source code of pg_dump
buts a bit organic ;) I think it schould move
all constraints out of the table definition | 512 |
YouTubeCommons | quiet what if the other person talks and I don't talk then I go to jail but the other person doesn't so my incentive is do I really trust the other person or should I just talk and and whatever the other person does well the other person does then you think okay I have the the two incentives over there the the the person on the other side is going to be also thinking oh should I talk or not talk eventually it comes to a thing called the Nash equilibrium named after John Nash and if you guys have seen the movie A Beautiful Mind it it tells like a great story it's a highly recommend watching but if both of them talk each one gets seven years in jail right so you're gonna risk do I trust the other person completely then each one spends two years in jail do I stay quiet and then the other person talk and I go to Jay the other person doesn't or do I speak in the end the incentive is everyone's gonna talk because you'll try to minimize the time spent in jail not talking comes with a potential penalty of spending 12 years in jail versus if I talk I spend only seven years so a lot of game theory sometimes is on non-cooperative games this one is non-cooperative because each one is compete each one of the prisoners is competing for their own Freedom or minimizing the time they're spent in jail there are other modalities on the Cooperative games let's talk a little bit more about that so let's say there's an actor and you have on one side something not trustworthy and on the other side the other end of the spectrum you have a situation there you consider to be trustworthy the first question that comes to mind is what is the threshold for being trustworthy right we can put a bar over here and say is this a good threshold I don't know we can try to move this a little bit over here to the bottom and say let me be too low right it's it's a very low bar to to gain Trust of of someone you can be very uh sorry I'm gonna go back over here that one on the other hand is very high bar you say oh I need something very a guarantee of some something before I can see the trustworthy so perhaps we can compute what is that trust for being trustworthy how do we go about doing that let's build a trust game so there are going to be two actors over here the first one is a truster someone who is trying to gain the trust the second one is trustee so the trust is trying to gain the trust from the trustee but there's something interesting over here the thruster has to be trustworthy if you try to act as someone who is not trustworthy you already started this game in the wrong way | 512 |
Pile-CC | Singh Badal constituting a three-member panel to look into all shamlat land deals in Mohali district.
"It is part of the CM's strategy to keep the issue alive and deflect attention from the thriving drug nexus in Punjab under his government's patronage. Will this panel just single out opposition leaders or also look into all 77,000 cases of shamlat land grabbed by their own high and mighty, including director general of police (DGP) Sumedh Singh Saini, former DGP PS Gill and state election commissioner SS Brar? Majithia also breached the privilege of the House by quoting from the report of the Justice Kuldip Singh Tribunal, whose very setting up has been challenged by his government in the Supreme Court. To prove his intentions are good, the CM should first withdraw the special leave petition filed by his government in the apex court," Bajwa added.
Constitutional experts say the minister's statement can amount to breach of privilege if his speech is studied verbatim. "The exact usage of the words by the minister and the sequence of statements will decide if the minister breached the House's privilege (if he passed a judgment before an inquiry). As for contempt of court, the House can discuss a matter which is sub judice, but the speaker should have forbidden a sub judice matter from being discussed in the House," noted constitutional expert Subhash Kashyap said.
No probe report submitted: Kang
Financial commissioner, revenue, NS Kang, when contacted, denied that any report had been submitted by his panel on the land deals of Punjab Congress chief Partap Singh Bajwa. "I have yet to submit a report on the matter," Kang said.
Kristen Wavy Hairstyling Tip:
Step 2: Slightly twist a one-inch section before wrapping it loosely around a large curling iron. Hold the section in place for a few seconds to set the curl, release and repeat all over alternating the curl direction.
Step 3: Run your fingers through your hair to break up the curls and coax fullness. Part to the side.
Menu
THE 10 HOTTEST HOUSING MARKETS to WATCH in 2015
Not only did Boston make the list but so did Middlesex County….Sellers NOW is the time.
Every December, Trulia’s Chief Economist Jed Kolko takes a look at the data and picks the top markets to watch in the new year. The list is always an attention-grabber and full of insights that agents can learn from to build a targeted, booming business, and this year is no exception. Check out our top markets to watch—and take a look at what makes each one so special!
Before we dive in, let’s get a little technical with how Trulia’s team selected these markets. For the past few years, the so-called “rebound effect” has driven real estate market trends. But that effect is beginning to fade. So what replaces the rebound effect in the next stage of the housing recovery? Well, the real estate market then increasingly depends on fundamentals such as job growth, rising incomes, and more household formation.
Because of this, our 10 markets to watch have strong | 512 |
reddit | depends on what this fight means to Rocky. Every fight he wins there is something driving him towards victory. Even when he lost to Creed in Creed v. Balboa I he fought just to stay in the fight, and he did it. His will power kept him going. This is why he lost to Club record Lang in Lang v. Balboa I. Rocky wasn't hungry anymore. He was on top for years. That's why Lang destroyed him. When he beat Lang in their next fight it was for Mick. The same goes for Drago, who is much taller than Rocky. He beat Drago for Apollo. So if Rocky has a good reason to fight Mac then Rocky wins from his willpower. If it's just a random title bout then Mac could take Rocky down in 2 rounds. In a fight to the death I give the edge to Rocky. Knowing that he will die and leave Adrian and Robert alone in the world would be all the willpower he needs to win. In a Mac and Rocky team up I say they can take on most normal humans, up begin to lose when they go up against super humans or even peak humans. Like Captain America and Batman respectively. I'd say they might could take down Bruce Lee(in movies where he is stronger than he was in real life,) but people past him would be a tough fight for them. Tony "Duke" Evers would punch the shit out of Doc Louis. Duke trained both Rocky and Apollo, the two greatest fighters ever of all time. Doc Louis is a fat slob who is obsessed with chocolate. While this might help him win since he is chocolusted I say Duke because he would be in better shape and has more correct proportions. I'm not sure I understand the final one. Do they fight against each other with the help of the other fighters? Is it just a fight to the death like Rocky vs Apollo? If it is a fight to the death with the help like Mac and Sandman vs Rocky and Tyson then I say Rock and Tyson. Tyson is the real life equivalent to Sandman. Same for Rock and Creed. Creed is the Rocky universe equivalent of Muhammed Ali.
If I wanted to prepare individual meals in containers. Any idea of which Rubbermaid product is ideal for that? I don't drink alcohol at all. I guess the few bad habits I have are eating unhealthy junk and caffeine. Tea is cheap but it doesn't have enough caffeine for me. I abhor coffee. It is so bitter and nasty to me.
The [Haṭha Yōga Pradīpikā](https://en.wikipedia.org/wiki/Hatha_Yoga_Pradipika), composed in the 15th century by Svātmārāma, is one of the most well-known texts on physical yoga. It is often published with the Jyotsnā commentary of Brahmananda. A. G. Mohan has just [published a new translation](https://www.svastha.net/books/) drawing upon his notes of private studies and audio recordings with [T. Krishnamacharya](https://en.wikipedia.org/wiki/Tirumalai_Krishnamacharya). What I find interesting of this version is that it give us the chance to know the | 512 |
Gutenberg (PG-19) | reserved._]
LONDON:
SAVILL AND EDWARDS, PRINTERS, CHANDOS STREET,
COVENT GARDEN.
CONTENTS OF VOL. II.
CHAPTER THE FIRST.
PAGE
OF SUNDRY MY ADVENTURES FROM THE TIME OF MY GOING ABROAD
UNTIL MY COMING TO MAN'S ESTATE (WHICH WAS ALL THE
ESTATE I HAD) 1
CHAPTER THE SECOND.
OF MY OTHER ADVENTURES UNTIL MY COMING TO BE A MAN 50
CHAPTER THE THIRD.
OF WHAT BEFEL ME IN THE LOW COUNTRIES 87
CHAPTER THE FOURTH.
I MAKE THE GRAND TOUR, AND ACQUIRE SOME KNOWLEDGE OF
THE POLITE WORLD 120
CHAPTER THE FIFTH.
OF THE MANNER IN WHICH I CAME TO THE FAMOUS CITY OF
PARIS 164
CHAPTER THE SIXTH.
OF PARIS (BY THE WAY OF THE PRISON AT VIENNA) AND OF
MY COMING BACK FOR A SEASON TO MY OWN COUNTRY,
WHERE MY MASTER, THE CHAPLAIN, AND I PART COMPANY 187
CHAPTER THE SEVENTH.
OF CERTAIN TICKLISH UPS AND DOWNS IN MY LIFE: AMONGST
OTHERS OF MY BEING PRESSED FOR SERVICE IN THE FLEET 206
CHAPTER THE EIGHTH.
JOHN DANGEROUS IS IN THE SERVICE OF KING GEORGE 241
CHAPTER THE NINTH.
REBELLION IS MADE AN END OF, AND AFTER SOME FURTHER
SERVICE WITH HIS MAJESTY I GO INTO BUSINESS ON MY
OWN ACCOUNT 283
THE STRANGE ADVENTURES
OF
CAPTAIN DANGEROUS.
=A Narrative in Old fashioned English.=
CHAPTER THE FIRST.
OF SUNDRY MY ADVENTURES FROM THE TIME OF MY GOING
ABROAD UNTIL MY COMING TO MAN'S ESTATE (WHICH WAS
ALL THE ESTATE I HAD).
A STRANGE Nursing-mother--rather a Stepmother of the Stoniest sort--was
this Sir Basil Hopwood, Knight and Alderman of London, that contracted
with the Government to take us Transports abroad. Sure there never was a
man, on this side the land of Horseleeches, that was so Hungry after
money. Yet was his avarice not of the kind practised by old Audley, the
money-scrivener of the Commonwealth's time; or Hopkins, the wretch that
saved candles' ends and yet had a thousand wax-lights blazing at his
Funeral; or Guy the Bookseller, that founded the Hospital in Southwark;
or even old John Elwes, Esquire, the admired Miser of these latter days.
Sir Basil Hopwood was the rather of the same complexion of Entrails with
that Signor Volpone whom we have all seen--at least such of us as be old
Boys--in Ben Jonson's play of the _Fox_. He Money-grubbed, and
Money-clutched, and Money-wrung, ay, and in a manner Money-stole, that
he might live largely, and ruffle it among his brother Cits in
surpassing state and splendour. He had been Lord Mayor; and on his
Show-day the Equipments of chivalry had been more Sumptuous, the Banners
more varied, the Entertainment at Saddlers' Hall,--where the Lord Mayor
was wont to hold his Feast before the present Mansion House was built,
the ancient Guildhall in King Street being then but in an ill condition
for banquet,--Hopwood's Entertainment, I say, had been more plentifully
provided with Marrowbones, Custards, Ruffs and Reeves, Baked Cygnets,
Malmsey, Canary, and Hippocras, than had ever been known since the days
of the Merry Mayor, who swore that King Charles the Second should take
t'other bottle. He | 512 |
s2orc | matching to recent two-loop results for the cross section in the threshold region in the framework of QED [15]. The cross section is then obtained via the optical theorem, eq. (4). Conceptually we follow the lines presented in [8].
The relativistic corrections to the Coulomb Green function arise from three different sources: (a) the relativistic energy-momentum relation, (b) 1/M 2 Q corrections to the Coulomb potential V QCD and (c) 1/M 2 Q corrections from the electromagnetic current which produces and annihilates the quarkantiquark pair. The corrections from the relativistic energy-momentum relation can be easily determined by taking into account that G c can be written in the form
MINI REVIEW Vasculogenic Mimicry: Become an Endothelial Cell "But Not So Much"
August 2019
Laurence A Marchat
Gabriele Multhoff
Fahd Al-Mulla
Kuwait Genatak
Mónica Fernández-Cortés
Daniel Delgado-Bellido
F Javier Oliver
National Polytechnic Institute
Mexico
CSIC, CIBERONC, Instituto de Parasitología y Biomedicina López Neyra
Technical University of Munich
GranadaGermany, Spain
MINI REVIEW Vasculogenic Mimicry: Become an Endothelial Cell "But Not So Much"
Frontiers in Oncology | www.frontiersin.org
1803August 201910.3389/fonc.2019.00803This article was submitted to Molecular and Cellular Oncology, a section of the journal Frontiers in Oncology Received: 21 June 2019 Accepted: 07 August 2019Edited by: Reviewed by: *Correspondence: F. Javier Oliver joliver@ipb.csic.es † These authors have contributed equally to this work Specialty section: Citation: Fernández-Cortés M, Delgado-Bellido D and Oliver FJ (2019) Vasculogenic Mimicry: Become an Endothelial Cell "But Not So Much". Front. Oncol. 9:803.vasculogenic mimicrytumor microenvironmentmetastasisVE-cadherinanti-angiogenesis therapeutic failurecell plasticity
Blood vessels supply all body tissues with nutrients and oxygen, take away waste products and allow the arrival of immune cells and other cells (pericytes, smooth muscle cells) that form part of these vessels around the principal endothelial cells. Vasculogenic mimicry (VM) is a tumor blood supply system that takes place independently of angiogenesis or endothelial cells, and is associated with poor survival in cancer patients. Aberrant expression of VE-cadherin has been strongly associated with VM. Even more, VE-cadherin has constitutively high phosphorylation levels on the residue of Y658 in human malignant melanoma cells. In this review we focus on non-endothelial VE-cadherin and its post-translational modifications as a crucial component in the development of tumor VM, highlighting the signaling pathways that lead to their pseudo-endothelial and stem-like phenotype and the role of tumor microenvironment. We discuss the importance of the tumor microenvironment in VM acquisition, and describe the most recent therapeutic targets that have been proposed for the repression of VM.
BACKGROUND
The concept of neovascularization was described for the first time in 1787 in the context of developmental biology. The term angiogenesis was coined early in the 20th century but was not applied to tumor biology until decades later (1). Angiogenesis can arise in a variety of forms during cancer, namely sprouting angiogenesis, intussusceptive microvascular growth, and glomeruloid microvascular proliferation (2). Emerging studies have shown that a few tumors can grow without need of angiogenesis even in hypoxic conditions, while other tumors display both angiogenic and non-angiogenic regions (3). Vasculogenic mimicry refers to the ability of cancer cells to organize themselves into vascular-like structures | 512 |
gmane | not technically valid.
-e
Assalam - O - Alaikum,
Friends and fellows ! This mail I recived by some reliable personality which is also my fellow friend study in same campus where I.
He ensure & prove about this matter that's why It's our responsiablity to prevent bad think people whose interupt for bad fames
Assalam O Alaikum
Hello,
I already have Trac 0.12 working and localized (currently using
pt_BR). However, I want to update certain messages in the
translation.
I've already read and followed <http://trac.edgewall.org/wiki/
TracL10N> steps, but since my original installation of Trac was done
using easy_install, I'm not sure of how can I update this installation
with my recently compiled messages.mo. Is there any way of doing it?
Thanks for the attention,
-- Mírian.
Hello,
I'm giving a presentation at the GITA conference in
Grapevine TX in April, as part of the OSGEO track
there. (Audience: electric/gas/water utilities,
telecommunications, etc.)
Subject of the talk: highlights of management of a
project as open-source, especially where that differs
from software development in the single-company,
closed-source model.
Although the audience is likely to be mostly consisting
of non-software developers, I'll be calling on these very
people to team up with each other and with in-house
and/or consulting software engineers -- across company
lines -- to launch, build, and maintain open-source
apps that address needs in their respective subject
areas.
I've got a fair amount of research to do to compile this
information -- what apps and file structures comprise a
viable project server, presenting all that through the
project web site, etc.
It has occurred to me that it would be useful to create
an "Open-Source Project Starter Kit," a file structure
consisting of the means to create and maintain a
project, with none of the actual content. It's skeleton
website definition would simply point at the
unpopulated management components.
A quick google suggests there are tools out there
addressing some of this. And there's Sourceforge, of
course.
But if OSGEO were to create such a kit, it could be
constructed so that the resulting projects match many of
the criteria for qualifying as OSGEO member projects
later.
Any ideas out there on the feasibility of something like
this, how to construct, etc.? I know a starter kit such as
this would be most attractive to the GITA audience I'll
be speaking to if it as close as possible to being a
one-button operation.
Thanks,
Robert H.
Hi Robin,
Basically if you backup weewx.conf, the skins directory and the bin/user directory you should be fairly safe. Where these files/directories are will depend on how you installed weeWX. A setup.py install is very good in this regard as everything is in /home/weewx. Of course if you have been modifying any of the core weeWX python files you need to backup those. If you have any other scripts that you may run, manually or via cron, that support weeWX (I know you haven't been but an example is a backup script) you should back those up as well.
Since you have been backing up | 512 |
ao3 | and opened his eyes, finding himself in his bed. His heart was beating fast, and his breaths were hectic. He passed a trembling hand over his sweaty hairs to calm himself. He needed some time to know where he was, to remember he was safe...but was the boy safe too?
He tried to catch his breath, but it wasn’t easy.
It never was.
Chanyeol felt like he knew the boy, but at the same time, how could he forget a face like his? It was unimaginable, no one would be able to forget someone as beautiful as him.
It wasn’t the first time that he dreamed about people he didn’t know. Their faces were clear in his mind for only some seconds before everything began to be clouded and blurred.
Once he dreamed of a young man who seemed to be under a lot of pressure. Chanyeol only faintly remembered his features, what was impactful about his memory of this man was that there was a golden plaque on his table where only “Suho” was written.
Another young man touched his cup of water and then froze it.
There was this little laugh too, but he could only remember crinkled eyes. The first time he heard it was when he fainted in PE in high school. He hadn’t eaten anything since the day before and running for more than an hour didn’t help him at all. He would have probably panicked if he hadn’t heard this cute laugh when he was seeing dark spots in his vision before passing out. And every time he was having a hard time, he could remember this laugh which would repeat again and again in his mind.
And lately, it was this boy. He could remember his face more precisely than the others but for less longer.
That’s why he wrote every dream he had in his diary. His therapist told him it could help him to understand his own feelings and what his unconsciousness wanted to say to him. He was doing it since he was 14 and he could firmly say it was shit. It didn’t help him understand why he was suffering from insomnia, why he was having anxiety, why he couldn’t forgive himself from what happen to his family and it didn’t even helped him control his thoughts. So no it wasn’t helping him, but he was still doing it after almost 7 years because it felt like he wasn’t giving up the idea that he could become a better person.
He was seeing the same therapist since he was 13 years old. His uncle forced him to see one when he had a call from school saying that Chanyeol didn’t go to school for a whole week. Not even an hour passed after the phone call and his uncle was already in his house, screaming at him and calling him things that Chanyeol would never forget.
His uncle was angry and he had every rights to be so, Chanyeol thought. His uncle lost his sister who he wasn’t on very good | 512 |
DM Mathematics |
What is the tens digit of 26059?
5
What is the tens digit of 719?
1
What is the tens digit of 1037?
3
What is the units digit of 2463?
3
What is the tens digit of 644?
4
What is the units digit of 367?
7
What is the ten thousands digit of 44489?
4
What is the hundreds digit of 83835?
8
What is the hundreds digit of 350?
3
What is the thousands digit of 3665?
3
What is the hundreds digit of 60661?
6
What is the hundreds digit of 103892?
8
What is the hundreds digit of 51780?
7
What is the thousands digit of 1345?
1
What is the thousands digit of 6354?
6
What is the units digit of 7429?
9
What is the hundreds digit of 2610?
6
What is the hundreds digit of 11767?
7
What is the hundreds digit of 1666?
6
What is the ten thousands digit of 24474?
2
What is the units digit of 1499?
9
What is the tens digit of 12916?
1
What is the hundreds digit of 29076?
0
What is the thousands digit of 54184?
4
What is the thousands digit of 46093?
6
What is the thousands digit of 46382?
6
What is the tens digit of 33012?
1
What is the units digit of 2843?
3
What is the thousands digit of 7416?
7
What is the thousands digit of 9318?
9
What is the ten thousands digit of 57949?
5
What is the tens digit of 22173?
7
What is the units digit of 1655?
5
What is the tens digit of 2489?
8
What is the tens digit of 1810?
1
What is the units digit of 30711?
1
What is the thousands digit of 27165?
7
What is the tens digit of 16639?
3
What is the units digit of 3585?
5
What is the ten thousands digit of 22111?
2
What is the hundreds digit of 1824?
8
What is the thousands digit of 1616?
1
What is the units digit of 220?
0
What is the units digit of 1028?
8
What is the thousands digit of 3232?
3
What is the thousands digit of 10235?
0
What is the tens digit of 7796?
9
What is the hundreds digit of 43033?
0
What is the tens digit of 47421?
2
What is the tens digit of 14673?
7
What is the tens digit of 18?
1
What is the hundreds digit of 1259?
2
What is the units digit of 12631?
1
What is the thousands digit of 58908?
8
What is the hundreds digit of 2606?
6
What is the thousands digit of 9289?
9
What is the hundreds digit of 1864?
8
What is the thousands digit of 2351?
2
What is the thousands digit of 70137?
0
What is the ten thousands digit of 89517?
8
What is the hundreds digit of 3100?
1
What is the units digit of 31627?
7
What is the thousands digit of 6471?
6
What is the | 512 |
s2orc | Impact of Killing (IOK) (22), Trauma-Informed Guilt Reduction Therapy (TrIGR) (23), Acceptance and Commitment Therapy for Moral Injury (ACT-MI) (24), Building Spiritual Strength (BSS) (25), and the Mental Health Clinician and Community Clergy Collaboration (MC3) (26). There is also some evidence that certain PTSD treatments can help with moral injury symptoms (e.g.,
Force correlations in the q-model for general q-distributions
7 Feb 2002 (Dated: February 2, 2022)
Jacco H Snoeijer
Instituut-Lorentz
Leiden University
P.O. Box 95062300 RALeidenThe Netherlands
J M J Van Leeuwen
Instituut-Lorentz
Leiden University
P.O. Box 95062300 RALeidenThe Netherlands
Force correlations in the q-model for general q-distributions
7 Feb 2002 (Dated: February 2, 2022)numbers: 0250Ey4570Cc8105Rm
We study force correlations in the q-model for granular media at infinite depth, for general qdistributions. We show that there are no 2-point force correlations as long as q-values at different sites are uncorrelated. However, higher order correlations can persist, and if they do, they only decay with a power of the distance. Furthermore, we find the entire set of q-distributions for which the force distribution factorizes. It includes distributions ranging from infinitely sharp to almost critical. Finally, we show that 2-point force correlations do appear whenever there are correlations between q-values at different sites in a layer; various cases are evaluated explicitly.
I. INTRODUCTION
One of the main challenges of granular media is to characterize the network of microscopic forces in a static bead pack. In order to describe the corresponding force fluctuations, Liu et al. [1] introduced the q-model. In this model, the beads are placed on a regular lattice and the (scalar) forces are stochastically transmitted, by random fractions denoted by the symbol q. Even in its simplest version, where one assumes a uniform q-distribution, it already reproduces the main feature of the experimental observations: the probability for large forces decays exponentially [1,2,3]. Although for this uniform qdistribution the forces become totally uncorrelated, in general, correlations do persist [4]. In the present study, we investigate for which q-distributions this is the case and we reveal the surprising nature of these correlations. In order to perform an analytical study, we restrict ourselves to the scalar q-model and allow only correlations between q-values in a layer. More sophisticated lattice models, which include the vector nature of the force and allow correlations between layers are not considered here [5].
Although the q-model is particularly simple, its behavior turns out to be very rich. First of all, there is a so-called critical q-distribution, which produces a force distribution that decays algebraically instead of exponentially [4,6]. It therefore forms a critical point in the space of q-distributions, and its properties were recently investigated in great detail [7,8]. A second intriguing issue concerns the top-down dynamics of force correlations (the downward direction can be interpreted as time) [7,8,9]. Even if both in the initial state (top layer) and in the asymptotic state (infinite depth) all forces are uncorrelated, there will be correlations at all intermediate levels. Correlations become longer in range while their amplitudes diminish in a diffusion process, and as a result, the asymptotic force distribution is | 512 |
realnews | U.S. bank account is required by the merchant. Payment21.com provides international merchants with financial access to more customers than any other payment method. Funds clear faster - same day or overnight. Check 21 and UCC governed. A much lower cost than credit cards.
Payment21.com’s ACH (Automated Clearing House) Transaction Processing, their second payment option, quickly automates payments for your U.S. customers, who simply enter their checking account details securely on the merchant’s payment page. The checking information is then electronically converted into an ACH transaction. One of Payment21.com’s strengths is focusing on processing electronic transactions. The company offers advanced services and personalized support behind every transaction. Payment21.com’s ACH Payment Processing is an excellent solution for qualified organizations, reducing the time of receiving paper checks by 1 to 5 days. Depending on your type of business and your check return types and/or averages, Payment21.com settles collected funds via ACH to your business's bank account within 3 to 5 business days.
Payment21.com’s Check 21 and ACH electronic check processing represent different transaction and business models, and provide significantly different information flows, legal frameworks, and risk management capabilities. This is actually a good thing, since it enables different products to meet different business needs and market requirements. For more details on the main differences between Check 21 and ACH transactions, visit http://www.payment21.com.
Payment21.com's merchant approval policy is fully compliant with the Patriot Act. Due Diligence is done on all merchants. In order to comply with AML-provisions, beneficial owners related to cross-border payments get identified however and more importantly, all information is protected by data protection laws.
Whether it’s a Check 21 or ACH transaction, superior fraud protection such as the customizable Verification Loop™ and the proprietary Mitigation Algorithm™ ensures that Payment21.com has the solution that will save international merchants money and enable more U.S consumers to buy from them.
Visit Payment21.com’s newly designed, user friendly website at: http://www.payment21.com for more details.
###
Read the full story at http://www.prweb.com/releases/2011/5/prweb8486083.htm
Senior vice-president, Customer and Corporate Services, Sheree Martin, is pioneering change at Jamaica Public Service (JPS), the leading energy provider for Jamaica.
Having worked in the banking industry, Martin noted that the energy sector is subject to the same dynamics, as all fields go through radical transformation periodically.
"It is an exciting time to be in the energy sector, especially at JPS. It's a constantly changing environment that transforms with each new challenge, triumph, setback, lesson and relationship that comes our way," she said.
Martin acknowledges that, in the past, JPS had been largely seen as a hateful monopoly and was forced to take a sharp look at itself, shake off old habits and embrace being a revolutionary leader in the sector, with the aim to be better, greater, faster and more caring.
She commended the company for making an effort in 2012 to reshape customers' views by starting with their employees and coming together to reflect on what a new JPS should look like.
This led to a new corporate vision, mission and new ways of working. JPS now works hard at putting the right people | 512 |
reddit | the president and was "unaware of the reason" for his firing. >"Under Secretary Steve Goldstein said: 'The Secretary had every intention of staying because of the critical progress made in national security.'" That's very unprofessional the manner in which he was let go, and quite frankly, scandalous in the way it happened, based on the content of the article. >Now that he is fired we are upset? When did this change? No, people are concerned. From my view, we're putting the fox in charge of the hen house, to borrow a euphemism. We also let go of someone who was beginning to make some progress that our CINC hadn't, and replaced him with the head of central intelligence. I question the move and rotation being made in that manner; it reeks. As well, gender aside: putting someone in his place who ran a torture site in Thailand, which lines up with some former comments he has made regarding torture, is morally and ethically reprehensible on every level.
Yeah, I love the new pyromancy flame. It is really interesting because all I heard about it at first was that you had to kill 12 people to use the weapon art and get ONE estus flask and it had lower spell buff and I was kinda disappointed. But then I found out about melee range fire damage and was very happy.
This is super weird, but I have one of the Manic Panic lipsticks (in Vampire's Kiss,) and it's AMAZING. It goes on so nicely, beautiful color, doesn't bleed. Makes my lips feel nice all around. MP has mostly gothic colors, blacks and greens and blues, but they do carry a handful of pinks and reds. Overall very nice! (Plus the tubes are fabulous.)
Thank you so much for this post it gave me the motivation to keep trying! It paid off buyer blatantly lied in feedback and I had proof. One rep said that it was an opinion which makes no sense. I had proof that they lied how can that be an opinion? Long story short after 3 calls 4hrs on the phone and a couple of messages on site I got results. They stated that there was some "misinformation".
I came scrolling down a lot to this post, just to say thank you, OP. When I saw you found one in the forgotten temple, I went there, search around and found it and finally I have the 28 defense ancient greaves to wear with the 32 tunic of the hero and the amber earrings. Thanks!
people with pcs way over the recommended specs are stuttering constantly. and then people like me who don't quite meet them are constantly freezing. this was always somewhat of a problem but it's the worst it's ever been after the compound update. i think optimization should be a top priority considering how badly optimized it is currently and how much one death to lag can screw you over in this game. i've noticed that the devs have a bad habit of constantly adding new things without tuning old things and | 512 |
realnews | attract more than 15 billion pageviews every month.
Although that statistic is huge, it comes as no surprise given that there are (as of right now), 16,343,419,993 Tumblog posts being published, tweaked re-blogged and read by the site’s dedicated community.
At the conference Karp also went on to discuss some of the key features of the platform, and why he thinks it’s become so popular in recent years, standing by the decision to not introduce standard features, like commenting and tagging. According to SocialBeat, Karp explained, “commenting makes YouTube a horrible place”. Although some of the more unusual choices may put some users off, it could well be Tumblr’s rather unconventional attitude to blogging that’s made it such a hit.
You can view Tumblr’s Quantcast page for a more detailed breakdown of the stats.
Share this: Facebook
Twitter
Pocket
Pinterest
Tumblr
Print
Email
LinkedIn
Reddit
Like this: Like Loading...
You might like
[Via SocialBeat
ENOLA, Pa. (WHTM) – With lots of sunshine these days, it’s important to keep tabs on spots and burns that could add to the risk of skin cancer.
A machine in Enola helps to reveal the warning signs.
Teresa Dougan, on her lunch break at the Capital Blue Store cafe, saw the DermaScan in the lobby. She says she took a preliminary questionnaire because of her age.
“Has your doctor ever told you you had skin cancer?” she read. “No, not yet.”
Dougan says her past choices make her worried.
“Baby oil, and I’d use a sun lamp,” she said.
Dougan is a prime candidate for DermaScan, a machine that detects sun spots you’re unable to see in natural light. The Capital Blue Store has one available during all business hours. UV lights inside the machine penetrate through moisturizer, makeup, and even your top layer of skin.
Dougan looked inside and said, “There’s a spot I don’t think I’ve seen.”
Hilary McMahon is the health guide that helps people understand what each spot and color mean in terms of sun damage, skin dehydration, circulation, and more.
“If you see something coming up sooner, you can go to the doctor sooner to get that checked out,” McMahon said.
She says it’s not a replacement for the suggested annual trip to the dermatologist, but it’s a good first step.
“The face is very tender skin, so if this area is damaged, it’s likely there is damage in other areas,” she said.
According to the Skin Cancer Foundation, one in five people will get skin cancer in his or her lifetime.
As she’s leaving, Dougan voices exactly why the DermaScan exists.
“I think this is going to make me get home and call a dermatologist,” she said.
The DermaScan is available for free in the Capital Blue Store in Enola during all business hours, but employees suggest you make an appointment so that someone is there to guide you. Appointments can be made through capitalbluestore.com.
Get breaking news, weather and traffic on the go. Download our News App and our Weather App for your phone and tablet.
TOKYO, Oct 30 (Reuters) | 512 |
YouTubeCommons | part 7 chapter 2 of Anna Karenina by Leo Tolstoy translated by nathan haskell Doyle this LibriVox recording is in the public domain read by Maryanne Spiegel please don't forget to call it the Bowles said kitty as her husband came into her room about 11 o'clock in the morning before going out I know that you are going to dine at the club because Papa wrote to you but what are you going to do this morning I'm only going to cut of a sauce why are you going so early he promised to introduce me to metrof he's a famous scholar from Petersburg I want to talk over my book with him oh yes wasn't it his article you were praising well and after that possibly to the tribunal about that affair of my sisters aren't you going to the concert she asked no why should I go alone do go they're going to give those new pieces it will interest you I should certainly go well at all events I shall come home before dinner he said looking at his watch put on your best coat so as to go to the countess balls why is that really necessary Oh certainly the count himself came here now and what does it cost you you go you sit down you talk five minutes about the weather then you get up and go well you don't realise that I'm so out of practice that I feel abashed how absurd it is for a strange man to come to a house to sit down to stay a little while without any business to find himself in the way feel awkward and then go kitty laughed yes but didn't you used to make calls before you were married yes but I was always bashful said he and now I'm so out of the way of it that by heavens I would rather not have any dinner for two days than make this call I'm so bashful it seems to me is that they must take offense and say why do you come without business no they don't take offence I will answer that for you said Kitty looking brightly into his face she took his hand now crushed I please go he kissed his wife's hand and was about to go when she stopped him Kostya do you know I have only 50 rubles left well I will go and get some from the bank how much do you want said he with his well-known expression of vexation no wait she detained him by the arm let us talk about this a moment this troubles me I try not to buy anything unnecessary still the money runs away we must retrench somehow or other not at all said then with a little cough and looking askance upon her she knew this cough it was a sign of strong vexation not with her but with himself he was actually discontented not because much money was spent but because he was reminded of what he | 512 |
StackExchange | the page based on the number chosen:
prodName="doesn't matter, not directly $.ajax related"
function searchProduct() {
var prodName = $("#admin-search-product").val().trim();
var pagenumb = 1;
$(".page-item").click(function() {
pagenumb = $(this).children('.page-link').attr('value');
});
alert(pagenumb);
if (prodName == "") {
$.ajax({
type: "POST",
url: "admin_search_product.php",
data: {
search_prod: 0,
},
success: function(respond) {
$("#admin_content").html(respond).show();
$("#admin-search-product").focus().val('').val(prodName);
}
});
} else {
$.ajax({
type: "POST",
url: "admin_search_product.php",
data: {
search_prod: 1,
searchName: prodName,
pagenumb: pagenumb
},
success: function(respond) {
$("#admin_content").html(respond).show();
$("#admin-search-product").focus().val('').val(prodName);
}
});
}
}
<script src="https://cdnjs.cloudflare.com/ajax/libs/jquery/3.3.1/jquery.min.js"></script>
<input id="admin-search-product">
<div class="page-item">
<input class="page-link">
</div>
<button onclick="searchProduct()">clickme</button>
Everything works well, except the problem is that the pagenumb variable stays on "1" even though the code "pagenumb = $(this).children('.page-link').attr('value');" can retrieve the value of the page clicked, tested with alert() function and it can return the value of "2" if put within the click function.
However if I test the alert() function outside the click function, it shows that the pagenumb variable stayed the same. I don't know why it doesnt want to change the received value even though I'm able to receive it.
A:
You should bind the event handler once when the page is ready, not every time you searchProducts().
You want the change event, not click. pagenumb should be updated when the input's value changes. Click will only try to update the value when you focus the input box, which is not what you want.
prodName = "doesn't matter, not directly $.ajax related"
var pagenumb = 1;
// you should bind this event handler _once_ when the _page is ready_
// you want the change event, not click. update pagenumb whenever value _changes_
$(".page-item").change(function() {
// coerce to number using + operator
pagenumb = +$(this).children('.page-link').val();
});
function searchProduct() {
var prodName = $("#admin-search-product").val().trim();
alert(pagenumb);
if (prodName == "") {
$.ajax({
type: "POST",
url: "admin_search_product.php",
data: {
search_prod: 0,
},
success: function(respond) {
$("#admin_content").html(respond).show();
$("#admin-search-product").focus().val('').val(prodName);
}
});
} else {
$.ajax({
type: "POST",
url: "admin_search_product.php",
data: {
search_prod: 1,
searchName: prodName,
pagenumb: pagenumb
},
success: function(respond) {
$("#admin_content").html(respond).show();
$("#admin-search-product").focus().val('').val(prodName);
}
});
}
}
<script src="https://cdnjs.cloudflare.com/ajax/libs/jquery/3.3.1/jquery.min.js"></script>
<input id="admin-search-product">
<div class="page-item">
<input class="page-link">
</div>
<button onclick="searchProduct()">clickme</button>
Q:
How to fix 'tar: Failed to set default locale' error?
I'm trying to install a package into R, something I swore on my blood never to do, yet here I am.
The command supposedly goes:
install.packages('NCStats',,'http://www.rforge.net/')` while I am enjoying the healthy dose of:
Warning: dependencies 'nortest', 'plotrix', 'sciplot', 'car', 'gplots', 'gdata', 'Hmisc', 'TeachingDemos' are not available
trying URL 'http://www.rforge.net/bin/macosx/leopard/contrib/2.11/NCStats_0.1-4.tgz'
Content type 'application/x-gzip' length 237120 bytes (231 Kb)
opened URL
=================================================="
downloaded 231 Kb
tar: Failed to set default locale
The downloaded packages are in
/var/folders/Qj/Qjps7xnxFcWdSHsJY3lo+k+++TI/-Tmp-//RtmpzNO8MM/downloaded_packages`
Le-sigh. Anybody know how I can tell tar what locale I'm in, not that I understand why it needs that or why it can't just know it already?
I'm running OSX 10.6.4 and R 2.11.1 GUI 1.34 Leopard build 64-bit (5589).
A:
Step 1 (In R Console)
system('defaults write org.R-project.R force.LANG en_US.UTF-8')
Step 2: Restart R
Source: http://cran.r-project.org/bin/macosx/RMacOSX-FAQ.html#Internationalization-of-the-R_002eapp
A:
Use this command in the R console:
system("defaults write org.R-project.R force.LANG en_US.UTF-8")
Remember to quit and start again | 512 |
realnews | was irresponsible of the governor to link them to criminal activities in the state.Dickson said: "Lokpobiri is the one that armed and equipped Kareowei that has now killed soldiers and subjected innocent communities into this problem.
"He supplied all the guns, AK47, the boats and others he uses to kill and other arms and ammunition. I have evidence that on January 2, Kareowei and his gang of killers were in Ekeremor celebrating with the minister. The President should call them to order. But in a swift reaction, Lokpobiri said he had nothing to do with the arrested militant leader and challenged Dickson to prove his claims.
"I don't know this militant leader. I have never met him before and it is irresponsible for anybody to accuse someone like me, who has been preaching peace of buying arms for a criminal. It is unimaginable.Whatever Dickson has said came from his imagination," he said.
Responding to the allegations, Sylva's Media Aide, Doifie Buokoribo, said the governor was sick, adding that he had returned to his notorious game of accusing Sylva of sponsoring crimes in Bayelsa.
"This time he has joined the minister of state to his list of culprits. As always, Dickson has provided zero facts to support his irresponsibly frivolous claims that Sylva and the minister are providing cover for alleged cultists and other criminals. Dickson lied during his briefing in Yenagoa," he said.
Meanwhile, tension has continued to mount in Bomadi communities, Delta State following threats by some militants' leaders yesterday to breach the peace in the area.But the JTF said security had been beefed up to secure lives and property in Bomadi and its environs.
Sources, however, said that Kareowei's co-militants have threatened to kill more military officers in a manner to avenge the gun duel and in proportion to the injuries sustained by Kareowei.
It was learnt that one of the persons treating Kareowei had also been arrested and taken to Abuja for interrogation.A trader, Ebi Commissioner, who spoke to journalists, said he was forced to close business on seeing the increasing number of soldiers on the streets and major roads as early as 7am yesterday.He explained that vehicular and pedestrian movement were, however, restricted, while vehicles coming from Ughelli and Yenagoa were subjected to thorough search at the JTF check point in Bomadi.
Also, panic-stricken residents were forced to stay indoors for fear of being brutalised by the soldiers.But the Delta State Commissioner for Information, Patrick Ukah, assured the people of their safety, adding that efforts were on to ensure that peace prevails in the area.
It was gathered that a Nigerian Gas Company (NGC) pipeline belonging to the Nigerian Gas Processing and Transportation Company Limited (NGPTC) at Ejere Community in Warri South Local Council, exploded yesterday.
The explosion, it was learnt, may not be unconnected with renewed tension between the Ijaw and Itsekiri over the siting of the Maritime University of Nigeria in Okerenkoko.
Japan: If a weaker currency and a jumpy stock market equal success, then the Abe government's superstimulus is working like a charm. But that | 512 |
YouTubeCommons | a job candidate submit their resume without their last name it seems that they wanted to reduce any bias that might come with the use of their last name do you have any comments or advice advice on how to approach this name withheld St Louis so in the Arts world when you are trying out you try out behind when you're auditioning you uh for music I should say musicians you are put behind a curtain and you are escorted onto the stage on carpet so you cannot hear nor you can't hear a gate which means high heels or men's shoes so hopefully it erases gender and then you can't see what that person looks like you're only supposed to audition the sound and that is kind of that cultural world's approach to this I think this is fascinating and I would love to get your comments about this yeah you know this is the first time I'm encountering this uh but it's a very interesting uh representation of today's political and social climate yeah um I think that you can still approach and encourage the applicant to be fully themselves in the process and you know I would still take them for the value and experience that they provide um it might even be interesting if HR would screen applications on a blind basis just based on resume without names right and then pull those candidates forward so that this doesn't even have to be an issue in their policies of how they go about screening candidates um so I think that um this could be a nice Trend that is developed and people are interviewed based on their skills and expertise uh solely and then in the interview process sure additional information like their last name and things can be put into it but that's after the screening process um so I I think I'm a fan of it it's such an interesting thing because I when I first read this question my response was I live in the southwest and we don't have enough people in the nonprofit sector that speak Spanish and yet we need more people from all aspects of business actually but especially in the non-profit sector and so I was like oh my gosh I would be really interested interested if they had a Hispanic last name because I would think that pulls them up into that category that woohoo maybe we get a dual language person right so I had to shift my mindset and thinking about this and it's very interesting it's very interesting it seems to me like this person's had a negative um you know the applicant has had negative um situations you know that's LED them to this point I mean amazing well we're gonna have to see how this goes I I like your idea about if you have an HR contractor or HR department to go through and Screen those and then move that forward really interesting really really interesting okay you know what name withheld | 512 |
s2orc | [5] Parhusip A, Yasni S and Elisabeth Y 2003 Kajian metode ekstraksi andaliman (Zanthoxylum acanthopodium DC.) terhadap mikroba patogen dan perusak pangan [Study of andaliman extraction method (Zanthoxylum acanthopodium DC.) on pathogenic microbes and food destroyers] Jurnal Ilmu dan Teknologi Pangan 1 1 pp 112-23 [6] Tensiska, Wijaya C H and Andarwulan N 2003 Aktivitas antioksidan ekstrak buah andaliman (Zanthoxylum acanthopodium DC) dari beberapa sistem pangan dan kestabilan aktivitasnya
. 10.1088/1755-1315/260/1/012178IOP Conf. Series: Earth and Environmental Science. 26012178IOP PublishingIOP Conf. Series: Earth and Environmental Science 260 (2019) 012178 IOP Publishing doi:10.1088/1755-1315/260/1/012178
Antioxidant activity of andaliman fruit extract (Zanthoxylum acanthopodium DC) from several food systems and its activity stability against temperature and pH conditions. Jurnal Teknologi dan Industri Pangan XIV. 1terhadap kondisi suhu dan pH [Antioxidant activity of andaliman fruit extract (Zanthoxylum acanthopodium DC) from several food systems and its activity stability against temperature and pH conditions] Jurnal Teknologi dan Industri Pangan XIV 1 pp 29-39
Pengaruh ekstrak andaliman terhadap hidrofobisitas bakteri B. cereus, S. aureus, dan S. typhimurium. A Parhusip, 2Effect of andaliman extract on B. cereus, S. aureus, dan S. typhimurium bacterial hydrophobicity] Jurnal Ilmu dan Teknologi Pangan 2Parhusip A 2004 Pengaruh ekstrak andaliman terhadap hidrofobisitas bakteri B. cereus, S. aureus, dan S. typhimurium [Effect of andaliman extract on B. cereus, S. aureus, dan S. typhimurium bacterial hydrophobicity] Jurnal Ilmu dan Teknologi Pangan 2 2 pp 23-32
Singlet oxygen quenching effect of andaliman (Zanthoxylum acanthopodium DC.) Indonesian Food and Nutrition Progress 11. E Suryanto, H Sastrohamidjojo, Raharjo S , Tranggono , 2Suryanto E, Sastrohamidjojo H, Raharjo S and Tranggono 2004 Singlet oxygen quenching effect of andaliman (Zanthoxylum acanthopodium DC.) Indonesian Food and Nutrition Progress 11 2 pp 48-55
Pengaruh ekstrak andaliman (Zanthoxylum acanthopodium DC.) terhadap permeabilitas dan hidrofobisitas Bacillus cereus [Effect of andaliman extract (Zanthoxylum acanthopodium DC.) on permeability and hydrophobicity of Bacillus cereus. A J N Parhusip, B S L Jenie, W P Rahayu, Yasni S , Jurnal Teknologi dan Industri Pangan. 16Parhusip A J N, Jenie B S L, Rahayu W P, and Yasni S 2005 Pengaruh ekstrak andaliman (Zanthoxylum acanthopodium DC.) terhadap permeabilitas dan hidrofobisitas Bacillus cereus [Effect of andaliman extract (Zanthoxylum acanthopodium DC.) on permeability and hydrophobicity of Bacillus cereus] Jurnal Teknologi dan Industri Pangan 16 1 pp 24-30
Efek perlakuan ekstrak andaliman (Zanthoxyllum acanthopodium) pada tahap praimplantasi terhadap fertilitas dan perkembangan embrio mencit (Mus musculus) [Effect of the treatment of andaliman extract (Zanthoxylum acanthopodium) on the preimplantation stage on fertility and development of mice embryos. E Sabri, Jurnal Biologi Sumatera. 2Mus musculus)Sabri
Ensino da Odontologia Hospitalar no Sul do Brasil Ensino da Odontologia Hospitalar no Sul do Brasil
Recebido em 17/01/2017. Aprovado em 09/04/2017.
Bruno Bevenuto Lucas
Estudante do Programa de Pós-Graduação em Odontologia
Docente do Departamento de Medicina Oral e Odontologia Infantil
Estudante do Curso de Graduação em Odontologia
Universidade Estadual de Londrina *
Universidade Estadual de Londrina *
Universidade Estadual de Londrina
; José
Estudante do Programa de Pós-Graduação em Odontologia
Docente do Departamento de Medicina Oral e Odontologia Infantil
Estudante do Curso de Graduação em Odontologia
Universidade Estadual de Londrina *
Universidade Estadual | 512 |
Pile-CC | all platforms in use both internally and externally·Responsible for the usability of key web technologies in use and in development·Ensure proper compliance and testing of UIs·Analyse requirements and interpret into usable designs·Implement requirements and ensure scalability of UI components·Assist in the Back Office development when required
Required Skills:·Proficient in Java Programming, (mainly front-office)·Previous experience of developing complex user interfaces·Competent in mobile and slate technologies·Excellent interpersonal and decision making skills ·Ability to work on own initiative
This position will be based predominantly in the UK with International travel when required.
TERRAFORMING TERRA
We discuss and comment on the role agriculture will play in the containment of the CO2 problem and address protocols for terraforming the planet Earth.
A model farm template is imagined as the central methodology. A broad range of timely science news and other topics of interest are commented on.
Wednesday, August 17, 2011
Road Cult
What becomes rather clear to me
is that these national calculations are simply not to be trusted.Infrastructure always needs to be maintained
and pretty well it is on a local needs basis.After all anyone on the ground can determine which roads are heavily
used and need plenty of support and which are rarely used and need only the
minimum.What this approach does not do
is encourage the over building of capacity anywhere.That decision must be made at a higher level
in order to channel real growth.
That leaves us to discuss the
future.Two major changes are looming on
the horizon.
The most obvious is the advent of
electric transport generally.This will
have the effect of cutting the actual vehicle weight in half at least and
produce a commensurate decline in outright road wear.Coming with this will be driverless
cars.Thus while traffic will not
necessarily lessen except where high population density has allowed the
effective use of trains, the road wear will be much lower and automatic driving
may allow for some smarter engineering that lowers road costs.
Less obvious is the coming advent
of airships for long haul transport.Once the adjustment is made, airships sized to carry one, two, and four
containers at a time will easily take over the whole of long haul
trucking.Firstly the operating costs
are likely to be much lower once we have mass production of airships.There is no running gear to wear out or
excess mass to haul around at all that vaguely compares to that of a truck.Even better, movement is generally straight
line at a plausible seventy plus miles per hour even without clever engineering.The goods are also delivered unshaken which
seriously matters for plenty of cargos.
I cannot over estimate the
airship revolution made possible by modern materials.An airship can deliver directly from an
origination facility to a distribution facility by straight line travel half
way around the world at a speed of close to two thousand miles per day.In fact, on a west to east route flying with
prevailing winds, one could easily add an extra thousand lie each day.That means that California
produce could be a mere day away from New York
and two days | 512 |
Gutenberg (PG-19) | of assent among the listeners.
"The stars," said Tigranes, "are the thoughts of the Eternal. They are
numberless. But the thoughts of man can be counted, like the years
of his life. The wisdom of the Magi is the greatest of all wisdoms on
earth, because it knows its own ignorance. And that is the secret of
power. We keep men always looking and waiting for a new sunrise. But we
ourselves know that the darkness is equal to the light, and that the
conflict between them will never be ended."
"That does not satisfy me," answered Artaban, "for, if the waiting must
be endless, if there could be no fulfilment of it, then it would not be
wisdom to look and wait. We should become like those new teachers of the
Greeks, who say that there is no truth, and that the only wise men are
those who spend their lives in discovering and exposing the lies that
have been believed in the world. But the new sunrise will certainly dawn
in the appointed time. Do not our own books tell us that this will come
to pass, and that men will see the brightness of a great light?"
"That is true," said the voice of Abgarus; "every faithful disciple of
Zoroaster knows the prophecy of the Avesta and carries the word in his
heart. 'In that day Sosiosh the Victorious shall arise out of the number
of the prophets in the east country. Around him shall shine a mighty
brightness, and he shall make life everlasting, incorruptible, and
immortal, and the dead shall rise again.'"
"This is a dark saying," said Tigranes, "and it may be that we shall
never understand it. It is better to consider the things that are near
at hand, and to increase the influence of the Magi in their own country,
rather than to look for one who may be a stranger, and to whom we must
resign our power."
The others seemed to approve these words. There was a silent feeling of
agreement manifest among them; their looks responded with that
indefinable expression which always follows when a speaker has uttered
the thought that has been slumbering in the hearts of his listeners. But
Artaban turned to Abgarus with a glow on his face, and said:
"My father, I have kept this prophecy in the secret place of my soul.
Religion without a great hope would be like an altar without a living
fire. And now the flame has burned more brightly, and by the light of it
I have read other words which also have come from the fountain of Truth,
and speak yet more clearly of the rising of the Victorious One in his
brightness."
He drew from the breast of his tunic two small rolls of fine linen, with
writing upon them, and unfolded them carefully upon his knee.
"In the years that are lost in the past, long before our fathers came
into the land of Babylon, there were wise men in Chaldea, from whom the
first of the Magi | 512 |
reddit | was the only one involved in the "game" who was caught out so i think she was super pissed that the photo had been taken and annoyed that i'd snooped on her fb group... We are both looking to work through this tough time together, she's working hard on it and i am in the process of forgiving her for what she did.
OK, think I have your situation figured: single dad; girlfriend; rich family; just a portion coming to you now. So, do you have a relative that you truly admire? That really great uncle that seems to always be happy with his life, not trying to amass more fortune? Go to that person and ask for some references for financial help. Make that person your go-to. I do really like the tree analogy below. "You have a tree that will literally grow money, don't go cutting off its branches trying to make a second tree - that is greedy and stupid. This tree already gives you everything you could ever need and significantly more. Feel free to try planting its fruit if you don't want to eat all of it." Keep this tree in your family, teach them all to respect and care for it. Every time you think about cutting off a branch, think about all the fruit your children may never be able to get from that branch again." Good Luck!
There is that bit going on in Texas right now, but technically it wasn't the church I grew up in. Mine would be the time a youth pastor gave a sermon as the head pastor because the two main pastors decided to suddenly move away splitting the church. The awkward part was he gave an altar call at the end and nobody got up... So he guilt tripped the congregation about it until people got up and went up front.
I thought that your initial post was made about Twitch and wanted to make the conversation less one sided as it seemed like a lot of people agree to your negative view of your local streaming platform. I feel like Fortnite is a great (not perfect by any means) game when you don't take it too seriously. The gameplay is fun and fresh, the graphics are just fun to look at, the devs are amazing and all in all there's very few things I would change about it. But with its rise in popularity the community became more and more toxic as with most games, making the game less fun for me as someone who played the game since day one. But I do not in any way think that it contributed to the mentality you mentioned. It may have brought a younger audience to the streaming platforms, but the mentality within that group has always been there. When I was about 13 and Skyrim came out all I wanted to do was level up and bash monsters over the head as well.
When fucking an old girlfriend of mine, I pulled out and came on her chest. | 512 |
StackExchange | + "-" + (start.getMonth()+1) + "-" + start.getDate() + " " + start.getHours() + ":" + start.getMinutes() + ":" + start.getSeconds(),
end : end.getFullYear() + "-" (end.getMonth()+1) + "-" + end.getDate() + " " + end.getHours() + ":" + end.getMinutes() + ":" + end.getSeconds(),
allDay : allDay,
url : ''
},
function(answer) {
console.log(answer);
}
);
Q:
How to only capture the matching side of a disjunction?
The following code:
re.findall('(a).(b)|(c).(d)','axbcyd')
Captures two matches, both with two empty strings:
[('a', 'b', '', ''), ('', '', 'c', 'd')]
I'd like to instead return:
[('a', 'b'), ('c', 'd')]
Essentially, only capture on the side of the disjunction that actually matches. How can I do this? Happy with a totally different approach...
A:
Like Avinash Raj says; just remove the empty elements:
map(lambda x: tuple(filter(lambda y: y!='',x)),re.findall('(a).(b)|(c).(d)','axbcyd'))
(Edit: Less functional, more pythonic:
[tuple(y for y in x if y != '') for x in re.findall('(a).(b)|(c).(d)','axbcyd')]
)
Q:
mysql win loss records and joining three tables
I'm trying to join three tables together and it's gotten a little complicated. This is what I have. It was working fine before trying to select the team name. Also, if anyone knows how to calculate the wins and losses more effectively that would be helpful.
$sql = '
SELECT u.name,
t.name AS team,
SUM(
CASE WHEN (g.awayScore > g.homeScore AND g.away=u.team)
OR (g.homeScore > g.awayScore AND g.home=u.team)
THEN 1 ELSE 0 END
) AS wins,
SUM(
CASE WHEN (g.awayScore < g.homeScore AND g.away=u.team)
OR (g.homeScore < g.awayScore AND g.home=u.team)
THEN 1 ELSE 0 END) AS losses
FROM game AS g
JOIN user AS u ON g.away = u.team OR g.home = u.team
JOIN team AS t ON g.away=t.id OR g.home=t.id
GROUP BY u.name
';
A:
I think you want to join team to the user, not the game. I expect that user table has a team_id (or team) column which is a foreign key references team(id).
I think the only change needed in your query is one line. Just change this:
JOIN team AS t ON g.away=t.id OR g.home=t.id
to
JOIN team AS t ON t.id = u.team
That should be sufficient to fix the problem.
But I'd write the query a bit differently. Something like this:
SELECT u.name
, t.name AS team
, SUM(
CASE WHEN (g.awayScore > g.homeScore AND g.away=t.id)
OR (g.homeScore > g.awayScore AND g.home=t.id)
THEN 1 ELSE 0 END
) AS wins
, SUM(
CASE WHEN (g.awayScore < g.homeScore AND g.away=t.id)
OR (g.homeScore < g.awayScore AND g.home=t.id)
THEN 1 ELSE 0 END
) AS losses
FROM user u
JOIN team t ON t.id = u.team
JOIN game g ON g.away = t.id OR g.home = t.id
GROUP
BY u.name
, t.name
NOTES
I'd start with the user table, that's what we really want to return. (If we wanted to return zeros for users in teams that weren't in any game, then we'd be looking at doing an OUTER JOIN, and I just always write LEFT JOINS.)
Next, I'd get the team associated with each user.
Then, I'd join to the game. It's a bit tricky | 512 |
reddit | has gotten a but better this season, and I'm enjoying her in the mother role for the group.
There's a night in the town where I went to college where at one bar from 10 to midnight the special is quarter beers and then at another bar from midnight until 2 it's dollar double well drinks. The first time I went I totally forgot about an interview I had the next morning. I wake up the next morning to a text from my friend that set up the interview for me reminding me to go. I got dressed (forgetting to put on an undershirt), did my hair the best I could, and drove to the interview. During the interview I couldn't focus on anything because the room was spinning and I thought I was going to hurl. My phone alarm went off (the tone was one of those "Latin" style presets every phone comes with). I muted the alarm but didn't silence the phone and later received a text. At the time, my text tone was "Go Go Power Rangers". Finally, after having sweat through my shirt, the people interviewing me asked if I had any questions. I said, "Nope," and just walked out. **TL;DR I was drunk off my ass, sweating like crazy, and too stupid to silence my phone before an interview**
I use it to warn me when a patch is 80% depleted, so I know when to start looking for a new one. Once the new one is installed, I use it to warn me when the patch is fully depleted, so I know I can go clean up the installation.
Sure! I believe a fetus is a human because it has its own set of chromosomes, and has its own (human!) DNA. In terms of cellular DNA, it is just as different as a toddler's DNA and his mother's to a fetus's DNA and his mother's. It fulfills 6 out of 7 of the characteristics of life that biologists have defined, except for reproduction, which it would obviously do later in life. (Source: http://infohost.nmt.edu/~klathrop/7characterisitcs_of_life.htm) Feminists that say that it's their body irk me so much, and this is why: I have basic university-level biological knowledge, and I know very well that the cells in the fetus are NOT the same as the one in the mother. Half of it came from the biological father, and half from the mother. Also, sometimes women are pregnant with a boy! It just so happens that during the pregnancy, a penis grows. and some arguing would say that it's still their body. Does your body now have a penis too? I didn't think so; it's a separate body. So there you have it. Once I approached it from a purely scientific view, I was absolutely convinced that abortion is wrong. There is no way I could defend abortion by using science. Hope I helped.
I had one of the biggest urges last night. I opened a private tab, entered the web name. I was one click away from relapsing. Yet somehow, I had | 512 |
realnews | brought success to the club which it had never seen before, winning three Premiership titles in six years and a European Champions Cup last season. He talks incredibly and equally fondly of his time there and about what makes the club so special.
“It’s not one specific thing. During the first year I never experienced anything like it before. When Brendan Venter and Edward Griffiths took over, it wasn’t just a rugby club. It was more than that. It was very personal. They made the effort to know everybody personally, to look after their families and to bring the squad together as a group of friends. We talk a lot about this friendship thing, but when I went into work it felt like family. You will do more for someone you like and you actually care about. I think they got that right,” says the much-adored Namibian.
“It’s something you want to belong to; you want to be part of that group. It helps to have great players. They’ve signed some really good players in the past and they’ve got a really good squad, but I think the culture, the coaching aspect of it, the friendship and the family and the willingness to work just a little bit harder than everybody else is what makes this club pretty special.”
“Saracens have been on the right track for the last seven years; I think it’s been great. We haven’t won all the trophies but we’ve been there or thereabouts to challenge for them and we’ve been better every time. I think it’s very rewarding that a lot of the squad is still very young, the English internationals are all still very young, they’ve still got a lot to achieve. England are doing brilliantly and the players want to impress and they want to be part of that England set-up. The club will benefit from that.”
Although Burger has enjoyed a long and successful career, it has not come easy. Throughout his time he suffered over 60 injuries, some particularly serious. Despite the demands he placed on his body through his uncompromising way of playing, Burger was still able to keep coming back.
“The biggest test in your career is when you have serious injuries and you’re trying to bounce back. When I had my first serious injury I knew I wasn’t done and I wanted to play rugby again. I was fortunate enough that I could find a way back. It took me a while, but by the end of the year I was playing well again. For me, I found it incredibly hard to come back, as a couple of times I knew I wouldn’t be able to play for a long time when I had serious surgery, so they were really dark periods of my life. But you’ve got to fight; your character has got to stick through. You’ve got to keep working hard and that’s what I did.
“However, you need a club that is going to back you and believe in you. As soon as the CEO at Saracens | 512 |
reddit | 19. Homecoming 20. Mercy Honourable mention to Siiiiiiiiiilver Surffffer Intermission for being the greatest skit of all time.
And I also couldn't find the one RSD exclusive I was looking for that I'm pretty sure no one ordered. It was my first RSD experience after missing the past few years. I really didn't miss much by the looks of it. Just lots and lots of people everywhere, in the way. I ended up getting two bootlegs that I'm already regretting.
whats the best way to loose weight around back and belly ? now some back story about me and my journey in loosing weight : in the December of 2017 i noticed i had difficulties when i sit so i weighted myself and it was 90KG !! i jumped to nearest gym immediately and lost 18Kg but my manboobs + belly fat +back fat stay so when i stopped going to gym my fat back is but minus hard breathing lol, now after 9 months i'm back gym again loosing weight i'm thinking what's i need more help to loos those trio.
FP1 and FP3 are on LiveExtra streaming only while FP2 shows live on air with commentary on NBCSN. Qualifying will be broadcast live on NBCSN. The race will be broadcast live on NBCSN -- and includes 30 minutes of "countdown" style coverage preceding the event as well as 30 minutes of F1 Extra after the race ends. &nbsp; Note the dates for race weekend: * Thu = Thursday, April 14, 2016 * Fri = Friday, April 15, 2016 * Sat = Saturday, April 16, 2016 * Sun = Sunday, April 17, 2016 &nbsp; event | live channel | start time (EDT) | comment ---|---|---|--- FP1 | nbcsn.com | Thu 10:00 PM | 1.5 hours live coverage; no commentary; [NBCSN LiveExtra stream](http://stream.nbcsports.com/liveextra/) FP2 | NBCSN | Fri 02:00 AM | 1.5 hours live coverage; [NBCSN LiveExtra stream](http://stream.nbcsports.com/liveextra/) FP3 | nbcsn.com | Sat 12:00 AM | 1 hour live coverage; no commentary; [NBCSN LiveExtra stream](http://stream.nbcsports.com/liveextra/) qualifying | NBCSN | Sat 03:00 AM | 1.5 hours live coverage; [NBCSN LiveExtra stream](http://stream.nbcsports.com/liveextra/) race | NBCSN | Sun 02:00 AM | 2 hours live coverage; [NBCSN LiveExtra stream](http://stream.nbcsports.com/liveextra/) &nbsp; Other programming of note: program | channel | start time (EDT) ---|---|--- F1 Countdown | NBCSN | Sun 01:30 AM F1 Extra | NBCSN | Sun 04:00 AM
I know its unlikely, but this movie is just so great rewatch material. titanic pretty much had a low Opening weekend, but it stayed no.1 for 17 weeks or like that. And with the Huge opening that the Last Jedi will have if it stays at top for 7-8 weeks it'll match Titanic numbers.
The red dot almost covers just as much screen space as the reflex, but the bullet comes out somewhere near the center of it, not even in the center. I'd rather have an arrow resting below someone's head than covering someone head with the reticle and praying that it's on
I always enjoy finding out what musicians/bands are currently listening to, so what were some of your | 512 |
reddit | have barely used VR at all. I had a 2-3 min demo at Anime expo back in 2014 on a DK2 that is it...well also cardboard, but that pales to even the Dk2.
This generation of gamer arnt used to real testing environments. And thats due to companies slapping "pre-alpha" and "Closed Beta" on a complete game and upcharging people for early access. They'll think everything is broke/OP/sucks til live levels out the balance of the game post launch... then theyll be the "remember what it was like in alpha, god the game was so much better then." Expect Change, always.
I was banned from returning to their house, we dated for an additional year and a half, I tried mending things and I even wrote him an apology letter, not that it happened but that it happened in his home (they were doctors for christ sake) but we just grew apart after that and a few other incidents, her mom never found out about it for fear it would send her into a mental breakdown...shit was wack
I can see the 14th episode being included with the other 13. 14 is the right number to adapt the 13 chapters nicely since a couple of them are more than double the length of the others. Not to mention that the first episode apparently had anime original content in it
> FFXI. Ok so im reading publishers stating that MS rules didn't allow sharing of servers though no first party confirmation, it also doesn't seem to be specifically aimed at Sony more everyone and linked to techical/security concerns , though again this is hearsay. I'm also not seeing Sony actively being involved in the discussions. They seemed to be happy to sit back so not exactly analogous to the situation today
I'm posting this on the other bathroom plant, too. Do you own a bird? The seed I feed my bird sometimes ends up in weird places- it's like glitter. I often find small plants growing out of my sinks. I pluck them out and put them in a little pot next to the window.
Well if you look at their Wikipedia pages than yes but there's more to football than just stats about matches played and goals scored. Pulisic is a great player for his age, at 17 years old he shows great composure he is in most cases calm with the ball and he has a great understanding of the game and with that I mean he is a smart player he knows how to follow the flow of the game which is a bit hard for young players in their first matches at such high level like Bundesliga... But now let's go with Mor !!! When I saw Mor play with Turkey in Euros and later some YouTube highlights videos it is really easy for me to say that Mor is a player that gets you excited, he has a style of play that is really flashy I mean his rapid sprints and his dribbling feints are not just fun to watch but they | 512 |
ao3 | pink haired woman eventually succeeded in providing Fang with a location, time, and her cell phone number. Holding the scrap paper in her hands, Fang completely forgot that she was supposed to bring back beers for herself and Vanille. Thankfully the red head was easily excitable, and spent the rest of the night prying for information rather than complaining about Fang not bringing drinks back for fireworks.
The following day, Vanille insisted that Fang cover the now purple welt that covered her cheekbone and eye, but Fang refused. Something told her that the sheer power behind the punch was going to be a hell of a conversation piece. Vanille also insisted on tagging along; she wanted to see this pink warrior for herself. Fang also denied Vanille this, staying she was going alone but would tell her all about it when she returned. Practically having to tear Vanille off her arm, Fang eventually made it to the coffee shop written on the legal pad paper scrap. The smeared black ink against torn yellow paper that no one used already said so much about the woman, and Fang found herself growing more and more intrigued by the woman by the minute.
This interest doubled itself when Fang found that not only had Lightning showed up, but she was waiting for Fang. Once she stepped into the shop, Fang could spot the pink beauty without even trying. That same awkward, socially uncomfortable woman who had found a secluded table for two in the back corner of the shop. It was well lit by sun, being next to one of the shop windows, where the woman idly kept her gaze. Gently, Lightning lifted her gaze from the patrons outside and towards the door that chimed when Fang entered. Fang felt her face forming a smile, crooked and playful. People always said Fang had a captivating smile, but it was this woman's, the woman who planted her knuckles into her face, whose smile she was captivated by. It was soft and small, yet oh so genuine. The smallest change in woman's features that lifted her face and made her look like a completely different person.
I know you're there
**Author's Note:**
> This is my first Larry smut ever!!! So please be gentle and if you don't like it I'm sorry but if you do please let me know :) you can find me on Tumblr hazkawaii thanks! Enjoy :)
"Why don't you take a quick shower while I set things up? We can apply your makeup first then we dress you" he says. Harry is used with the routine by now, but Louis likes to keep things clear. With a quick nod, Harry is pulling his shirt over his head before he enters the bathroom shutting the door and leaving Louis with his eyes staring at the door previously opened with Harry's beautiful bare torso in sight.
Harry's body wasn't anything new to Louis, obviously. He was his personal stylist, Louis has seen Harry's naked body several times. Way more than the safe amount of | 512 |
realnews | the larger companies. But T-Mobile isn’t throwing in the towel, and has announced plans to significantly expand its 3G wireless network services. The company says 3G was up and running in 130 U.S. cities at the end of 2008, and the company plans to double the population of people covered by its 3G services by the end of 2009. That would mean adding 100 additional cities by the end of the year, and coverage for more than 200 million Americans.
T-Mobile also announced the availability of its new T-Mobile webConnect USB Laptop Stick, manufactured by Hauwei technologies, which combined 3G and Wi-Fi connectivity on T-Mobile’s networks along with up to 8 GB of portable storage. The webConnect Stick enables users to connect to 3G wireless mobile services where available, EDGE services where 3G isn’t available, along with over 10,000 Wi-Fi hotspots managed by T-Mobile. Users just pop the stick into an available USB port and use built-in Connection Manager software to find the best available Internet connection for their location. The onboard storage just saves users the hassle of having to carry around a separate USB drive: now users can take their documents, media, music and Internet connectivity with them in a single device.
The webConnect stick is available for $49.99 with a two-year contract after rebate; users can also spend $99.99 for a one-year contract or $249.99 for no contract at all. Service plans for the webConnect stick start at $59.99 a month, which includes 5 GB of wireless data transfer; additional bandwidth costs $0.20 per MB.
A few days after rampant criticism in blogs and other online sources about AT&T’s decision to reject Google’s voice app on the iPhone, the Federal Communications Commission has opened an investigation into the telco giant as well as Apple (NSDQ: AAPL). The reason for rejection offered by the two companies was that the Google (NSDQ: GOOG) app “duplicates features that come with the iPhone.” Update: A statement from AT&T (NYSE: T) came out this morning: “AT&T does not manage or approve applications for the App Store. We have received the letter and will, of course, respond to it.”
This comes as the FCC is already looking into two other related issues: wireless open access AND handset exclusivity, both of which also have effect the three companies involved in the ecosystem.
Advertisement
The FCC has sent a letter to all three companies involved; the letters to AT&T, Apple and Google are pasted below. Some very pointed questions to both AT&T and Apple, and even an inquiry into the approval process for Google’s Android platform.
Letter to AT&T:
“Federal Communications Commission DA 09-1737
July 31, 2009
James W. Cicconi
Senior Executive Vice President-External and Legislative Affairs
AT&T Services, Inc.
1120 20th Street, NW, Suite 1000
Washington, DC 20036
RE: Apple
Fox News and Maven Networks, an Internet-TV-platform company, are teaming up on a new broadband-video-distribution system for the news network.
Fox News will roll out Maven’s technology companywide: All video content on Fox News Web sites, including FOXNews.com and the Web site for the upcoming Fox | 512 |
gmane | Maps or Earth view.
See http://www.w3.org/2003/01/geo/
Egbert Gramsbergen
Hi,
from what I can understand from the datasheet of the RS232 chip used
with the RS232-cape (the SN65C3221EPW by TI) this chip can handle any
voltage between 3.3V and 12V for the logical levels. Thats nice! :)
But what happens with the other side of the line? If the opposite chip
accepts (for example) 3.3V only...how can the chip of the RS232 cape
can detect this?
Thank you very much for any help in advance!
Best regards,
mcc
Hi,
I use Ubuntu to build the arm linux kernel and rootfs.
Now I need to build my own application.
I am just wandering about how to use the cross-compiler and the meego
libraries.
Meego SDK for Intel is just fine, and I can build my own app, but as for
meego for arm, I don’t know the way.
Best Regards
Wang Qiang
I am installing alsa on a laptop that has an ESS Maestro/Allegra sond
system. But, there are several listed in the './configure --help' and
on the web it is stated that the N505 uses the ESS 1988 and es198X.sys
is reported under the Windows device manager.
There is no 1988 under the cards list. There are es968, es1688 and
es18xx. But no mention of a 1988 version. Plus, the alsa-project.org
card matrix is being redone and the ESS cards ain't made it yet.
Which do I configure for?
Jeff
In the last year as a Fink maintainer (Mac OS X debian-like package
manager), I've come across a couple CPAN modules that have no license
information at all. It's very frustrating. I've submitted RT bugs,
but one of them has been fixed (thanks Ken Williams).
To encourage authors to correct this oversight, I propose a new pair
of Kwalitee tests. Both would be nice, but if either of them were
implemented, I'd be thrilled. I'd prefer that someone else implement
the test (lack of tuits), but if there is approval for the idea
without a motivated implementer I will take a hack at it.
1) has_license -- check for the presence of a file named something
like LICENSE or COPYING or COPYLEFT or GPL or ... (each test case
insensitive, with or without .txt extensions). Alternatively, the
test can be more liberal by looking for the string "copyright" in
README, *pm and *.pod.
2) has_meta_yml_license -- check for a META.yml field named
"license". Module::Build supports this.
These tests should not care which license is claimed, just that there
is a license present.
Chris
Hi,
I've got a system which only provides POSIX-style timezone information
through /etc/TZ and the TZ environment variable. Unfortunately,
Asterisk doesn't seem to care about the timezone and defaults to GMT.
Looking at main/stdtime/localtime.c, Asterisk seems to be able to
handle POSIX-style timezones, but I always end up with the string
"/etc/localtime" being parsed for timezone information. Is the code
(i.e. tzparse() ) supposed to work? If it does, how to I get Asterisk
to honor my POSIX-style timezone information?
Best regards,
Henning Holtschneider
Hi
I'm migrating some code to | 512 |
OpenSubtitles | go on the trip." "Yay." "Because, you guys, I have a real treat planned for us." "We are going to Tempe, Arizona to the Wimmin's Music Festival." "Please tell me Tracy Chapman is performing." "She and her "Fast Car" will be there." "Oh, my goddess." "[GAYLE LAUGHS]" "Gayle, what's wrong?" " You love women-centered folk music." " I do." "I know." "I just..." "I wish we could go somewhere more fun, you know." "So, like, we could be more fun." "We're fun." "Tell me that our yearly Americana road trip isn't fun." " Yeah, or at-home karaoke Fridays." " Yeah." "Or the Movie Numbers Game." "Hon, you love the Movie Numbers Game." " I do love that game." "JUDI:" "You go first." " Name a movie, one to 10, go." "" " One Crazy Summer." "" " Two of a Kind." "" " Three to Tango." "" " Four Weddings and a Funeral." "" " Five Easy Pieces." "" " Six Days and Seven Nights." " Ooh." "A double." "- 8 Mile." "" " The erotic Nine and a Half Weeks." "And 10." "We did it." "[ALL LAUGHING]" " See?" "We're pretty fun." " Yeah, we are." "Again, Vice President Lawrence Kenner /has resigned." "The disgraced politician remains /in an undisclosed location... /... a day after he was caught in /a motel room with two underage girls." "" " He said he loved me." "" " You liar!" "MAN [ON TV]:" "The presi..." "Whoo-hoo-hoo!" "I love me's a scandal." "Well, the president will be making his selection at the end of the week." "And guess who's at the top of his list." "That's right, Mama." "Mama's at the top of that list." "They're gonna want someone squeaky clean." " They'll comb through every part of your life." " I'm spotless." "I already deported the maid, and my husband's impotent." "What about your daughter, Ashley?" "But we were Lancelot and Guinevere of the medieval feast last year." "[SINGING]" "Not now, Trevor." "Ashley, we want different things." "Since I got my braces off and that mole removed I realized it's time for me to move on." " None of the medieval freaks even work out." "WOMAN 1:" "Hey, Doug." "Stop talking to that fugly face and get over here." "WOMAN 2:" "Support our spring break." " Buy a cookie." "All proceeds will support binge drinking, promiscuity and public nudity." "WOMAN 2:" "South Padre." "[SCREAMING]" "It's senior spring, Ash." "They're trying to be your friend because your dad owns Six Flags." "Maybe so, but they're fun." " And I wanna be with a girl who parties." " I can be that girl." "I can." "I could be a right, fine saucy wench." " I can be saucy." " Ashley." "You'll never be that girl." "Hey, Mason, wait up." " What's so great about them?" " Forget Doug, Ashley." "Let him and those frat gorillas go on their stupid spring break." "I hate his fake face." "[PHONE CHIMES]" "One second." " Hey, Mama." " Hey, baby." "What's up with my little rock star?" "I think someone's | 512 |
ao3 | adores you. Quinn basically hates everyone. As I've gotten to know you even if it only has been over the last few weeks, I do know I want to get to know you better. I know it all sounds so…"
Brittany was cut off when Santana put her hand over her mouth, "It doesn't sound crazy or weird. Maybe seems a little too good to be true," The brunette took her hand away from Brittany's mouth and rubbed her cheek softly. "I want to get to know you better too. I'd love it if you spent tomorrow with Mami, Abuela and me."
Brittany leaned forward and kissed Santana on the cheek gently, "I think we are going to get along just fine, Ms. Lopez." The brunette opened the microwave and pulled the bag out, "I suppose we should go back out there with this and talk to your parents some more."
"I'm pretty sure they are all three asleep by now," Santana grabbed a bowl down from the cupboard and poured the popcorn in it. "I'll be right back." Santana was right parents and grandmother were asleep. She grabbed a quilt off the couch and made her way back into the kitchen. "Let's go sit on the porch swing and hear embarrassing stories about you since you got some freebies today."
Brittany grabbed Santana's hand and followed her through the front door, "Best Thanksgiving ever."
2. Christmas Part 1
**Summary for the Chapter:**
A few days later, when the whole situation had mostly been forgotten, John was just returning home after he work at the doctor’s office for the day. Around noon he had been tasked with treating a particularly interesting patient with some sort of parasite living in his stomach, and had immediately thought of Sherlock and his current fascination with tape worms. Naturally, he wanted to tell Sherlock what he’d missed out on, and entered the flat expecting some sort of mess to have been made or to see his flatmate deep in concentration over an experiment. What he found in actuality was an empty apartment and a note sitting, lonely, on the cluttered kitchen table. He almost didn’t notice it, but being that it was sitting directly next to what John suspected was a jar of eyeballs that hadn’t been there in the morning, it attracted his attention. John’s eyes narrowed as he picked up the note and brought it closer to his eyes. The hastily scrawled, loopy handwriting read:
“John. Call Lestrade. Golem in the house. Don’t know where he’ll take me.”
After reading it twice to ensure that he had read it properly, he yelled, “SHERLOCK!” and frantically crumpled the note up, throwing it away from him. No. Sherlock did not get himself kidnapped. He was too skilled a fighter, would’ve hidden or found a gun at the last minute. He had had enough time to write the note, at any rate. So there was no way he would have been kidnapped. Was there?
“SHERLOCK, STOP THIS RIGHT NOW! If you’re hiding somewhere, I swear to God...” | 512 |
ao3 | at all. Almost.
“The boss wants to see you.” It did the trick. Every time. As much as he would try to deny it, he still idolized Tony Stark too much to turn down his request.
So, there he was, leaning tiredly against the car door and fighting against whatever was making him so sick. Happy tried asking him how he was feeling, but Peter was already out by then, his exhaustion winning over the excitement that had kept him awake from the front door to the car.
It didn’t take too long to reach the Avengers base and Peter woke up when Happy opened the door and he slumped down to the man’s arms. Just, when he finally got a grip on himself to feel his spine again and pull himself up, it wasn’t Happy Peter saw there. It was Tony Stark himself.
He almost chocked when he tried to draw a breath. “M-Mister Stark!” he squeaked and tried to pull himself together, straightening himself so quickly that his head spun. He tried to blink and breathe away the dark that gathered at the edges of his vision and he noticed that there was a hand on his shoulders.
“Just take it easy there, kid,” Tony told Peter as he swayed in his seat. He pushed Peter back in his seat so he could release him from the seatbelt, holding onto Peter’s arm as he ushered him out of the car next.
Peter’s eyes were wide with excitement but has a glassy shine to them. It came to him as no surprise then when Peter’s legs gave up after taking two steps and so he had to hold him up. Be it a teen or not, his limp body was annoyingly difficult to support and so Tony just heaved Peter up into his arms, complementing his suitless strength in his head. He had to carry him only less than ten steps when a medical team already ran to them with a stretcher where he could put Peter down.
Peter groaned and hid his face with his arm. Tony worried that Peter was in pain before the teen grumbled, “You carried me… again.” Embarrassment then. He could live with that. Tony just tapped his shoulder and let him be wheeled off.
“Just get better, kid,” he told and watched Peter’s arm fall to his side. “Keep me updated,” he then told Happy and left to work on some new tech he was developing. It would help keep himself occupied when he knew there was little he could do.
After an hour and thirteen minutes he gave up. There had been no updates from Happy, which he did _not_ approve of – like seriously, did he need to specify that this was something he wanted at least hourly updates on? – so he decided to go check on the kid himself.
The halls felt too long suddenly, and the elevator ride didn’t go fast enough. He had time to think of the worst-case scenarios and before he reached the medical bay, he was | 512 |
gmane |
Alexander Shapiro
Hello all!
Have decided to do the following, any comments appreciated (reply
off-list if you like):
1. Use the "Erase and Install" option. Leave Journalling ON (as I was
told by someone at Emagic that Journaling does not significantly effect
HD performance at all, plus it protects the file system better). Once
in Panther 10.3, upgrade immediately to 10.3.1 > 10.3.2
2. Install the Logic 6.1 (200 MB) file that I have from the Apple Pro
Series Book/CD set (Just found it!!! as I don't have my original Logic
CD with me while I am traveling).
3. Immediately install the 6.3.3 update from www.emagic.de (which is
only about 35 MB).
4. Then install the latest 1.2 XSKey driver (from www.emagic.de).
5. Insert my XSKey for the first time on Panther, and boot Logic 6.3.3!
Any problems foreseen???? Please comment.
Chris M.
Hi.
I have my setup working, and I can convert PDF files to gif and jpeg, on my
windows machine.
That's nice, so I am trying to outface the use of Adobe Photoshop for batch
conversion.
However, Photoshop has a feature, that sets the compression of jpeg files,
depending on the requested filesize. Can ImageMagick do something similar?
Here is my command-line so far
convert inputfile -colorspace RGB -density 96 -thumbnail "240x500>"
outputfile
/Thomas
http://english.farsnews.com/newstext.php?nn=8606300370
Fars News Agency September 25, 2007
Iranian University Chancellors Ask Bollinger 10 Questions
TEHRAN - Seven chancellors and presidents of Iranian universities and
research centers, in a letter addressed to their counterpart in the US
Colombia University, denounced Lee Bollinger's insulting words against the
Iranian nation and president and invited him to provide responses for 10
questions of the Iranian academicians and intellectuals.
The following is the full text of the letter.
Mr. Lee Bollinger
Columbia University President
Hi,
Anyone know if there's a way to get the 'currentrow' within a cfoutput grouping? In other words, if I have 5 groups I'm cfoutputting, I want to be able to access the row # within each group. I know I can do this by setting a counter and incrementing within the 'inside' <cfoutput> tag, and then resetting it to 1 before that every time, but I'm wondering if there is a cleaner way of doing this. And just to be clear, query.currentrow does not give me that, it gives me the row number in relation to the entire query, not the group.
Thanks,
Dave
Still can't decide if I want to remember to planner, or remember to
blosxom. So, can I do both? I've been trying to get
remember-handler-functions to "invoke" (is that the correct term)
both remember-planner-append and remember-blosxom. Can that
be done? And, errm, a rune of relevant lisp would be welcome :-).
So far I've tried (and failed with) everything from a plain:
(setq remember-handler-functions '(remember-blosxom
remember-planner-append))
to the creation of my own function that invokes both
remember functions and putting *that* into the handler.
tc
I am trying to get a webpage in the Chrome browser to save automatically. I modified the javascript to add a button with "document.execCommand('SaveAs', false, 'test.html')", but it | 512 |
gmane | way to put delay between HTTP requests.
In bean shell sampler pre processor I had used "Thread.sleep(millis) " , what I observed was if I run using one user and after coming of the response it sleeps for the specified time and then sends.
Is there anything where we can send requests exactly at the specified time without considering the response time of the previous requests.
For example : I submitted a HTTP request with one user at 1:00:00 PM and the response came at 1:00:50 PM , now my thread will sleep (let say delay of 60 seconds) and fire another http request at 1:01:50 Pm but my requirement is to fire the request at exactly 1:01:00 PM rather than considering the 50 seconds of response time.
Is there any way of achieving this?
Also please let me know if in JMeter its possible to submit requests asynchronously?
Regards,
Soumya
Hi,
I left my trusty 2000-converted-to-2100 on an airplane a couple of
years ago. Since then I have tried using a Filofax to stay
organized, but it hasn't been as smooth as the Newton was.
I had an MP130 before my 2100 (circa 2007-2009), and I liked the form
factor and the ease of using AA batteries and the built-in serial
port. I no longer have that one, as I gave it back to my former boss
who had originally given it to me.
I'm wondering if it would be worth getting an MP130 again. Was there
ever a Y201x fix for MP130 and OS 2.0 (pardon me if I'm not
remembering facts correctly)? If so, was it of the sort that power
loss would lose the fix or make alarms & calendars icky? Or could an
MP130 still be a trusty tool today?
I was given a Newton Technologies MP2100 by a former coworker. It is
only usable while connected to power, because I do not have a battery
tray. I also don't have a serial dongle. (Of course, I had both of
those things for my old Newton I left on the airplane). If an MP130
would be usable these days for calendaring and notes, I wonder if
someone would be willing to trade...?
Thanks,
Tim
The patch
ASoC: fsi: constify dev_pm_ops structure
has been applied to the asoc tree at
git://git.kernel.org/pub/scm/linux/kernel/git/broonie/sound.git
All being well this means that it will be integrated into the linux-next
tree (usually sometime in the next 24 hours) and sent to Linus during
the next merge window (or sooner if it is a bug fix), however if
problems are discovered then the patch may be dropped or reverted.
You may get further e-mails resulting from automated or manual testing
and review of the tree, please engage with people reporting problems and
send followup patches addressing any issues that are reported if needed.
If any updates are required or you are submitting further changes they
should be sent as incremental updates against current git, existing
patches will not be replaced.
Please add any relevant lists and maintainers to the CCs when replying
to this mail. | 512 |
reddit | hope to? What about the alternative of shatter/budder? What about those nifty little pens with replaceable THC cartridges? Thanks in advance for any advice, Frients!
First of, I am sorry to hear about your mum. I think you grew up even before her passing as it compelled you to make the changes you mentioned. Speaking from personal experience, I know that your younger brothers are going to be grateful that they have a sister who is loving, responsible, dependable and mature. I don't know how close your relationship was before with them but it will only strengthen and deepen for now on. If you are ever having a bad day and just need to offload about anything, then please don't hesitate to PM me.
why is it that if I say my favorite color for underwear no-one will try to convince me their choice is best. But the moment someone mentions his/her editor of choice the crusades begin! I mean, not even the most religious people are so eager to convert you. mmm, I don't even know my point. Why do I feel the need to post this?
The reason, and I don't like the reason but this is the reason, is that federal dollars comes with strings attached (this is called "fiscal federalism" when it applies to the states, and since it's the state's university, this is all aboveboard), and one of those strings is that the university can't promote the use of illegal drugs, and turning a blind eye to 4/20 was getting dangerously close to promotion, and somebody probably threatened the board of commissioners with losing millions of dollars and having to raise tuition or slash benefits. They dress it up with "it disrupts the work of our world class university!" and so much bullshit, but money is the real reason, as it usually is. this is also why they banned smoking on campus - it gives them the authority to cite people who are smoking weed. They can't have them arrested, but they need to look like they're not simply allowing it.
I think this spells her doom, I don't think her or Jaime will survive. I think Brienne won't be able to kill Jaime, not because of physical ability, but because of her sense of honor while Jaime will either: 1. Kill Brienne to save his skin or 2. Also spare Brienne, in which case I think they will both die. That's just my theory though
While one might not be winning any DH races with it, it's definitely useful. This was intended as a casual commuting board that I can take with me around the city and still have it be portable. This is the first time I've made something like this so I'm not sure how robust the screws are, but everything about longboarding is inherently dangerous. If you're doing anything over 35mph you should be prepared for those situations regardless of what board you're using.
As I've pointed out to others, [Texas citizens enjoy the fourth-lowest tax burden amongst all states.](http://247wallst.com/special-report/2014/04/02/states-with-the-highest-and-lowest-taxes/5/) That means they keep more of | 512 |
StackExchange | \setminus N'$$
$S_{i} \cap S_{j}=\emptyset $ when $i \not =j$, and
$$S:= \bigcup _{k \in N'} S_k$$
Then, is the following true?
$$|S|=\sum_{k \in N'}|S_k|$$
I was thinking that it was because the intersection of any $S_i$ and $S_j$ is empty for $i \not =j$, but I am not sure how to prove it.
(Sorry if my notation is confusing\wrong, I am fairly new to set theory.)
Edit: Translating it into words:
If $S$ is a finite, non-empty set, partitioned into $n$ strict subsets, such that the intersection of any two of these subsets is $\emptyset$, is the cardinality of $S$ just the sum of the cardinalities of the subsets?
A:
Yes, it is true. You should know, and it sounds like you do, that the union of two disjoint subsets has size the sum of the sizes of the subsets. For three subsets, just add two of them to make one set, then add in the third. Proceed by induction of the number of subsets. Many properties are like this, if you prove it for a pair you have proven it for all finite collections.
Q:
Archive Trouble
Inspired by The Vowel Eater. Thanks, @JonMark Perry!
A vowel,-space,-and-punctuation-eating monster and a paper-ripping monster have broken into the Federal Archives of the United States! (oh no!)
You find this fragment of an important historical document:
...dndschcnvyncsbcknwldgdrthxctnthrfdlyprvdndbrcrddwthnnyrftrprprmgstrtscrtsndrgstrsshllbppntdfrthtprpsndprsnlprprtymybtrnsfrrdbydlvrysvnghwvrtthFrnchndCndnnhbtntsndthrsttlrsfthKsksksStVncntsndthnghbrngvllgswhhvhrtfrprfssdthmslvsctznsfVrgnthrlwsndcstmsnwnfrcmngthmrltvtthdscntndcnvyncfprprty
BtrdndbyththrtyfrsdThtthrshllbppntdfrmtmttmbyCngrssgvrnrwhscmmssnshllcntnnfrcfrthtrmfthryrsnlsssnrrvkdbyCngrsshshllrsdnthdstrctndhvfrhldsttthrnn1000crsflndwhlnthxrcsfhsffc..
Thrshllbppntdfrmtmttm
What is this important historical document? Quick, you have to find out so the Archives can sort their stuff again!
A:
This is
the so-called Northwest Ordinance of 1787.
It says, in part:
[...] and such conveyances be acknowledged, or the execution thereof duly proved, and be recorded within one year after proper magistrates, courts, and registers shall be appointed for that purpose; and personal property may be transferred by delivery; saving, however to the French and Canadian inhabitants, and other settlers of the Kaskaskies, St. Vincents and the neighboring villages who have heretofore professed themselves citizens of Virginia, their laws and customs now in force among them, relative to the descent and conveyance, of property.
Be it ordained by the authority aforesaid, That there shall be appointed from time to time by Congress, a governor, whose commission shall continue in force for the term of three years, unless sooner revoked by Congress; he shall reside in the district, and have a freehold estate therein in 1,000 acres of land, while in the exercise of his office.
There shall be appointed from time to time by Congress, a secretary, [...]
Q:
Disable Hyper-Threading on Dell XPS L502x
Does anyone know how, or if it's even possible, to disable Hyper-Threading on an Dell XPS L502x?
I've checked the BIOS, which seems like it's hiding a lot of the usual options, but can't see anything.
I've tried disabling Intel SpeedStep, which did nothing.
Thanks
Kieron
A:
You can do that via a mod-ed BIOS, see this thread.
Q:
BigQuery Table Decorators with Standard SQL
I'm having some trouble using table decorators using Standard SQL. However, the same concept with Legacy SQL syntax works for me. Is | 512 |
s2orc | [12][13][14] The possible implications of this shift were neatly summarized in a recent editorial in the British Dental Journal: "If talking about tobacco and alcohol habits have seemed like difficult subjects to raise, then talking about oral sex may present a further challenge." 15 Evidence from the cervical cancer literature suggests that general practitioners and practice nurses often lack knowledge of HPV and find the topic sensitive, awkward, and difficult to explain in a way patients can understand. 16 From the patient's perspective, an HPV diagnosis has the potential to cause feelings of stigma and shame in addition to the anxiety and health concerns usually associated with abnormal cervical screening results. 17 In the absence of any formal recommendations for discussing HPV test results with patients with oropharyngeal SCC, a recent review 18 suggested that the cervical cancer literature could be used to provide a starting point.
The experiences of patients with HPV-positive oropharyngeal SCC have begun to be explored; a qualitative study with male HPV-positive oropharyngeal SCC survivors in New York found that some participants were concerned about infecting a partner with HPV and some had discontinued oral sex or deep kissing even with long-term partners. Physicians were the primary source of information for all participants who wanted to know about HPV. 19 In a small study exploring the information needs of patients with HPV-positive oropharyngeal SCC in Texas, 20 around half reported that their oncologist did not discuss issues related to HPV with them. Many of these patients sought information about HPV and cancer elsewhere.
It has been argued that health professionals have an ethical obligation to ensure accuracy and transparency when disclosing HPV as the cause of a patient's cancer, 21 but, as yet, there have been no studies exploring this among health professionals themselves. We therefore carried out an exploratory qualitative interview study with clinicians treating patients with HPV-positive oropharyngeal SCC to explore their experiences and the perceived challenges of talking to patients about HPV in this context. The purpose of the study was to map a broad range of experiences and views from professionals working with this patient group, and seek explanations for differences in experiences, in the hope that this work would inform future quantitative studies.
MATERIAL AND METHODS
Sample
Participants were health professionals caring for patients with HPV-positive oropharyngeal SCC. We used purposive sampling to recruit participants from different disciplines in order to explore a range of perspectives. Participants were recruited via email from 8 researchactive hospitals in England and Wales (see Table 1) where HPV is discussed with patients. Potential participants were initially identified through existing contacts (2 surgeons and 2 oncologists) and we subsequently used snowballing. The first author also attended multidisciplinary team meetings at 2 hospitals in London to introduce the study and recruit participants. Initially, we aimed to purposively recruit 10 participants to include oncologists, surgeons, and nurses as they have the most contact with patients with HPV-positive oropharyngeal SCC. As the study progressed, we included some additional professional groups also key to the care of patients with HPVpositive oropharyngeal SCC, | 512 |
Pile-CC | equally amazed that my ID and PC docs apparently don't know either.
My new ACA plan starts in January (still Anthem) so I will be calling them and citing the statute.
Saga continues. 2 hours yesterday on the phone and 2 hours today. Still not resolved.
Are these people real?
Funny (NOT) that the woman that I spoke with from Anthem didn't know the Connecticut law either regarding the fact that they cannot require me to use a mail order pharmacy. She had to file an appeal. What? I gave her the state statute and said that the state insurance commissioner would be happy to follow through after a complaint was filed. She wrote the statute # down in the "appeal".
I think Accredo has a printed list of excuses and blame for every occasion. No doubt the insurance companies do as well.
BTW- I spoke to the local CVS pharmacist today about the law. I said that I'd much rather just get my meds through you. (I know they have their own mail order business as well but was talkin' local retail pharmacy here) She didn't even know the law. One would think that a $30,000 loss in business from ONE person alone would want them to keep a customer. The whole thing just blows my mind.
When I changed meds in March I got the first months supply through them. When it came time to refill CVS said that Anthem would not cover it because they required me to go though the mail order pharmacy. WTF? Against state law!
I'm glad to have discovered this on my own but wouldn't you think they would want their piece of the pie?
I'm coming into this conversation late but is there a small independent pharmacy near you where the pharmacist is also the owner? When I lived in Philadelphia my local pharmacies had the laws and they would also deliver for no fee. They were glad to get my $3000 a month in business.
The employees at CVS and Walgreens are just that employes. Their job is to fill as many prescriptions as fast as they can.
I'm coming into this conversation late but is there a small independent pharmacy near you where the pharmacist is also the owner? When I lived in Philadelphia my local pharmacies had the laws and they would also deliver for no fee. They were glad to get my $3000 a month in business.
The employees at CVS and Walgreens are just that employes. Their job is to fill as many prescriptions as fast as they can.
Yes there is but on the rare occasion that I have used them they seem slow and out of touch.
I know they are "just clerks" at CVS/Walgreens. As a business owner I would be appalled if an employee of mine kissed a $30,000. customer goodbye in this fashion. Just sayin'.
Quite frankly I am a bit
So much has been happening lately which I haven't really caught on to. Zhuyo's mom, you must have felt gutted. I feel for | 512 |
realnews | “Whatever that has been done by the department in the past…Like in last five years they have reached conclusion for regional plan (RP) on Pernem, Canacona and Sattari, now all that work will not go waste. “We will certainly consider all the work that has been put in. But the new RP 2030 will have to be based on a new policy,” he said.
Tightening the noose around the illegal conversions in absence of RP, Sardesai said “there is a section in town planning act which makes it mandatory for plots before being registered with the sub registrar to have NOC from the town and country planning department.” “This practice was stopped by the then government because they thought this was being misused by Planning and Development Authorities (PDA) and town and country planning department. I think we will have to restart this process,” he said. “When you come to register the plot you should have no objection certificate from PDA or Town and Country Planning department. Otherwise illegal development will continue,” Sardesai added.
LOS ANGELES (AP) — Roger Ebert could be tough on filmmakers, but unlike many critics, he earned their respect.
So much so that they claimed him as one of their own when the Directors Guild of America made Ebert an honorary lifetime member at the group’s awards ceremony four years ago.
What better testimony for a life’s work in a profession that typically draws sneers from filmmakers and fans alike? But then Ebert, who died Thursday at age 70, was not just any critic. He was THE critic.
At the Chicago Sun-Times since 1967 and through decades as a pioneering film reviewer on television, Ebert championed tiny gems that he scouted out at film festivals and took Hollywood’s biggest names to task when they missed the mark.
Ebert drew his own criticism that the thumbs-up, thumbs-down trademark of his TV shows over-simplified the way we look at films. Yet with his chubby frame and thick-rimmed glasses, he popularized the notion of the dweebish critic as arbiter of cultural taste, inspiring a generation of TV and online reviewers much as Woodward and Bernstein inspired a generation of investigative journalists.
Just as inspirational was how Ebert continued the work he loved through repeated ailments. He lost parts of his jaw and the ability to speak after cancer surgeries in 2006, yet he came back to writing fulltime and eventually returned to television.
And that famous thumb barely scratched the surface of Ebert’s work as a critic, student and just plain lover of film.
“Roger loved movies. They were his life. His reviews went far deeper than simply thumbs up or thumbs down,” said Steven Spielberg, one of the filmmakers who honored Ebert at the Directors Guild ceremony. “He wrote with passion through a real knowledge of film and film history, and in doing so, helped many movies find their audiences.”
Ebert died at the Rehabilitation Institute of Chicago, two days after announcing on his blog that he was undergoing radiation treatment for a recurrence of cancer.
“I’ve lost the love | 512 |
reddit | positive winrate and attitude.
>The Church is *led* into all Truth. Yes, but how does one objectively discern whether the an Eastern Orthodox Church or an Oriental Orthodox Church is being led into all Truth? It seems the Council of Chalcedon decided that, but how do we know whether the council was one that was leading the Church (ecumenical) or causing it to stray (robber)? If we cannot know, what is the point of a council? Also, leadership is authoritative. Just because the Church is led does not mean there is no guarantee of truth. In fact, it would mean the opposite. >Despair is never the right answer. I do not understand the answer. Yes or no, is your soul endangered?
I think the power supply is just crap, voltages drop too much and system reboots. Buy something better like EVGA G2 650W or EVGA GS 650W. That's how I solved that exactly same issue anyway, it was a shitty power supply I should have never used and after some time it started rebooting the system as it was dying from having to do something. >If the PSU is to blame (550w not being enough), why did it work up till now? For about a year this PSU was sufficient enough to run the game, I have not changed any hardware in past half year. That's how it was for me. It worked for a year or so, but then died (showing symptoms like yours) and the replacement died too. I then went with something higher quality and now my system has worked fine for 4 years. For power supply buyers I recommend you always check with Jonnyguru.com http://www.jonnyguru.com/modules.php?name=NDReviews&op=Story&reid=429 can't go wrong with something like this.
could you have a "slumber party" with the same sex? or how about gay members or the opposite sex? how about an irrational adult in a relationship they dont value .....then is it ok ?? or how about if said rational adult in a relationship they value just hangsout 3-4 times a week with a friend until say 3am ....2am...1am...midnite .....when would you like them home? .......now i would def be bummed if my girl was hanging out 3-4 times a week with anyone other than me! after all isnt that kind of the point of being in a relationship ......but i wouldnt care if she stayed the night at a friends house guy or girl and i know she wouldnt care if i did the same .
Do you HAVE a Model X? If so, go to a Babies'R'Us and try things out. They let you do that. If you don't, arrange a test drive scenario, where you drive to a Babies'R'Us and try things out. I would imagine most things would fit. It's got loads of legroom back there, so a seat should have room.
Sorry to take a contrary view but most oil change places offer to replace the air filter for around $15 - so unless you drive an unusual car...or do your own oil changes... you SHOULD pay someone to change it. The real | 512 |
reddit | Johnson is against TPP? That's cute! >while Johnson sounded critical of the Trans-Pacific Partnership in an earlier Politico interview, in this later one he appeared to support it. “It is my understanding that the TPP does advance free trade,” he said. “Is it a perfect document? Probably not. But based on my understanding of the document, I would be supporting it. Read more: http://www.politico.com/magazine/story/2016/06/2016-campaign-election-hillary-clinton-bernie-sanders-green-party-jill-stein-progressives-liberal-213972#ixzz4FdLmhAoO Follow us: @politico on Twitter | Politico on Facebook
I always go for biggest case because i tend to have such bad luck with phones, well electronics in general....When it comes to phone cases, i like having that "odd" case, one no one would have. So as of Christmas, my main case is an Otterbox Armor. It may be big, and expensive, (only $20 more than life proof) but i trust it more than a Lifeproof when it comes to water/shock resistance, and i always get stopped and asked what case it is. My alternative case is a very bright, neon orange Griffin survivor case... I am yet to see either case that i use, out on someone else's phone, just has not happened yet.
You like to make generalisations as if that's ok. >especially if it's not even enforced by the one who makes it. Why not enforced? It would be better to be enforced. No one would suffer in Hell, right? Like someone (dont remember his name) has said: "Yes I have free will; I have no choice but to have it." What he said indicates the irony that if we do have a "free" will, we have no choice in the matter. However, this "free" will you're talking about is anything but free. The choices are forced on pain of death and eternal suffering. We have no real knowledge of what happens after we die, so we don't really know the truth in that respect. With zero information to reach a conclusion it's a massive lie to pretend anyone truly knows the truth in that respect. We're ignorant of the outcome of our actions. When a person does not believe in God, it does not mean that he willingly chooses Hell. He is ignorant of the outcome just like we are. This ignorance is innocent. We have no complete knowledge. Like I mentioned above it's a massive lie to pretend that we do know the truth in that respect, nobody truly knows the truth in that respect. It is not possible to know it within the confines of human life, and presuming to know it is ridiculous. Personally I default to "all our physical data and information returns <null> so Ill go with "nothing happens. No God, no afterlife, no judgment for our actions". I find it unrealistically hard to believe that we can survive the death of our physical bodies. You only find out what happens after you die, when you die.
Whilst the majority of what they're saying is bullshit, there is one thing that rings true, and that's that the majority of porn is not friendly to the women in it, there's a reason | 512 |
gmane | directory and pulled wav files from different mailboxes and this user's files are just quiet and very hard to hear. Gain changes did not help (but it was just a test anyway) it was not any louder than before. I tried deleting it and allowing the system to recreate this box, hoping that it would return to normal (yes, grasping at straws). Still, the voicemail box records this user's messages with very low playback volume, while other users have no problems hearing their voicemails.
Thanks for your response.
Lara
Hi,
could you give me a link or some information about the validating features in Jira?
I´m a bit lost searching for APIs and examples, i´m new on programming but I have almost done my work!!
I made a custom field wich I want to "give" some validation functions (not only if it is obligatory or not).
It is possible to do something as I describe in the picture shown below?
Thank you.
Hi,
While entering the Sonar with a "viewer" role and trying to add manual violation, I get the following error:
[cid:Qduq9FGPyC0AhK62@example.com
According to http://jira.codehaus.org/browse/SONAR-3237:
Admin users create the new rules from within the review screen. Once there is one rule, users are able to raise reviews, too.
But I am unable to add rules in the review screen (see above).
Is there a possibility to define that users will be able to add manual violations without being administrators?
Thanks,
Assaf Katz
Hi!
Quoting the latest debian-news announcement [1];
"Security Support for Woody ending. The Debian Project [2]announced
that more than one year after the release of Debian GNU/Linux 3.1
alias 'sarge' the security [3]support for the old stable
distribution 3.0 will be terminated at the end of June 2006. Debian
GNU/Linux 3.0 alias 'woody' has been released nearly four years ago
on July 19th 2002."
As the Debian-Edu/Skolelinux Security Support [4] depends on the work
by the Debian Security Team, our Security Support for
Debian-Edu/Skolelinux alias 'woody' and 'venus' will also be
terminated in the end of June 2006.
We recommend all users and schools using the Debian-Edu/Skolelinux
distribution to upgrade [5] or reinstall [6] to the Sarge-based version
soon. Sorry about the short notice.
- Werner
Hi. I want to use ed25519/curve25519, but right now I have an offline
master RSA key with three subkeys. Does it work well to add new subkeys
for Ed25519/Curve25519? What is the user experience in various
applications? I'm thinking MUAs, SSH, git, gpg itself, and also more
exotic approaches like K9Mail.
The alternative for me of course is to create a brand new key, with an
offline Ed25519 master key, plus some subkeys. Has anyone done this,
and can share their experience?
Naturally, I want the subkeys to be on hardware (smartcard). Is it
possible to have multiple OpenPGP cards for the same master key, but for
different subkeys? Does GNUK handle combined RSA+25519 keys?
/Simon
Hello,
I've downloaded Android-x86 v0.9 in my Eee PC 904HD, then i burned
the ISO file and booted it, then in the Grub Boot Menu i select | 512 |
s2orc | effectiveness (16)(17)(18). Nonetheless, this index only indicates the probable occupant acceptance of IAQ (19). In addition, in spite of an adequate ACH, there might be some areas with stagnant air, in which higher concentrations of indoor air pollutants are present and can increase the total occu-pants' exposure. Ventilation effectiveness cannot be considered as a good indicator of occupants' exposure to coarse particles since they no longer strictly follow the air pattern. Therefore, a more accurate index is needed for assessing the IAQ, which included not all, but the most important indoor air pollutants with respect to human health. Recently, a new methodological approach, called -fuzz logic‖ (21), has been used to solve complex environmental issues. This approach has been quite appropriate for subjective environmental problems, mainly due to its ability to deal with the classification of environmental conditions, particularly near boundary values were conventional methods tend to fail. In addition, it can help us achieving a balance when different or even contradictory observation have been obtained (22,23). Therefore, a number of studies have been conducted to develop environmental quality indices based on the fuzzy logic (24)(25)(26) and found it a suitable tool for assessing the environmental qualities. However, there has not been a study with the aim of developing an index for the IAQ assessment. Hence, the present study was aimed to develop a novel, fuzzy-based index (FIAQ) for assessing the air quality in indoor environments. For this purpose, we took into account three important categories of indoor air pollutants, namely, criteria air pollutants, volatile organic compounds, and bioaerosols, in the body of the index. In addition, a case study of virtually generated indoor environments was also provided to indicate the index performance.
Materials and Methods
A brief description of Fuzzy logic
Fuzzy logic has being increasingly applied mainly due to its particular capability in efficiently handling the environmental complex issues. By applying fuzzy logic, qualitative elements such as expert's knowledge and experience can be added to the quantitative part of a problem. The traditional methods used to develop indices are not capable of handling the environmental problems.
Fuzzy-based systems consist of fundamental parts, including membership functions, fuzzy inference systems, fuzzy set operators, fuzzy inference rules, and defuzzification process. In previously conducted studies, the concept of fuzzy logic is explained in details (24,27).
Criteria for the selection of weighting assignment to the parameters included in the FIAQI
Considering the advantage of Mamdani inference system, selection of weighting factors to the parameters included in the FIQAI were performed according to the experts' knowledge and medical evidence about their human health effects existing in the literature (Fig. 1). The top priority was given to the volatile organic compounds (VOC s ) group. Although criteria air pollutants are the most important air pollutants outdoors, the indoor concentrations of these compounds are 20-80% higher than their corresponding amount in the environment (12). In the case of VOC s , the indoor concentrations of these parameters have been observed to be largely higher, compared to their corresponding amount in the environment, (28); this is mainly due to | 512 |
reddit | really used for boss attacks that have 100% accuracy. I don't really think there's a such thing as a "general use" shield, as all shields are pretty useless in general, they only have niche uses at high-level bosses. if you just want one to quick-swap to for resonance/debilitate then t90 is better.
It's a free app so don't set off your piracy alarm, and I'm not asking for anything except a link to an older .IPA. I've looked for hours and every link leads to the app store. I don't want 6.2, I want 5.8.x or something close. No piracy, nothing cracked, just a simple older version of the app.
Had all three once, but MIDs and DEFs are a better investment (especially if you look at the value(season) rating), and that's why the FWD spot is the one that I give to rotating bargain strikers (Niasse scored me 12 today), so that I could be 100% happy with my GK, defenders and midfielders. Meanwhile with premium strikers one blanks one week, the other blanks another, they are the best players in the league but for their price in the FPL I'd rather go with someone like higher-scoring and cheaper Salah, KDB and Sterling, and defenders in my team (who are 2x cheaper) are just trailing behind the strikers as well. As for captaincy, Salah is the set and forget.
I think it helps that these people are such excellent actors. If you look for it, or even just casually watch the movies, you can pick up on the emotions they’re experiencing which helps you understand their motivations. They are such good actors that we subconsciously realize their growth through the movies
Lots of focus on future marriage/future hubby. At the time, I was like, I'm 12, I'm too young for this shit. Lots of crafty activities that were kind of a dialed down version of RS craft days. Emphasis on how to put together a nice home on a budget. Camp was kind of a joke compared to the cool things that the boys were able to do. I envied my brothers all the time. Lots of emphasis on being virtuous, lots of emphasis on what we wore, not a whole lot of emphasis on things that would actually help in the world outside of church. It wasn't awful, but there was a ton of room for improvement.
I was very drunk walking home with a friend on a college campus. Three guys approach us and one of them pulls out a gun and aims it at us. Tells us to take out our wallets. Being drunk, 19 yrs old thinking I was invincible, and an idiot. I told him "fuck you". There was an awkward silence followed by one of those crazy laughing fits on both sides you see in the movies. The gunmen then tried to say it was just a joke and it was a BB gun. Showing us the gun and saying this. It deff looked like a real piece but I was drunk so who knows. I feel like | 512 |
StackExchange | \leftarrow 3 \to 1$ have no join.
A:
$\def\Acyc{\mathrm{Acyc}}$Here are some things I have figured out since asking the question. Thanks to John Machacek for pointing out that I should look at the literature on supersolvability and chordality. First of all, rather than numbering the vertices of $G$, it is better to start with an acyclic directed graph $\vec{G}$, because we only care about the relative order of the labels on vertices which are joined by edges. So I'll refer to $\Acyc(\vec{G})$ from now on. I'll write $G$ for the underlying undirected graph of $\vec{G}$. I'll write $A(G)$ for the graphical hyperplane arrangement of $G$.
Let $\vec{G}$ be an acyclic digraph. Let $K$ be a clique of $G$. Define $c_K(G)$ to be the graph where we add a vertex $v$ with edges to the vertices of $K$ (and no other neighbors). Let $\sigma_K(\vec{G})$ and $\tau_K(\vec{G})$ be the orientations of $c_K(G)$ which match $\vec{G}$ on the edges of $G$ and make the new vertex $v$ into a source or a target respectively.
There are obvious maps $\Acyc(\sigma_K(\vec{G})) \to \Acyc(G)$ and $\Acyc(\tau_K(\vec{G})) \to \Acyc(G)$. The fibers of this map are total orders.
(1) Adapting the proof of Theorem 4.6 in Bjorner, Edelman and Ziegler shows that, if $\Acyc(\vec{G})$ is a lattice, then $\Acyc(\sigma_K(\vec{G}))$ and $\Acyc(\tau_K(\vec{G}))$ are as well.
In particular, if $\vec{G}$ can be built from the empty digraph by repeatedly applying the $\sigma$ and $\tau$ operators, then $\Acyc(\vec{G})$ is a lattice.
(2) Stanley (lecture 4) shows that the following are equivalent:
$G$ can be built from the empty graph by repeatedly applying the $c_K$ operators.
$G$ is chordal, meaning that $G$ does not have a $k$-cycle as induced subgraph for $k \geq 4$.
$A(G)$ is supersolvable.
(3) If $\Acyc(\vec{G})$ is a lattice, and $\vec{H}$ is an induced diagraph of $\vec{G}$, then $\Acyc(\vec{H})$ is a lattice. Proof: Let $G/H$ be the graph obtained by shrinking $H$ to a point. Choose an acyclic orientation $\omega$ of $G/H$. Let $\omega_-$ be the orientation of $G$ which agree with $\omega$ on the edges not in $H$ and agree with $\vec{G}$ on $H$; let $\omega_+$ be the orientation where we reverse the edges in $H$ and keep the others the same. Then the interval $[\omega_-, \omega_+]$ in $\Acyc(\vec{G})$ is isomorphic to $\Acyc(\vec{H})$. Every interval in a lattice is likewise a lattice.
(4) Let $\vec{G}_1$ and $\vec{G}_2$ be two acyclic digraphs, and let $\vec{G}$ be the graph obtained by gluing $\vec{G}_1$ to $\vec{G}_2$ at a single vertex. Then $\Acyc(\vec{G}) \cong \Acyc(\vec{G}_1) \times \Acyc(\vec{G}_2)$, so $\Acyc(\vec{G})$ is a lattice if and only if $\Acyc(\vec{G}_1)$ and $\Acyc(\vec{G}_2)$ are. So we can reduce to considering $2$-connected graphs.
I still suspect there is a nice answer I am missing.
Q:
Is there a faster way to Map an Association?
Consider mapping an existing Association in a manner such as this:
asc = AssociationThread[Range @ 26, CharacterRange["a", "z"]];
Map[asc, {{11, 13, 2}, {19, 23, 16}}, {2}]
{{"k", "m", "b"}, {"s", "w", "p"}}
Is there a more efficient way perform this generic operation?
A:
Although announced for 10.0.2 the functionality below works from 10.0.0 onward. | 512 |
s2orc | be difficult to access frequently. Because of this, CRAFFT should be operated by full automation system and maintenance free. Now we are testing the solar power system and automation DAQ system. We also update electronics for slow control in order to switch from a commercial product to original electronics developed by our own for cost reduction. All of the procedure such as initialization of electronics, weather monitor, DAQ and shutdown will be done, automatically.
Protection and fail-safe system is also important. Now, for the protection of the detector from daylight we installed a roll curtain which is manually operated just behind the Fresnel lens. We will update the protection system using electric powered shutter which will be mounted in front of the Fresnel lens. We are planning the automation system test in 2018 Oct. at TA FD site.
Future prospect
We proved the detection ability of ultra-high energy cosmic ray air showers by CRAFFT detector. We propose a huge CRAFFT array for the next generation of cosmic ray observatory as shown in Fig. 14 Overlaid on the U.S. map. In order to clarify the origin of ultra-high energy cosmic ray, we need more detection area than ever. The detection area of TA is ∼ 700 km 2 . If we need 100 times more than TA, the detection area should be 70, 000 km 2 which is shown in Fig. 14 as a left side square area . However, the duty cycle of FD is 10% of surface detector array. If we realize 100 times TA using only FDs such as CRAFFT, we need 700, 000 km 2 . which is shown in Fig. 14 as a right side square area. If it is difficult to prepare such huge area at the same place as shown in Fig. 14, divided array can be distributed in any place, because the important things is total area. If the target energy is above 10 20 eV, CRAFFT can detect air showers within ∼ 25 km [14]. When we arrange the CRAFFT stations at intervals of 25 km over 700, 000 km 2 , we need 900 CRAFFT stations. One CRAFFT station consists of 30 telescopes. Here, the F.O.V. of each telescope is assumed as 12 • . Under these assumption, total cost will be roughly $250,000,000.
Summary
We are developing a simple
FUNGSI PRONOMINA PERSONA PERTAMA DALAM BAHASA SASAK DIALEK MENU-MENI (FIRST PERSONAL PRONOUN FUNCTION IN DIALECT MENU-MENI OF SASAK LANGUAGE)
Siti Wahyuni
Fakultas Ilmu Budaya
Universitas Gadjah Mada Ponsel
087738282036
Sulistya Wulandari
Fakultas Ilmu Budaya
Universitas Gadjah Mada Ponsel
087738282036
FUNGSI PRONOMINA PERSONA PERTAMA DALAM BAHASA SASAK DIALEK MENU-MENI (FIRST PERSONAL PRONOUN FUNCTION IN DIALECT MENU-MENI OF SASAK LANGUAGE)
Siti Wahyuni S.W..: Fungsi Pronomina Persona ... 69syntactic functionpersonal pronounSasak language Kata kunci: fungsi sintaksispronomina personabahasa Sasak
This writing discusses the possible syntactic functions for each form of first personal pronouns using descriptive-qualitative method. Data were collected by several techniques, namely observing, recording, listening, interviewing, using intuition, and writing (fonetics transcription). Data were analyzed using distributional method. The result shows that generally, based on the | 512 |
Pile-CC | Dinner co-chair, former chair of the Association's national board and current chair of the Alzheimer's Impact Movement (AIM). "This accomplishment was driven by you and your willingness to share your personal stories with your elected officials, so they could recognize the need to push this cause forward."
Harry Johns, Alzheimer's Association president and CEO, thanked attendees for their successful advocacy efforts. "We now have hundreds of thousands of advocates around the country letting lawmakers know what they need to do," he said. "We appreciate what you do to keep them informed. What I want you to walk away from tonight is the realization that because of your work, we can truly have a world without Alzheimer's."
The Alzheimer's Association Humanitarian Award recognizes public officials who have made a significant policy contribution to advancements in research and enhanced care and support for people with Alzheimer's disease. This year's honoree, Sen. Jerry Moran (R-Kan.), played a vital role in the increase in Alzheimer's funding included in the 2014 federal budget.
"This accomplishment is among the most profound I have witnessed in my 16 years of advocacy, because it marks 2014 as the year that Alzheimer's research funding initiated its first step in the ramp-up to a cure," said Bob Thomas, National Dinner co-chair and AIM treasurer. "No one could have done this alone — credit belongs to Association advocates and to other key legislators in Congress. Yet, I assure you that Jerry was a true leader, providing vision with passion and, in these times, courage, to make this happen."
Moran said he was honored by the recognition but that people in the audience are the "true champions" in the fight against Alzheimer's. "I commit to you that during my time in the U.S. Senate, I will be a relentless advocate to see that Alzheimer's becomes a preventable, treatable and curable disease," he said. "But the cause has a lot less to do with me and lot more to do with you."
Moran also confirmed how vital it is for advocates to visit with lawmakers. As it turns out, Thomas himself made an impression on Moran.
"It was only when one of your advocates called on me and made your case that this issue became a priority for me," he said. "Bob Thomas was that person for me. He sought me out — and then I couldn't get rid of him."
The Alzheimer's Association Ronald and Nancy Reagan Research Award is presented annually to an individual working to find innovative approaches to Alzheimer's treatment, prevention and care. The 2014 recipient is Dr. Francis Collins, director of the National Institutes of Health (NIH), where he oversees the work of the world's largest research enterprise, spanning the spectrum from basic to clinical research.
At last year's Forum, Collins announced that he was spending $40 million from his discretionary budget to fund innovative Alzheimer's projects. According to Johns, who presented Collins with the award, Collins fulfilled that promise with the funding of important research aimed at advancing treatment and validating drug targets. In addition, Collins established the Accelerating | 512 |
gmane | than the column width available in vanilla Mezzanine.
See https://www.sharedsds.com/user-docs/quick-start/
I'm not a css/html (nor any other type of) guru so any advice will be
reverentially followed.
Thanks
Mike
Hi,
I am trying to use statistical Plugin for ActiveMQ broker to get the broker
stats into the log file. But I am not able to find any access methods or
APIs by which I can log these stats. I have checked
org.apache.activemq.plugin.StatisticsBroker for this but it is use to send
these stats to the broker. Is there a way by which I can log these all stats
into my log file.
Thanks,
Steven
Guys
I think there is legal systems that can take care of these legality issues, and much better than the ASL mailing list at that. Try reading the rulebook and learn it instead of trashtalking on the list. Everytime you mail something to the list, ask yourself, will this mail benefit ALL aspects of the hobby ? If it is then send it, if it does not keep it for yourself.
Can we maybe talk about ASL as a game we all love instead ???
Anyone have any cool war stories to tell ?
I can tell you all to try play ASL A 120 Uncommon Valor, a very nice and fast paced night scenario where many aspects of night warfare can be experienced. As there is no vehicles it is also a great learning scenario for night action.
Med Vänliga Hälsningar (Regards)
Hi Tarik,
Linux uses ram completely differently from windows - take all you know about
windows put it in a box and put it away as it is of no use.
Linux manages it ram very effectively allocating ram to where it is actually
needed - because the ram manage is so much more effective it will use a lot
of ram for buffers etc if no other program requires ram ie squid. As a
result the only sign that an ipcop box is in trouble ram wise is if it
starts to use swap - this is a last ditch effort by linux to keep going
unlike windows where it is the norm.
Is the long sleep because the hard disk is set to sleep in the bios?
My home system with 192 Meg ram, k6-500, 6.4Gb responds in less than a
second if I go to open the admin web page on ipcop.
The ipcop at the school with 256 Meg ram, p4-733, 10Gb where I am the
computer admin/network admin responds slightly slower 1-2 sec - that is with
210 computers (acorn a4000's (80), acorn nc's (20), pc's (80), mac's (30))
on the network.
Both systems has advproxy, urlfilter with custom expressions for ads.
Home system also has lmsensor mod - so i can monitor the fans and
temperature
Maurice
[4.5 Stable]
With both an Intellimouse ps2 and an old ibm ps2 I get
the psmintr out of sync (00c01 ! = 0000) error.
I tried with the NOCHECKSYNC flag in moused and place
the following in my kernel:
options PSM_HOOKRESUME
options PSM_RESETAFTERSUSPEND | 512 |
Pile-CC | Such security worries are overblown, at least in most cases, Kundra felt. "If you think about it, there is very little the government does that is private," he told GCN.
Another set of projects Kundra spearheaded shows a conviction to openness: that agencies could benefit by publishing their data so that others can use them for their purposes. Last year, D.C. published over 240 data feeds all of which came from internal systems, ranging from metro timetables to crime reports.
To spur applications that use this data, Kundra then kicked off a contest, called AppsForDemocracy. Instead of building out applications that the public could use itself, D.C. hoped to motivate volunteers to build apps, for either the Web or for mobile phones or some other platform. The effort led to more than 47 new apps being built, at a fraction of the cost of building them in-house.
Again, by relying on this new approach to IT system procurement, namely by using Web 2.0 tools and crowdsourcing, agencies could save money. The city estimated that, if it were to commission all these apps that were built for AppsForDemocracy individually, it would cost more than $2.6 million. Running the contest came to only about $50,000. (The OCTO also created its own site, the Digital Public Square to make data feed information available as well).
These are just a few of the new initiatives that have come from Kundra. His office has also opened the city's procurement process, publishing request-for-proposals on the Web and offering introductory information on YouTube. In-house, his employees use Wikis and Twitter-like messaging service, and he has floated the idea of "letting drivers pay parking tickets and renew driver's licenses on Facebook," the Post reported.
Behind these initiatives, obviously, is a belief that technology could be used for positive change. Not surprisingly, Kundra was a supporter of the Barack Obama presidential campaign, which also spoke of government change. Kundra has stated that his career goal is to "to affect change as a public servant."
And like Obama, Kundra shares an international upbringing. If Wikipedia is to be believed, he was born in India and grew up in Tanzania, speaking Swahili as his first language. When he was 11, his family moved to Gaithersburg, Md. He majored in psychology as an undergrad, and he earned a masters degree in information technology from the University of Maryland. He is also a graduate of the University of Virginia's Sorensen Institute for Political Leadership. Before coming to D.C., he served as Virginia's Assistant Secretary of Commerce and Technology. He's also spent time on the private sector at SAIC and as chief executive officer of startup Creostar.
Not surprisingly, Kundra has brought some of the swiftness of the business world to his government work. For instance, he set up the OCTO office to run like an open trading floor. He even uses financial portfolio management software to track the success of IT projects. "The main work area is set up to resemble the trading floor of a stock exchange; the open seating format encourages collaboration, while | 512 |
reddit | gain more weight or lose more weight than their energy counts dictate - but I don't subscribe to these beliefs as I have not yet seen convincing evidence.
Let's see. I think I miscounted my Phoebe's. I thought I had another of her, but I don't :(. Also I never had a 303 Katrina, I still need her. So how about My DJ KK (003), Tommy (108), Flo (73), Fuschia (123) for your Reese (102), Phineas (304), Frita (339), and Frobert (393)?
Yes the spots were, but they were really really bad. Line and tears all over the screen. My refurbished model I didn't have a choice on, Sony just sent me it. It also only has one little black dot. But I have a screen defect like the one on the photo. But it's only barely noticeable. It's just frustrating because I want to sit back and enjoy my vita but I've had so many screen problems.
Trust me, it's hard sometimes. I have a close friend that came out of the entire show thinking both SA and BD were both completely guilty. Human perception is weird, everyone sees stuff differently. I however can't argue with some people, when their argument are opinion based but presented as factual- when they're just regurgitating the same false rhetoric. It was fun to send him a screenshot of "BD Case overturned" and have him immediately start the back peddling. "SA is still guilty though." Can't wait till his next serving of humble pie. I'm only in my mid twenties, I can't imagine losing my teenage and early adulthood years for a false crime, let alone poor SA who's lost 30 years of his life- you'd think people would be more sympathetic and open minded. People don't even necessarily have to pick a side in a situation like this, let the upcoming legal proceedings happen and than pass a judgment.
**Country of purchase: US** **Budget range:** up to $1500, preferably between $1000 - $1300 **Purpose(netbook, ultraportable, mainstream, gaming, desktop replacement, etc.):** ultraportable / light gaming and photoshop **Screen size preference:** 14" or smaller, might go to 15" if it's light enough. **OS preference (Windows/Mac/Linux):** No preference **Gaming requirements (example games and desired fps/settings):** I'm really only looking to run indie games like Risk of Rain, Rogue Legacy and Transistor (maybe League of Legends and Blizzard Games, but not as important). Medium to low settings are fine. **Other performance requirements (video editing, CAD, etc.):** I'll be doing some drawing and photo editing in photoshop, but it doesn't have to be too intensive since I'll also have a desktop **Brand preferences and reasons (already owned accessories, familiarity, business compatibility):** No brand preference as long as it's a good laptop **Any particular style that you like (examples are great):** Nothing too flashy, I prefer something understated **Which of the following qualities would you prefer? (Choose one, two, or balanced)** **Long battery life -vs- Low weight -vs- High performance:** preferably somewhat balanced, but I'm more in favor of low weight + long battery life **Build quality -vs- Low price -vs- | 512 |
gmane | just this single function
from the Rcmdr package?
Many thanks,
Rehceb Rotkiv
I haven't been too successful in apt pinning components. Has anyone
else tinkered with this yet?
It would be nice to keep all of the components intact while being able
to perform an 'apt-get upgrade'
for all of the packages that would be installed off of a localized
debian sarge/sid mirror. Its cumbersome
to add ALL of the packages contained within the components to a pinning
list, and the ability to pin a whole
component would rock my socks off!
Neil
Just a quick heads up. I'm doing a little testing with the Hudson CI
server. Although this is just an experiment, I think the way that
I've got it configured right now you'll get email from it at your
Tigris address if you break the build because it just slaps your SVN
commit username together with @tigris.org.
If you'd prefer not to receive this emails, don't break the build. :-)
Our current homegrown setup only runs nightly and doesn't keep any
history, but has the advantage of publishing results back to the team.
Hudson, as far as I can see, doesn't provide for external publishing,
but keeps track of history, trends, who broke things, provides links
to back to the web SVN source browser, etc.
Anyone know of a good solution that integrates the best of both
worlds? BTW, I previously did a CruiseControl config for ArgoUML
which is available in SVN, but I doubt it's been updated for the new
directory structure. Hudson seems a little nicer than CruiseControl.
Tom
Hi,
The package manifold learning does not build cleanly on Linux, and I
don't think it would on any other platform because of some directories
mispelling at least. I could not make it work in a few minutes, and
instead of messing with a package which is not mine, I have disabled it
in the setup.py for the moment.
Please make sure that a package is at least buildable when adding
something in scikits.learn, otherwise, every other use of scikits.learn
is affected, even when they do not use the package.
Thank you,
David
Hello list,
I hope this is an appropriate list for this type of question.
I'm about to set up some fail over VM hosts using KVM. I've got a
shared iscsi disk, and I was hoping
to use something like CLVM so that two hosts can have direct access to
the same volume group at the
same time (accessing different logical volumes of course).
However, when I started looking into CLVM, I noticed it requires the
redhat-cluster stack, of which I'm not
much of a fan.
So, is there an alternative to CLVM which doesn't involve
redhat-cluster suite? Or is redhat-cluster suite
and CLVM the preferred method for shared volume management in ubuntu?
Thanks,
Doug
Hi all,
I am trying to call web services from an Eclipse RCP application. Is
there a howto about this?
I tried to simply install the cxf-bundle-2.2.5.jar into the eclipse
plugins directory but it did not even show up in the plugins of | 512 |
reddit | cannot for the love of me find any. Do you guys know of anywhere I can snag some 2012 prints? I'm also looking for an MPP1 print from this year, but they want extremely too much money on ebay and such for them. Anyone know where to find good prints?
Pretty sure they already do this. I have 3 different things that I use a fingerprint to gain access. My gym, the supplies locker at work, and the clock-in device at work. Not to mention when I bought my house, if I cash a check at a foreign bank, or that little misunderstanding when my SO and I on date night decided to not get a room.
> I accept the possibility that there's a remote chance that I will accidentally harm someone Except before I even commented, you said: > It's our responsibility to avoid doing it to others, even accidentally. I just wanted you to admit that that's not realistic. Thank you for doing so. Though I'll point out that the 'thousands a year' number was based on us getting it right 99.9999% of the time, which is unrealistically high. Drop that to a 99% success rate and we're talking 69 million cases of misreading nonverbal communication a year. > I am quite certain we're not going to a "chivalric" culture - that just removes choice from women in a different way, and in reality has never been associated with lower violence against women, just lip service to it. I could have been more clear here - I didn't mean traditional male-dominated forms of "chivalry". That may have been a poor choice of words. The scenario I had in mind was not a male/female dichotomy but an active/passive one where the initiator is unilaterally responsible for the consent and comfort of the passive party in all aspects of the relationship, not just sex. > But we will have a lot of change in our ideas of "masculine" and "feminine" roles. Again, thank you for admitting to this. Too often I am seeing arguments that the 'masculine' role must change, while excuses are made for the 'feminine' one. Both must change if we are to move past this as a culture.
This here. Prior to Jan 1 of this year, we both worked, and she had no issue with waking me to go get the baby, burp the baby, put the baby back to bed etc. As of Jan 1, she is now a SAHM to my two girls (3.5 and 6m), while by boy (5) goes to VPK. She will occasionally wake me if something odd is happening, but for the most part, she manages the baby 100% at night. I still sleep in the same bed and can sleep through near anything. What is odd is I won't hear the baby, but since i've been doing nighttimes with the older kids for years now, I will hear and wake up if either of them has an issue in the night, but my brain has figured out how to tune out the | 512 |
realnews | 13 tablets will become available on June 10th and the base models will be priced at $500 and $650, respectively -- just as the Thrive is phased out of the market.
Toshiba introduced the world to Thrive tablet just a few months ago, in July, but all of the full-sized feature, removable batter options, and $430 price tag didn't entice the consumers enough and eventually the prices started getting slashed until now when we hear about a whole tablet line overhaul.
Toshiba also claims that the Excite 13 has an average battery life of 13 hours -- and if proved correct, this might actually be a successfully selling point since the HD power-sucking new iPads have left consumers feeling a distinct dependance on their power cords.
While we have seen a lot of these specs before in tablet devices, consumers will have to wait to interact with the new line to see if there is anything extra special or exciting about these devices. And with Google's rumored $200 Nexus Tablet expected out this summer, Toshiba may be fighting a losing battle in the tablet wars where the only big sellers are lowest prices or best design -- and anything in the middle is lost in the shuffle.
We already know that Toshiba isn't fighting for the top two spots in the tablet market since those have firmly been given to the iPad line and the Kindle pantheon.
Apple announced last month that itsold more than 3 million new iPads during the product’s first weekend in stores.
That’s at least triple the number of iPad 2 tablets that analysts estimated the company sold during that product’s opening weekend last year. While breaking the previous releases' record is now an expected move, the fact that it is triple is astounding and shows that there is no slowing rate at which people are snapping up these amazing screens.
The new iPad, released in early March starts at $500 and included what most are admitting is the best display screen in the market, a better camera, a faster processor and support from AT&T and Verizon’s LTE network.
So perhaps Toshiba wants nothing more than some crumbs from the growing demand for tablet devices.
Canadian prime minister Justin Trudeau said that he has no plans to "insult" or "overreact" to President Donald Trump's provocations.
In an interview with Rolling Stone, Canada's leader disclosed that while he disagrees with Trump on subjects like the environment and foreign policy, he also does not plan to "go out of [his] way" to prove him wrong.
"Obviously, I disagree [with Trump] on a whole bunch, but Canadians expect me to accomplish two things at the same time, which is emphasize where we disagree and stand up firmly for Canadian interests," Trudeau told Rolling Stone.
While some Canadians have criticized Trudeau for not taking a firmer stance against Trump's politics, he said he prefers to maintain "a constructive working relationship" between Canada and the US.
"But we also have a constructive working relationship, and me going out of my way to insult | 512 |
StackExchange | this? Is there a Launchpad project for the website content that is neither community-contributed nor hosted in the help subdomain?
I know there is an ubuntu-website Launchpad project, and I have seen this question which says that website problems should be reported there. Is that also the right place to report "pure content" problems like the one I have encountered?
Since I originally posted this question, aking1012 has pointed out in chat that at least one bug filed against ubuntu-website and accepted is, like this one, a non-trivial content issue. This suggests that I can just report this against ubuntu-website...but if anyone has a definitive answer with documentation (or just more examples of such bugs, or personal experience, or if you maintain the Ubuntu website), I'd still welcome an answer here.
A:
Your suspicion is correct. Website (including content) issues should be reported against ubuntu-website.
Q:
Replace all images to be element's own id + .jpg
What is a good way to replace all background-images on certain elements, to be each element's own id + ".jpg"? Using jquery
Do I need to use $.each, or can I edit this to work somehow:
$(".element").css("background-image", "url(img/" + $(this).data("id") + ".jpg)");
// it sets undefined.jpg, $(this) is not the way
EDIT PS: data("id") is not a typo/mistake. I use data.id on the element
A:
You can the setter version of .css() that takes a function as the second argument and then return the style value from that function
$(".element").css("background-image", function () {
return "url(img/" + $(this).data("id") + ".jpg)"
});
In your case this will refer to the function's context in which you have written the code, instead you need to have a reference to the current .element element.
Q:
php join two elements of array
I have this array
$MyArray[0]=Array("id"=>1,"name"=>prophet,"family"=>muhammad);
$MyArray[1]=Array("id"=>1,"name"=>imam,"family"=>ali);
$MyArray[2]=Array("id"=>1,"name"=>imam,"family"=>hossein);
I want merge only name and family to fullName?
I want like this
$MyArray[0]=Array("id"=>1,"name"=>prophet,"family"=>muhammad,"fullName"=>"prophet muhammad");
$MyArray[1]=Array("id"=>1,"name"=>imam,"family"=>ali,"fullName"=>"imam ali");
$MyArray[2]=Array("id"=>1,"name"=>imam,"family"=>hossein,"fullName"=>"imam hossein");
I can do with this code
$count=0;
foreach($MyArray as $R)
{
$result[$count++]=array("name"=>$R["name"],"family"=>$R["family"],"fullName"=>$R["name"]." ".$R["family"]);
}
var_dump($result);
Online Demo
there is better way to do that?
A:
Just assign a new key pair value inside your current array structure. A simple foreach should suffice:
$MyArray[0]=Array("id"=>1,"name"=>"prophet","family"=>"muhammad");
$MyArray[1]=Array("id"=>1,"name"=>"imam","family"=>"ali");
$MyArray[2]=Array("id"=>1,"name"=>"imam","family"=>"hossein");
foreach($MyArray as &$arr) {
// ^ reference
$arr['fullName'] = "{$arr['name']} {$arr['family']}";
// ^ new key ^ new value assignment
}
Sample Output
A:
You can use array_map() in your code like this:
<?php
$MyArray[0]=Array("id"=>1,"name"=> "prophet", "family"=> "muhammad");
$MyArray[1]=Array("id"=>1,"name"=> "imam", "family"=> "ali");
$MyArray[2]=Array("id"=>1,"name"=> "imam", "family"=> "hossein");
$array = array_map(function($n) {$n['fullName'] = $n['name'] . ' ' . $n['family']; return $n;}, $MyArray);
print_r($array);
Output:
Array
(
[0] => Array
(
[id] => 1
[name] => prophet
[family] => muhammad
[fullName] => prophet muhammad
)
[1] => Array
(
[id] => 1
[name] => imam
[family] => ali
[fullName] => imam ali
)
[2] => Array
(
[id] => 1
[name] => imam
[family] => hossein
[fullName] => imam hossein
)
)
Read more at:
http://php.net/array_map
Q:
How to add Banned Users to table,and send details to user's email within Django Admin
I have a simple banning function that sets user active to | 512 |
OpenSubtitles | and out." " Yes, sir." "And don't forget to trim the hedge." "Trim, trim, trim." " We will, sir." " Thank you, sir." "Arthur." "Don't you think you could have given them 75 cents for all that work?" "Nonsense, my dear." "Those kids get gypped a few times, it sharpens them up." "Why, people like me are benefactors to those children." "Yes, I'm a little nervous about those Addams kids." "Oh, what's the difference?" "Why, he looks strong as an ox and she probably is very wiry." "Oh, well, you'd hire Jack the Ripper and Lizzie Borden if they worked cheap enough." "I know what I'm doing." "If I really get that attic cleaned out and this hedge trimmed," "I can unload this lemon." "Come on, Charity, we gotta go." "We gotta foreclose on that Smith place before 3:00." "Thank you, Thing." "Hello." " Oh, darling, it's you." " Who you calling "darling"?" "Your son, Pugsley." "Yes, darling." "Really?" "Oh, that's wonderful!" "Yes, goodbye, dear." "Pugsley has a position with Mr. Henson." "And Wednesday is assisting." "Henson's a big man in property management." "I suppose they'll have to start at the bottom." "No, at the top." "They're cleaning out Mr. Henson's attic." "Little scamps don't waste much time getting going." "With their deft way with blasting caps, they'll have that attic cleaned out before you can say, "Take cover."" "My dear, it took me years to acquire the proficiency of the Australian Aborigine with the boomerang." "So don't be too disappointed at the showing you first make." "All right, now try it, my dear." " Yes, that's it." " Like this, dear?" "Yes, indeed." "Not bad for a beginner!" "Now, the essential quality of the boomerang is that..." " It returns to its thrower." " Correct." "As a matter of fact, a real expert can make it return..." "Again and again." "Wonderful!" "Seven more years of lovely luck." " Hi!" " Hi!" " Hi!" " My little working force." "Home from the first day on the job." "What did the Hensons think of your work?" "They didn't get back yet." "But it's all done." "Wonderful!" "Trust an Addams to finish the job." "Finish the
"Good morning!" "I'll take your word for it." "Why so fancy?" "I told you, ma." "I got the interview for the internship today." "Ah, yes." "A job where you work very hard and make no money." "It's what I dreamed of for you when I came to this country." "We know what you dreamed of for us." "Remember?" "Oh, when she'd take us to the nice neighborhood..." "Point to the biggest house..." "And say, "you're American." ""You work hard, you make something of yourself," ""and one day..." " You can clean that house." - "You can clean that house."" "I was wrong." "That was way too much house for either one of you." "Ah, my beautiful wife." "Mm." "Her beautiful mother." "And..." "Cristela." "You look very nice, Cris." "Thank you, Daniela." "I bought a digital scale." "I've lost four ounces." "I never weigh myself." "Yeah, skinny people don't | 512 |
YouTubeCommons | we don't want to overwrite any content that might be on that environment so we'll say none and we don't want to push our files either because any files that we created is just for test content on our local environment so we'll select none for that as well and we've already pushed this change so i'm just going to press enter here so if i flip back over here to my pantheon dev site we have this site here if i were to reload this it still has some of the things from the previous site so the switcher's still here and it hasn't been switched over to this dot based switcher here so what we want to do is we want to actually be able to run drush commands on that remote environment now we can do that from our lando base project so if you're in your terminal in your local project you could do a lando drush essay so this is a way to list all the aliases you have in your project and by default you might not actually have these pantheon aliases if you run this for the first time you might only see none self and default so if you want to list those additional aliases you can do drush terminus aliases so terminus is a pantheon command line tool that they use to interact with the revo environment so if i run that lando terminus aliases command it goes and it fetches those aliases from our remote site and then from there if you were to list your sa you will see those different environments now so i might want to clear the caches on just the dev environment so i can come up here and i can copy this command here that corresponds to the specific site that i want and then i can do orlando rush dev and do a status to start see if we can get the status of that remote and then we could do something like clear all caches now if i were to come back here and reload this page you see here that the dev environment switched so the css got applied because we cleared the caches and now we're seeing this little switcher block down here and it has these dots to switch through so that's been updated great so now we're seeing some of the changes from our local up on that remote environment and we can do other changes as well so if we want to enable those blocks like this call to action section that was added down here so these little blocks here this is a new section that we added we can enable those features and we want to enable any of the contributive modules that those features rely on and then that way we'll have that whole structure built out and we deployed that with code so we don't have to go and recreate anything manually on pantheon we can actually just use what we have already tracked in | 512 |
Pile-CC | of fat
To cause the least disturbance of neighboring tissue, such as blood vessels and connective tissue
To leave the person’s fluid balance undisturbed
To cause the least discomfort to the patient
As techniques have been refined, many ideas have emerged that have brought liposuction closer to being safe, easy, less uncomfortable, and effective. The marketing that goes on makes it hard for the consumer to determine truth from exaggeration.
Latest tweets
"Micro vascular free tissue transfer surgery is used for reconstruction of large tumors of the Head & Neck region, particularly the oral cavity. The advent of Micro vascular surgery has dramatically increased the scope and breadth of treatment options for patients who were previously considered non treatable, thus making a difference to people who had given up hope. ”
Get in touch!
Testimonials
" I am a dancer and I have over the years had bulges over my hip and thighs. I consulted Dr. Shivaram Bharathwaj and he assured me of a safe surgery. I was very comfortable after the surgery as the right amount of fat was removed. I understand removing excess of fat can lead to problems. I am now able to wear my old costumes and am following the necessary diet in addition to my practice regime"
Shanthi, Classical Bharthanatyam dancer, Chennai
" I have been on a strict diet and excercise regime for my overweight issues. Though I lost considerable weight, my paunch just did'nt go away. I had liposuction done by Dr. Shivaram Bharathwaj and now I am able to show off my new jeans."
Note: This site is not run by or affiliated with USPLabs in any way. See USPLabs Direct for the official site. No statements on this site are endorsed or approved by USPlabs LLC and are the sole property of this site's owners. The site operators can be reached at (424) 262-0793.
In April of 2012, Toronto Blue Jays star right-handed pitcher Marcus Stroman was handed a whopping 50-game suspension for violating the MLB’s drug program. He tested positive for methylhexanamine, otherwise known as 1,3 Dimethylamylamine, or DMAA for short.
This news was major in the sports world, but didn’t register onto our radars until recently. Why? Because it turns out that Marcus wasn’t just using DMAA — he was taking OxyELITE Pro, the fat-burning weight loss product that is the basis of this site.
Well baseball fans, you have our attention. So now it’s time for you to hear it from another angle – ours.
The Disclaimer: This Site is NOT Run by USPLabs
Before we begin, I must say this: this site is not run by USPLabs, the manufacturer of OxyELITE Pro. We are not reps for them, we are not employed by them, and we are not affiliated with them in any way, shape or form. They are at USPLabsDirect.com.
This is a third-party weight loss community. I am going to give some opinions that you may not like (if your name is Bud Selig). These opinions are mine. Not USP’s.
Now let’s get on with business.
OxyELITE | 512 |
goodreads | and she has given me the tools and the hope to continue on.
914.104858 The
Let's not even pretend that I didn't enjoy this. The second I heard about the little 12 year old version of me nearly shit a brick from excitement and it did not disappoint.
I don't usually pick up a political thriller, but found this one to be more of a murder mystery partially set agains the backdrop of DC. The other part was set in Savannah, GA, one of my all time favorite cities. I know the author (Margaret Truman, daughter of Harry S. Truman, who had a career as an operah singer before turning to writing) died in 2008 yet the book is set in current day. I thought the book felt as if some parts had been "updated" to make it contemporary and ruined the flow a bit, but still a very engaging read and it took my mind off Hurricane Irene as she blew through last weekend.
From Amazon.com
Doomed queen of Henry VIII, mother to Elizabeth I, the epic story of Anne Boleyn from an exceptional new writer. Anne Boleyn was the most controversial and scandalous woman ever to sit on the throne of England. From her early days at the imposing Hever Castle in Kent, to the glittering courts of Paris and London, Anne caused a stir wherever she went. Alluring but not beautiful, Anne's wit and poise won her numerous admirers at the English court, and caught the roving eye of King Henry.
Anne was determined to shape her own destiny, first through a secret engagement to Henry Percy, the heir of the Earl of Northumberland, and later through her insistence on marriage with the king, after a long and tempestuous relationship as his mistress. Their love affair was as extreme as it was deadly, from Henry's 'mine own sweetheart' to 'cursed and poisoning whore' her fall from grace was total.
I received this book from my daughter as a gift and have not finished it yet. So far so good. It appears that a lot of research went into it and it may not be accurate as a few reviewers claimed. But so far I am finding it interesting, I like the use of letters, notes, quotes. There are also nice pictures in the book of castles, statues. Amazing picture of the King Henry VIII bedroom at Hever Castle.
I am not a historian and do not claim to be but I find that it is interesting to read different variations on the same story. Anne Boleyn was a woman who knew what she wanted and how to go about it. Henry had a very high opinion of Anne and when she could not live up to his expectations , mostly not giving him the son he wanted, he found a way to bring her to her death, so he could move on to the next wife. Although the child they did have, Queen Elizabeth I was a very exceptional woman of her time, but that is for another review..
This is a very | 512 |
YouTubeCommons | Picts offer 20 21 so with the picks being 4 20 21 and you were looking at unload salary captain they've been doing it in so many different ways they restructured Patrick cards contract they restructured LJ Ford's contract they release James Hearst they traded Hayden her so that was more for him to get an opportunity and them to get a draft fit they um they have just done so many different things they extended Sam Cooke's contract they have been moving and shaking and bringing in quality guys upgrading the team but then with this you do trade a defensive line a backup defensive lineman who was gonna count a little over two million cap this year now of course you brought in some quality quality quality depth so Chris Romney was probably G's might have been active on game day he was active or last year but he wouldn't have seen too much time but he was counting to over two men on a salary on salary cap and you trade him away along with the seventh round pick for 2021 remember that part but you gain a fifth round pick so you're giving up a seventh round pick and I'm not trying to sound harsh I'm not trying to sound mean but it's the seventh round pick so a lot of those guys don't even make the rosters so you're essentially giving up somebody who might probably wouldn't have made the roster anyway you're essentially giving up somebody who probably wouldn't have made the roster anyway to acquire and the Penner you're giving up the somebody who wouldn't have made the roster anyway along with a DEP DEP DEP guy and you're gaming two million cap space and you're gaining a fifth round pick in 2021 Chris normally is not a bad player he just really didn't get many opportunities because of it was always somebody in front of him ever since he's been with the Ravens has always been somebody in front of him when he's been on the field he's been decent he hasn't been bad anything like that so I don't want Ravens fans or even still his fans to think oh man oh that this guy's he sucks no he doesn't he's not a bad player at all but he just the thing with him is that he hasn't had much opportunity will he get that opportunity with Pittsburgh we'll see now I know they got a nice little deal on over there they got a little they got a hold of a situation over there too but I'm sure he'll get some playing time with them but this this trade like for Eric decosta to be able to work this trade like you can commend him for a lot of other trades you can commend him for what he gave up to acquire something great he gave up a backup linebacker in a fifth not a first not a second not a third not a fourth he gave up a backup linebacker in | 512 |
ao3 | They all stare at us expectantly, and Bella grabs my hand again.
"So what's new, guys?" Bella asks like a true smart ass.
"Why don't you start, Edward." The Chief says, giving me a look that will surely kill me if I stare at him any longer.
"Well, Bella and I got to talking at the Rehearsal Dinner for Rose and Emmett's-"
"Ugh! At my dinner! Really, Edward?" Rosalie interrupts and looks like she is going to jump on me at anytime. "What the hell?"
"Slow down Rose. He said we talked at the dinner. After the dinner was over and I went home, Edward came over to tell me that my parents were staying here because they had a little too much to drink." Bella gives her mother a pointed look. "And then, well, one thing lead to another..."
"IN MY HOUSE!" The Chief is really pissed now. "You went into my home and just took it upon yourself to impregnate my daughter?"
"Sir, with all due respect-"
"Oh, now he has respect," he says, looking at his wife.
"Okay, hold on a minute." My father finally speaks up. "I know this is unexpected, but why are we upset? They are both adults and a baby is a miracle. How far along are you, Bella?" he asks smiling at us.
"Almost five months, Dr. Cullen," she answers, returning his smile.
"Please, call me Carlisle. You are carrying my first grandchild after all."
I look at my mother and see that her eyes are shining with tears, but she is smiling as well. She stands and pulls Bella into a tight hug before turning her attention to me. I relax in my mother's arms when I hear her whisper her congratulations to Bella.
"OH MY GOD... I'M GOING TO BE AN UNCLE!" Emmett shouts.
Everyone laughs at him and seems to relax a bit. They take their turns hugging Bella and shaking my hand. Mrs. Swan cradles Bella's face and kisses both of her cheeks.
"My baby is having a baby." Tears fall softly down her face. Bella reaches out to brush them away.
"Don't cry, Mama. I'm so happy," Bella says.
"So, Bells. Are you moving home? I mean I'm going to need to have the little guy here so that I can teach him to fish and take him to see baseball games." Her dad finally seems to be coming around.
"Her." Bella smiles at him. "It's a girl, Daddy."
Another round of gasps and squeals erupts and the women pull Bella into a massive group hug.
"A GIRL!" my mom shouts, actually jumping up and down.
After all of the squealing and hugging die down, we sit and actually have dinner. Emmett grins when we sing _Happy Birthday_ to him. I catch a few glares from her dad, but other than that it goes much better than I expected it to. Once everyone calms down, our families seem to just accept Bella and I as a couple. They also seem to accept our news for what it is, and | 512 |
Pile-CC | market cap. It plans to have 100 towers by the first quarter of 2018, and up to 300 towers by the same period of 2019. That would be 22x its current market cap. For an early-in investor, it could mean a multi-bagger in less than three years.
#4 A Visionary Dream Team of Telco Experts Tower One's CEO is Alex Ochoa, whose team has previously pumped $150 million into the tower industry and created tens of billions in shareholder value. It's a great meeting of minds that includes advisor Rolland Bopp, a former CEO of giant T-Mobile and Germany's Deutsche Telekom AG. What early-in investors will appreciate most is that 60 percent of shares are closely held by management, so it's all about maintaining and building shareholder value, and higher share prices. We're looking at minimal dilution here, and with supply locked up, demand is bound to set prices high.
#5. Easiest Cash on the Planet The infrastructure for a cell tower can take as little as 30 days to build. A mere 15 days later, the 'landlord' is collecting rent-on a beautiful 10-20-year contract. It's as easy as that. You can see the trail of revenue far down the road, and it's not a road paved with the risky potholes that drag down the wireless sector and its fierce competition. Rent is pretty nice. On average, a single tower can collect $1,000 per month for a single tenant. Additional operators (up to four) are pure profit. In this $7.56-billion market, the only small-cap entry point is sitting on a wireless gold mine, and it's only got 3 competitors on a playing field that is traditionally one of the most commercially bloody there is. The next wireless revolution is undoubtedly unfolding in South America-and the U.S. giants would agree, but the place to be is way up in the air looking down on the match and just collecting cash. Cell towers are the backbone of the wireless revolution, and this small-cap is still off the radar, while it moves in fast on South America's need for over half a million cell towers.
Honorable Mentions in the wireless revolution:
- Frontier Communications (NYSE: FTR): Three things make for good catalysts for this giant: 1) it's paying down near-term debts with a secured debt issue of $1.5 billion; 2) it's moving to focus more closely on customer service and marketing, to which end it's hired two new promising executives; 3) It's set to get very serious about expanding revenue.
- Verizon (NYSE: VZ): Verizon has long been a 'safety bet' in this sector, but keep in mind that those days may be closing because the competition (particularly Sprint, our next pick) is heating up. But look further ahead here because Verizon's 5G help promises great growth-depending on how long it takes to get up and running widely. Right now, it's a bet on who gets to 5G fastest.
- Sprint (NYSE: S): Sprint is one of the fastest-moving on this highly competitive playing field. Right now, it's challenging Verizon pretty well. Verizon is facing | 512 |
reddit | of sleep after hitting it at the gym is amazing. A huge factor, excuse really, in my drinking was, "do I have enough to help me fall asleep (read "passout")?" or "I can't sleep without this!" But really, last night I slept harder than I have in months and you know what? I woke up this morning refreshed and energized and ready to not drink today as opposed to ashamed and dehydrated and wondering if there is anything left around here so I can start my day without shaking. Today will be a great day! In addition, the past couple of days that I have been actively participating in this sub have been awesome. I am very grateful to all of you.
The great thing about this place is you get a lot of feedback about what is working for all of us within the swell of the bell curve. Don't be afraid of starting a good barbell routine and putting on a couple of lbs of fat. You'll learn so much and it's easy to drop the weight if you need to.
All I have to say is there's nothing like being the underdog And the opinion I shared was that less hp is better. Again nothing feels better than opening a can of whoop ass on a guy with more power or a more expensive car. You clearly don't understand how much skill plays into how fast you can make your car go. My apologies if my explanation previously made it seem like I was upset, I'm just trying to explain it fully, nothing wrong with that right?
I'm thinking a lot more thinker powers, think Contessa and Tattletale. Tinkers in urban centers, strongman types especially in rural areas, increased durability in the slums. I think that the global political atmosphere would have placed them in power after ww2, especially if they kept quiet about thier powers. Ww1 would see nearly every person who could trigger to do so in the trenches, manifesting blaster or mover with some shaker powers.
New Sheoth (Oblivion): Fun city with the two conflicting halves, Mania is beautiful and Dementia is cool with its darker motifs. Ecruteak City (Pokemon): Its a sleepier town close to a larger megacenter, has an interesting history and lovely architecture, and it's close to the pokeatholon, battle frontier, and national park. Soundtrack is nice too. Mineral Town (Harvest Moon): Smallish town with a great nature view and memorable population.
I started masturbating at the age of 7 and porn at the age of 13. I am 20 now and just completely sexual screwed up. I feel like I started so young that maybe it won't be as quick to fix as 90 or a little more days... what if it takes years or never... Theres no way I wouldn't lose motivation if I went that long knowing nothing may change...
After reading all of your comments I’ve decided to talk to my DM about this whole situation. I’m going to head to the next session, and try to explain to the party that I’m | 512 |
Pile-CC | rock processing equipment including ... unloaders, stackers, mixing, blending, washing, screens and crushers. ... new, used and reconditioned machinery is available for sale, rent or lease/purchase.
The advantages of renting your rock crusher with Warren include flexible rental terms, convenient rental store locations in Oklahoma and West Texas, fast delivery to your job site, available technical support and emergency service, and purchasing options that include rent-to-own and leasing.
song – Mississippi Business Journalhttp://msbusiness.com
Mississippi Business NewsThu, 17 Aug 2017 19:56:11 +0000en-UShourly1https://wordpress.org/?v=4.7.545828637Local officials hoping for state help in funding Wynette museumhttp://msbusiness.com/2013/05/local-officials-hoping-for-state-help-in-funding-wynette-museum/
http://msbusiness.com/2013/05/local-officials-hoping-for-state-help-in-funding-wynette-museum/#respondMon, 06 May 2013 13:29:04 +0000http://msbusiness.com/?p=74348TREMONT — Officials in northeast Mississippi are hoping for some money from the state to help to finance construction of the Tammy Wynette Museum in Tremont. Wynette, a country music legend who died in 1998, is a native of the Tremont area in Itawamba County. She was married for six years to George Jones, who ...
]]>http://msbusiness.com/2013/05/local-officials-hoping-for-state-help-in-funding-wynette-museum/feed/074348Rock/R&B songwriter Jackson dies at home of cancerhttp://msbusiness.com/2013/04/rockrb-songwriter-jackson-dies-at-home-of-cancer/
http://msbusiness.com/2013/04/rockrb-songwriter-jackson-dies-at-home-of-cancer/#respondMon, 15 Apr 2013 12:10:10 +0000http://msbusiness.com/?p=73284RIDGELAND — Songwriter George Jackson, co-author of “Old Time Rock and Roll” and hundreds of other soul, rock and rhythm and blues tunes, has died. He was 68. Jackson died yesterday morning at his home in Ridgeland, said Thomas Couch Sr., board chairman of Malaco Records. Jackson had been sick with cancer for about a ...
Advertisement
Bill Black: The Banks Have Blood On Their Hands
We invited Bill Black to return to explain whether the level of systemic risk due to fraud in our financial markets has improved or worsened since the dire situation he painted for us in early 2012. Sadly, it looks like abuse by the big players has only flourished since then.
In the U.S., our regulators have publicly embraced a “too big to prosecute” doctrine. We are restraining, underfunding, and dismantling regulatory oversight in the interest of short-term stability for the status quo. Which, as a criminologist, Black knows with certainty creates an environment where bad actors will act in their self-interest with assumed (and likely real, at this point) impunity.
If you can steal with impunity, as soon as you devastate regulation, you devastate the ability to prosecute. And as soon as that happens, in our jargon, in criminology, you make it a criminogenic environment. It just means an environment where the incentives are so perverse that they are going to produce widespread crime. In this context, it is going to be widespread accounting control fraud. And we see how few ethical restraints remain in the most elite banks.
You are looking at an underlying economic dynamic where fraud is a sure thing that will make people fabulously wealthy and where you select by your hiring, by your promotion, and by your firing for the ethically worst people at these firms that are committing the frauds. And so you have one of the largest banks in the world, HSBC, being the key ally to the most violent Mexican drug cartel, where they actually did so much business together that the drug cartel designed special boxes to put the cash in that they were | 512 |
gmane | the model using the state of the model at the end of the previous run (unless you decided to reset the model). Using this snapshot, you will get the same behaviour, except that OpenCOR will not automatically clear the plotting area (note that you can still clear it yourself, if needed).
This feature means that you can also run a model and then rerun it with different initial conditions (as before), this without having the previous runs cleared (unlike before). For example, consider the Noble 1962 model. We ran it three times using different values for the maximum sodium conductance (400, 350 and then 300 mS/cm2):
As you might expect, support for multiple runs has also been added to our CSV and BioSignalML exports (note that it still works if you use different output intervals for your runs).
However, when it comes to SED-ML, we don’t currently serialise the fact that a simulation may consist of several runs. Indeed, this would first require some work on other aspects of our SED-ML support, something that we are going to do, but not just now.
Indeed, OpenCOR 0.5 was released more than 15 months ago, which means that OpenCOR 0.6 is well overdue. So, consider this snapshot as a beta version of OpenCOR 0.6. In other words, have a (very) serious play with it and let us know of any issue that you come across.
Best regards, Alan.
Hi!
I'm wondering about the topic of my gsoc project.
I'm interested in these areas:
- improving cabal (more sophisticated dependency, multi version, compiler
support, etc)
This could be useful from practical view.
- Another idea is to improve GHC's new LLVM backend.
(eg: support cross module optimization, integrate with llvm-gcc or clang
to support full project link time optimization, even using FFI)
I'm really keen on compiler technology, and i know llvm for 3 years. (and
i'm familiar with clang too)
I also have a perspective to GHC's compile stages and intermediate
languages.
But I've seen that other people are interested in LLVM backend gsoc
project too.
- Another LLVM related idea is to create a framework to support writing llvm
passes in haskell, this should be based on existing llvm haskell binding.
- I'm also interested in computer graphics. While this kind of project could
look really good, the community could not benefit from it.
eg: *write a pure FRP based 3D game, withs existing haskell libs
*improve lambdacube 3D engine, etc
IMO the big thing will come in these area when DPH and GPGPU will be stable
and supported.
What do you think about these?
Cheers,
Csaba Hruska
Is it possible to place track markers that will be reflected in a cue sheet within a long FLAC file?
I have a label who want to offer FLAC downloads of complete albums - but there have to be track points designated within the FLAC file
How can I do this please?
Many Thanks
Hi all,
I am doing the umbrella sampling of a ligand pathway (Gromacs4.0.4).Now i
want to plot the PMF using WHAM | 512 |
StackExchange | &&\
mv /tmp/project/* /var/www/html/ && \
mv /tmp/project/.* /var/www/html/ | : &&\
php artisan config:clear &&\
php artisan cache:clear ; \
fi &&\
echo "Try connect to db and set up schema..." && \
php artisan migrate --seed --force &&\
/start.sh
My project/config/server-nginx.conf looks like that:
server {
listen 80; ## listen for ipv4; this line is default and implied
listen [::]:80 default ipv6only=on; ## listen for ipv6
root /var/www/html/public;
index index.php index.html index.htm;
server_name _;
# Add stdout logging
error_log /dev/stdout info;
access_log /dev/stdout;
location / {
try_files $uri $uri/ /index.php?$query_string;
}
location ~ \.php$ {
try_files $uri /index.php =404;
fastcgi_split_path_info ^(.+\.php)(/.+)$;
fastcgi_pass unix:/var/run/php-fpm.sock;
fastcgi_index index.php;
fastcgi_param SCRIPT_FILENAME $document_root$fastcgi_script_name;
fastcgi_param SCRIPT_NAME $fastcgi_script_name;
include fastcgi_params;
...
}
}
The problem is that everything works fine in my macOs and ubuntu, however my client which use Docker Claud and DigitalOcean have following problem after container run (so building step is fine, but after container run it is killed by docker - so in CMD dockerfile part):
Fatal error: Uncaught Error: Class 'Illuminate\Foundation\Application' not found in /var/www/html/vendor/autoload.php:14
Stack trace:
#0 /var/www/html/artisan(18): require()
A:
So the problem sometimes (! - on some hosts - why?) appear when we use composer ... in some directory (with php project) and then we move/rename that directory (by mv ... bash command in CMD dockerfile part) - so if we do it (in some hosts) then file autoload.php (generated by composer) will have not proper paths to php classes.
However in this case we use dir tmp/project (and call composer inside) and then move it to /var/www/html, because we cannot directly work in /var/www/html because in richarvey/nginx-php-fpm is VOLUME directive so if we create files in this directory - they will 'disappear' - so we use /tmp dir.
Additional there is also problem when we want to link by ln /var/www/html to /tmp/project and use chown -R nginx:nginx /tmp/project because it will go into infinit loop and never ends... :( (why?).
SOLUTION
Is to change root dir in project/config/server-nginx.conf to:
root /var/www/app/public;
Then change workdir in dockerfile to:
WORKDIR /var/www/app
And in dockerfile CMD section add
chown -R nginx:nginx /var/www/app/storage
To give write access to laravel only to storage directory (in which laravel save work data) (if we use chown -R nginx:nginx /var/www/app/storage it will newer 'ends' (go into infinit loop) :( )
In this way we avoid move composer compiled directory and everything works grate on all hosts :)
Q:
difference between linq query on list and linq query in class method
I have a List of custom objects and I am querying them using the following method:
private double GetSurveyorEarliestAttendenceMIPercentage(IList<InsuranceJobDTO> jobs, int workingDays, int year, int month)
{
var kpi = from j in jobs
where j.EarliestSurveyDateOffered.HasValue &&
j.EarliestSurveyDateOffered.Value.Year == year &&
j.EarliestSurveyDateOffered.Value.Month == month &&
(j.InstructionToEarliestSurveyDateOffered.Value <= workingDays ||
!j.IsPolicyHolderSurveyDatePreference.Value)
select j;
double totalCount = kpi.Count();
double withinSLACount = kpi.Count(x => x.InstructionToEarliestSurveyDateOffered.Value <= workingDays);
return totalCount > 0 ? withinSLACount / totalCount : 0;
}
I decided a cleaner way to produce the same result might be to add a method to the custom object:
public | 512 |
gmane |
complaint. He also pointed out that false memory syndrome is not recognized in the
medical community....
At the same time, the RCMP informed Robert the investigation into his
complaint about being sexually abused by the man in the early 1980s had
concluded without corroborating evidence to support charges....
Looking back, Robert said the man probably wanted him to go along as a
cover, in case he was seen, so that he could say he was taking him to his
mother and father.
This time, Robert noted, the man didn’t attempt to drive up the dirt road
but stopped on the side of Maddox Cove Road and walked up to where the body
was.
“He was looking for his jacket — he didn’t have his jacket on — and he
had gotten the booster cables,” Robert said. “So while I was left in the
car, there was a car that drove by. He told me that if anyone stops, (to say)
he left his new chainsaw up in the woods.”
As outlined in previous media reports, a Shea Heights couple driving north
on Maddox Cove Road that night — between midnight and 1 a.m. — noticed a
car matching the suspect vehicle parked on the side of the road. They said
a passenger side door of the car was open and the dome light was
illuminated. They also saw a man standing near the woods. They reported he had no
jacket, despite the cold....
They then drove back to the man’s house, where Robert held a work light
while the man washed the trunk of the car using cleaning supplies.
“He cleaned out the trunk and then he got me in the backseat of the car
and had another go (sexual assault) at me,” Robert said. “And then he
brought me home.”....
The man Robert describes had been a close friend of his parents in the
early 1980s.
In the 1990s, he was convicted of sexually abusing children and served
time in prison.
The time period of those offences is the same time frame Robert alleges he
was abused by the man and Dana’s murder occurred....
http://www.thetelegram.com/News/Local/2014-03-15/article-3650234/Man-claims-
he-witnessed-Dana-Bradley-murder/1
http://www.thetelegram.com/News/Local/2014-03-15/article-3650234/Man-claims-
he-witnessed-Dana-Bradley-murder/2
http://goo.gl/uBq4Ae
‘The guy is the real thing’
Tara Bradbury and Glen Whiffen
Published on March 17, 2014
Doctor says man’s story of Dana Bradley murder shouldn’t be written off
as false memory syndrome
Part 2 in a three-part series
Good memories from childhood are often recalled fondly. Bad memories, not
so much. But what if the memories are so terrible, so horrible, it’s
unbearable to live with them?....
He says he saw her murderer sexually assault and kill her by hitting her
in the head with a tire iron and that he was there, crying, when the killer
laid her out in burial fashion among the trees off an old dirt road just
outside the city.
Robert’s relates these memories in spine-tingling detail — how he
screamed and begged the man, a close friend of his family, not to leave the body
in the winter cold overnight, and of being forced to hold | 512 |
gmane | services honchoes
Despite all the hoopla surrounding executive compensation, the paychecks to many top executives in asset management business increased an average of 10% to 15% in 2003. The article states that the rise in compensation is a result of the improved market and also a "clear indication of the industry's apathy toward embracing new standards of good corporate government." And while compensation packages are impressive, "they are nothing compared with increases seen among big Wall Street companies, particularly those that wheel and deal in investment banking."
Lawsuit May Dampen Shareholder Activism: 'Sweatshop comments imperil social investor'
A defamation lawsuit has been filed by Cintas Corp. against the parent company of Walden Asset Management (Boston Trust and Investment Management Co) and Timothy Smith, a Walden VP. Walden manages several social funds. In the suit, Cintas accuses Walden and Smith of falsely accusing the uniform supplier at its October annual shareholders meeting of supporting sweatshops. At the meeting, Smith introduced "a resolution asking Cintas to asses the effectiveness of its vendor code of conduct, and the compliance of offshore factories and suppliers. Accoding to the suit, Smith identified a Haitian apparel company he called 'a poster child for sweatshops as a major supplier to Cintas." Until now companies have refrained from using the courts to go after shareholders who bring up issues with which management may disagree. Some fear that the suit may lead to other shareholders less willing to challenge company management, others think it a frivolous suit that won't change anything.
Jayson Funke
Here is the situation: I have multiple network addresses on my box and
4DIC IT_MyTCPAddress gives me one of those addresses.
Fine, BUT if I issue an HTTP (or SOAP) request from 4D, the IP address
sent out is not the same.
Say I have a local network address: 10.0.1.202, and I'm vpned into my
office, which gives me a second IP: 192.168.1.123.
IT_MyTCPAddress gives me 10.0.1.202, but any HTTP requests sent from
4D indicate the originator IP as 192.168.1.123. This is not going to
the outside world, a local HTTP request to a local webserver running
on the same machine (another 4D app).
Is there a way to be consistent there. To ensure that whatever IP 4D
sends out on HTTP requests is the same value returned by
IT_MyTCPAddress, even when multiple network addresses are present? Is
there a workaround or should I post a ticket to bugs.4d.fr?
TIA
julio
I've updated the wrapper at:
http://www.itwriting.com/sqlitesimple.php
for Sqlite 3.1.2. Sqlite 3.1 changes the way column names are returned,
so I've added a call to set the Pragma full_column_names on. I've also
amended the field type detection to use the actual type when the
declared type is not available, and added the utility function
TableExists.
The test application now includes a demonstration of one way to load,
save and display images in a Sqlite 3 database.
Tim
Hi,
I use RT2 and needs the CanonicalizeAddress function.
I saw after digging through google and MailingLists that it's no more
available with RT3.
Could someone point me to an explaination of | 512 |
reddit | behavior to display. Being possessive, confining, and overwhelming can be signs that he is abusive. He doesn't sound like he is physically abusive, but he seems extremely passive in that he would threaten doing something to himself to keep you bound down. Sorry if I'm overstepping my boundaries in saying that, but do be extremely cautious in handling the situation. Good luck:) Hope everything goes ok
You can look at the xp on his bar, at the start it says ~4.5 million, and at the end it's at 11.8 million. Which means he has gained 7.3 million xp over the course of roughly 4 minutes. 4 minutes is 1/15th of an hour, so 15*7.3m = 109,3 million xp per hour.
Yeah, that's exactly it. One doctors appointment you're told you have depression, then it's anxiety, then maybe you had a psychotic break and need a short term antipsychotic. Fixed... right? Nope. Keep going on like that. This stuff is SO hard to pin because your symptoms change and disappear and come back and that's why this whole "perfectly functional but pretend wife" crap is exactly that - crap. Completely bemused by this even though I know I shouldn't. People lie about having mental illnesses, it's just a thing that shitheads do. Guess it's one of those things that is so infuriating it's impossible to accept. On a nicer note, I hope things do improve for you. I know what it's like to hear that constantly and it becomes easy to pass off as courtesy, but seriously, I hope the shit gets less shitty and the good gets better. Keep on keeping on, as they say.
The way I like to eat bananas is sometimes put into suggestive light by others while it doesn't actually mean anything. It's pretty disrespectful, and I wish nobody cared. I suppose it's hard to avoid seeing certain things in certain ways, but there's no reason to point it out and make others uncomfortable. I guess it's cool when everyone is in on the joke.
I don't believe it's unique, but I believe the response is troubling and I'm trying to understand the logic that people are using to take it there. The president literally just said that players who kneel shouldn't be allowed to play and shouldn't be allowed in the country. How can Americans say that or agree with that sentiment when it contradicts everything this country is supposed to stand for?
The link is to the FBI statistics that you say you are going from. Post the numbers if you are going to reference them. Violent crime has clearly not been going down since the '60s if it spiked in the '90s. It peaked in the '90s, actually '94, and has been falling since. 2012 had about the same violent crime rate as '72. If you are going to say you are going by FBI statistics at least look them up. I posted them for you and you didn't even look at them. You are not helping our cause by pretending to know the numbers. Every time someone | 512 |
realnews | Levitt wanted to end the practice of accounting firms offering both auditing services and also consulting services to big companies, but Pitt successfully fought that off. Pitt favored, and testified in favor of, the 1995 Private Securities Litigation Reform Act, which reduced executives' potential risk in fraud cases; Goldschmid went the other way, including backing President Bill Clinton's futile veto of the bill.
But now we're about to get another Harvey on the commission, Harvey Goldschmid, whom many expect to serve as a Democratic foil to Pitt. Goldschmid is also a former SEC general counsel (from 1998 to 1999), has his own little agenda, and comes down on the opposite side of many issues with Pitt.
Etc.
I don't expect to see knock-down, drag-out battles from the dais between these two; that's not their style. But I do expect we'll eventually learn of immense backroom battles between them, trying to reach compromises on what comes up in public sessions and what comes to a vote. These compromises inevitably will shorten both Pitt's agenda and his leash -- and he won't like that.
Just could be that the upcoming Two Harveys wars at the SEC will be the best show in Washington.
Anytime public officials get into jihads over that magical word "reform," we have to remember how broadly, and sometimes how differently, it is defined.
One of my favorite memories of the Texas Legislature -- a comedy club, which convenes every other year across town from my office in Austin -- was the time two decades ago when "reform" was the theme of a wildly acrimonious session. Both sides, of course, claimed they were with the angels in their definitions of the word; needless to say, their definitions were very different.
The battle came to a peak one day when the member of the House holding down the microphone drew his many listeners' attention to the balcony surrounding the House floor, the place tourists usually sit to watch the show.
On his cue, in the balcony a squad of seven young women from a Texas junior college stood up, in their short-skirts-and-shiny-tops cheerleader outfits, turned their backs to the assembled legislators and flipped up the back of their skirts.
A large capital letter was neatly attached to each woman's derriere; from left to right, they spelled out R-E-E-F-O-R-M.
Like the making of sausage, the making of public policy is not always a pretty thing to watch. But sometimes it can befunny. Your cue, Chairman Pitt.
As previously announced, Bob Dylan returns to these shores in April for his first shows since the release of Modern Times earlier this year.
To celebrate the big man's return to the UK.
We have a pair of tickets for London and a pair of tickets for Newcastle to give away.
CLICK HERE TO ENTER
A further Wembley Arena show has been added due to high demand. Tickets are available from the outlets detailed below.
Buy online from: www.livenation.co.uk . 24 hr c/c hotline: 0870 400 0688. Ticket prices are £37.50 and £32.50 (subject to booking fee). | 512 |
StackExchange |
SQL remove duplicated rows with different values but keep and show them in single row
There are 8000 rows including students name, course and grades. There are 4 courses in total so it means for each student there is maximum 4 rows. So I would like to create a table containing distinct student name and show different grades in the same row as below:
Many thanks.
PS. I noticed from your initial responses that it is not an easy task. So can I have table showing only students with more than one grade as I am not interested in students with only one grade? like this:
A:
You can do conditional aggregation :
select name,
max(case when seq = 1 then Course end) as Course1,
max(case when seq = 1 then Grade end) as Course1Grade,
max(case when seq = 2 then Course end) as Course2,
max(case when seq = 2 then Grade end) as Course2Grade,
. . .
from (select *, row_number() over (partition by name order by course) as seq
from table
) t
group by name;
A:
This will surely work just need to add another join as of another course
SELECT n.name, N.course, N.grade, E.course, E.grade, I.course, I.grade
FROM (
SELECT DISTICT name
FROM STUDENT
) N
LEFT JOIN (
SELECT name, course, grade
WHERE course = MATH
) M
ON (N.name = M.name)
LEFT JOIN (
SELECT name, course, grade
WHERE course = ENGLISH
) E
ON (N.name = E.name)
LEFT JOIN (
SELECT name, course, grade
WHERE course = IT
) I
ON (N.name = I.name)
hope this helps..
Q:
Add a code branch to a single workspace in Hudson
Does anyone know how to add a subversion branch to hudson and have it build the whole branch? It seems that I would have to make a workspace for each branch/app. So could I just add the branch to a workspace and have hudson build each directory? Hope this isnt a stupid question.
This is a java enviroment so mostly maven and ant builds. Could I make a mass pom.xml file to have it build each directory?
A:
Some of the projects that I have are just a collection of small projects (libraries). To build them I created a simple pom.xml that contained every subfolder as a module. Works fine for me.
Alternatively, you can use the M2 Extra Steps Plugin to call all the poms separately and still have the comfort of a maven job. More straight forward would be a freestyle project, here you can define all other targets.
All have the disadvantage that you need to configure the projects explicitly. If you don't wanna do that, write a shell script that parses the directory tree and calls maven with the pom files found.
Q:
How to calculate Pixel wise accuracy in pytorch?
My code looks like the following and I get accuracy from 0 to 9000, which means its clearly not working.
optimizer.zero_grad()
outputs = net(inputs)
loss = criterion(outputs, labels)
loss.backward()
optimizer.step()
running_loss += loss.item()
predicted = outputs.data
predicted = predicted.to('cpu')
predicted_img = predicted.numpy() | 512 |
reddit | hipster stage (before it comes too cool) - just for record i am not a hipster with that said i highly highly recommend going to voodoo
I think Ooze is one of the more underrated tech cards right now. I'm running it in my Paladin (currently at Rank 1) with great success. It helps a ton in the mirror, hunter, and control warrior. It's more of an annoyance vs. rogue (since they usually burn their bigger daggers), but nice nonetheless when you can burn a turn 2 dagger or the poisoned charge they're saving for Blade Flurry. I run Harrison as well, but I tend to get a ton of value from having double weapon removal -- people never see it coming. What to sub out to make room for Ooze? I used to run 2x Zombie Chow, but found it was too often a dead draw late in the game. Ooze is a great draw at any time vs. classes with weapons and worst case, is a decent 2 drop vs. aggressive decks like mech mage. I currently run 1x Chow and 1x Ooze, with 60%+ win rate against everything but Rogue. Thoughts on Ooze in the current meta?
Hey all, So the plan is to save up for retirement, but I feel like I'm just not saving enough and was wondering about my budget and if any of you have advice. We are a home of three (though that might be growing soon as we are exploring adoption.) We live near the GTA if that matters. Anyways, here are the numbers: Income monthly $6134.88 Expenses: Auto payment $360.11 Bills (includes mortgage) $2103.39 Insurance $308.46 (Home, 2 cars, and rental property) RESP: $178 Apartment: $ 172.06 Variable: Automotive (repair and gas) $369.63 (last six months) Healthcare: $150 (massage and physiotherapy on top of what is covered.) Home maintenance $180 -For things such as replacing the roof, windows, floors, making a garden etc. Pets: $20 Vacation $250 Groceries: $1045.30 (240/week and this covers personal care stuff like deodorant, shampoo, pet food, and all “extras” like Kid’s field trips and special days.) His/Her allowance: $195 Date Nights: $80 Family Time: $80 Kid allowance: $65 Clothing: $50 Gaming: $32 Alcohol: $15 Gifts: $30 Other: $100 Total: $5783.95 $350.93 doesn't seem like anything with the take home income.
That was my initial thought too. But having mulled over it, could he not be her equal? As in they stand side-by-side as opposed to him being her right-hand man? The film didn't seem to suggest that this was completely planned out by Talia, it could well have been a joint effort.
See a doctor. First a medical doctor so you know you didn’t cause any scarring or damage because be real; protect yourself and check up on yourself. Second, talk to a therapist. If you’re going that far as to possibly harm yourself and lie to someone because you want a baby? That’s beyond words. Please seek someone out so you can prevent any damage from getting worse or happening more down the line, and it’ll help you | 512 |
ao3 | they will find out, and when they do, you will be all alone again.”
_“You’re never alone, sillystring”_ , retaliates a voice in his head. It is strangely familiar although Taako cannot place it, and it grounds him back to the moment, back to his body, back to his senses.
“No”, Taako says, forcefully, and turns to look Sazed square in the face.
“I am not alone, and the boner squad targets people _just like you_ , and you know what? We kill them. We. Kill. _You_.”
Sazed leans back, clearly sizing up both him and his words.
“Fine”, he finally says, letting his grip loosen. Taako pulls his hands away from his.
Oscar swears he didn’t get jealous when Neymar and Gabriel hugged, and when Gabriel decided to watch the film with them. He didn’t feel bad because he hadn't found his soulmate yet. Let’s pretend his face wasn't looking like he was in a funeral when he gave his ID card to the theater guy.
“Excuse me, your name is really Oscar?”
Oscar looked up and found his blue eyes staring at him. The guy had his ID card, wasn’t him seeing his name and his picture?
“I’m sorry, I just saw your wrist”, he said then.
Oscar reacted instinctively, scratching the four letters on his own wrist.
“My name is Eden. Hazard. I mean, Eden Hazard. Yeah.”
Oscar froze.
“Oh my God”, he was thinking.
He found him. Actually, he had already found him before. Had already touched his hand. He was the blue-eyed guy who collected the 3D glasses. His Eden was the son of the theater owner. Which also makes him the owner.
“Hey, Oscar, are you okay?”
Oscar smiled to him. His soulmate.
“Can I watch the movie with you? The session is on the house”.
In the end, everything was right.
**Author's Note:**
> Once again, sorry for any mistakes, and thank you for reading!! x
1. It Starts
**Author's Note:**
> So this timeline is not going to follow the show, but quick rundown:
> Jim is back on the force, Harvey is in charge, Mario? who that?
Jim sat on the floor of the examiners room. Propped up against the cabinets he smiled constantly up at the woman working feverishly at her desk.
Lee looked through the information if her newest patient. How often must she remind the GCPD she was not their resident doctor, but Jim was a special case. The documents did not reveal anything the 9th time that they didn't the first. The documents showed that he was a perfectly healthy male for his age, except he wasn't. Of course at a glance he was the same Jim Gordon. The only effects so far of whatever had happened on the last case could only be seen as the drool escaping from Jim's smiling lips.
“Jim! Jim!” GCPD police captain, Harvey Bullock, shouted through the halls of the police station. The heavy footsteps of his jog heard even from the forensics room. Opening the door Harvey walked in slowly surveying his partner. | 512 |
realnews | feedback from its readers. According to Ms. Burgess, Seventeen receives in excess of 6,000 letters per month.
"We research every issue with our readers, so we are continually in touch with what they want in the magazine," she adds.
Ms. Grossman describes the magazine as "fun, funny and nurturing. .*.*. The magic of Seventeen is that it's more in-depth than it's been in the past, without being condescending."
Michael McCadden, VP-marketing for The Gap, says both Seventeen and Gruner & Jahr USA Publishing's YM are strong books for his products, but that they differ psychographically.
MIDDLE-OF-THE-ROAD READER
"The Seventeen reader, I think, is a bit closer to center," says Mr. McCadden. "YM is a little edgier."
The idea that Seventeen serves a closer-to-center target seems to support its strong performance. Other industry and agency observers familiar with the titles made similar comparisons be-tween the two
By the end of last year, Sassy checked out, leaving Seventeen and YM to cover the market. Teen, on the other hand, remains a more general-interest title and not as focused on beauty, fashion and cosmetics.
With Seventeen addressing the multitudes and YM a continued strong player (its circulation grew 1.8% last year to more than 1.9 million), the teen market is stronger than ever.
Ms. Appel highlights Seventeen's "relevancy" to its target market and its relationship with its readers as the biggest draws of the magazine.
For client Procter & Gamble Co.'s cosmetics lines, the amount of editorial devoted to beauty is also essential.
"They are a very important resource to us, and our partnership with them through the years has never wavered," says Ms. Appel.
NEAR TOP OF LIST
Though she could not divulge a dollar figure or number of ad pages placed in the magazine in 1996, she maintains Seventeen will always be near the top of her list.
Other advertisers appear to feel the same way. Last year Maybelline, a unit of L'Oreal's Cosmair, did roughly $2 million in business with Seventeen, and Benckiser Group's Coty did roughly 69 pages of advertising with the monthly, according to Ms. Burgess.
"Beauty and fashion rule at Seventeen," quips Ms. Burgess.
While the bulk of the title's pages come from the fashion/
beauty category, the magazine last year got Dean Witter, Discover & Co.'s Discover Card and Campbell Soup Co. In 1997, Ford Motor Co. will make its first appearance.
Also helping promote the magazine is Seventeen's marketing department, with 22 people on board.
"We do all our own events, in roughly 110 markets a year, ranging from campuses to malls to drug stores," says Ms. Burgess. "It's another way to access this market."
The coming year is shaping up to be better than last year, according to Ms. Burgess.
AD PAGES UP 9%
Ad pages in the first quarter of the title's current fiscal year, or February through April, are already about 9% ahead of the same period last year.
Though the magazine has never sold premiums with the Seventeen name on it, executives say they are now investigating such opportunities. Though subscriptions are the | 512 |
reddit | at Mirage gets old fast. I stayed at both respectively over the past year and I keep going back to Ballys on location alone - plus the price is usually much cheaper. Can't speak to the pool. Might be better at Mirage (I assume).
I'm getting my lionhead bun back from my mom next weekend. I graduated college and was in between apartments for a long time, so she took care of her. I know that Sassafras hasn't had her nails trimmed in a very long time. I'm worried that the nerves have grown with her nails. How do I go about trimming them when she gets home? Or should I just bring her to the vet to do it? Any suggestions would be fantastic! Thank you! Edit: Would filing them work any better than clipping? It seems less painful and dangerous to me.
More simulated presence in the galaxy. Ship traffic going in and out of stations. High volume everyday things in the way to make it seem more alive. Dont have to do it everywhere. Infact its better when used sparingly. Maybe capital city type stations and areas that makes being out in the deep space by yourself more lonely. I would love love love some in game radio stations staffed by volunteers that is scripted. Give some bored people a way to write themselves into the game. Let anyone apply to do a bit whether its a fake commercial or a radio show or a news update. Put the script out there in advanced and the people who do it the best production wise get their bits played on the radio station available to all players. I dont imagine it would be hard to do. I'm sure someone can do it on their own if they're dedicated enough and got enough support around it but it wouldnt be as fun if it wasnt done with a hand from the gaming studio. Sorry for the random idea but your question made my brain go looking for what would one of my dream features be. I imagine it almost like how Matrix Online handled their live story*, mixed with how Howard Stern handles his user submitted songs. Have some free music play on the stations to fill a lot of air. I'm sure some people would be willing to offer their own music for free advertising for themselves. Earn some ad revenue if you want by throwing a few sparingly used and rare actual paid for content. If you go that route you have to go the rarely used route. Enough to pay for itself and a little revenue to other game development and profits but not enough to really annoy. [*Wiki link to Matrix Online reference. Best link I could find after a not very intensive search.](https://en.wikipedia.org/wiki/The_Matrix_Online#LESIG_program)*
My sister was born the same year as you! My High School years were all about Grunge and Gangster Rap. People used to complain about how Pop music had become and I always thought it was way more awesome to have her listening to | 512 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.