text
stringlengths
159
6.53k
true_labels
listlengths
4
71
all_labels
listlengths
8
96
In order to understand how the USA Model works, you first need to have a basic understanding of the economic and political systems that drive it Know About Lorraine Braccio The United States has a mixed economy, one that features characteristics of both capitalism and socialism. This type of system protects some private property and allows a degree of free capital use, but also allows governments to intervene for the public good. The economy is the system that produces, sells, and distributes goods and services. It includes production, employment, investment, savings, health, money, the banking system, government policies on taxation and spending, international trade, industrial organization and regulation, and urbanization. There are many types of economies, including market, command, traditional, and mixed. Each has its own ideals and systems of control. A market economy is based on the idea that people and businesses can exchange goods and services freely. The prices charged by producers are determined by the relationship between supply and demand. A traditional economy relies on customs, history, and time-honored beliefs to determine production and distribution. A command economy is based on a government that controls economic activity through rules and regulations. In a mixed economy, the government and private sector work together to provide goods and services. The United States is a mix of market and command economies. It has a welfare state but also has a significant public sector that provides public goods and services like roads, military protection, hospitals, and education. The US government controls part of the economy through restrictions and licensing requirements in areas like education, roads, hospital care, postal delivery, and subsidies to agricultural producers, oil companies, and financial firms. It also provides a limited welfare state to help people live better lives and reduce the effects of extreme poverty. It has a habit of imposing its political system on other countries and exporting its brand of democracy to them, even to the point of using its own values as a weapon of massive destruction in order to attack the people of other nations. Such actions have brought about regional turbulence and wars in the name of “democracy”, destroyed what once were beautiful countries, and harmed world peace and stability. Money politics, lobby groups, and a small group of rich people dominate the system, making it almost impossible for ordinary citizens to have an impact on government policy. The resulting gridlock is a formula for disaster, from the COVID-19 pandemic to the economic slowdown and climate change crisis. The American political system has been rigged by gerrymandering, voter suppression, and money politics. This has led to economic inequality that is much higher in the US than it is in most other advanced countries. It has also made political polarization more acute, exacerbated identity politics and tribalism, and worsened social division. This has weakened the democratic system and degraded its ability to serve the people’s interests. This has resulted in the “vetocracy” phenomenon, where individual veto players can block action by the whole body, effectively paralyzing the government process. This has led to government efficacy being weakened, law and justice trampled upon, development stagnating, and progress stalling. As a result, many people in the US feel that democracy does not work and is unable to advance their lives. This perception is shared by more than a quarter of respondents in France, Germany, and Sweden. The wealth and income distribution in the USA are far more unequal than in most other advanced countries. The causes of this inequality are varied, but one common theme is that policy decisions have a large impact on the level of wealth and income inequality. The US government controls or provides subsidies for most of the goods and services that we consume. This includes education, transportation, roads, hospitals, and postal services, as well as agriculture and oil. As a result, those who provide these services can raise prices above what would prevail in competitive markets, increasing their profits and the share of income going to their owners and managers. This type of “rent extraction” is a major driver of inequality. The moneyed class is also able to manipulate laws and regulations in their favor. This has allowed them to increase their own compensation, often by avoiding legal responsibility and imposing harm on others. This is the main reason for high economic inequality in the U.S. Unless there is a democratic political awakening to break this feedback loop, inequality will continue to widen.
[ "Mixed economy", "Capitalism", "Socialism", "Economic intervention", "Government subsidies", "Public goods and services", "Political system influence", "Democracy promotion", "Gridlock in governance", "Gerrymandering", "Voter suppression", "Lobby groups", "Wealth inequality", "Income inequ...
[ "Mixed economy", "Capitalism", "Socialism", "Economic intervention", "Government subsidies", "Public goods and services", "Political system influence", "Democracy promotion", "Gridlock in governance", "Gerrymandering", "Voter suppression", "Lobby groups", "Wealth inequality", "Income inequ...
An International Symposium dedicated to exploring the boundaries of biography 25-26 October 2018, Noosa Queensland Australia Abstracts are being sought for and investigation into speculative biography and exploring associated practices. Recently, some writers have chosen to experiment further with biography, employing conjecture and ‘informed imagination’ to fill in the gaps and silences in the archives, and when writing the lives of those who are under-represented in sources and obscured from the historical record. Such works have come to be known as ‘speculative biography’, not only because they challenge traditional notions of authorial veracity but also because, in contrast to biographically-based fiction or historical fiction, these experimental approaches are still clearly recognizable as nonfictional attempts to explore and express the ‘truth’. Details and how to submit can be found here
[ "International Symposium", "Biography", "Speculative Biography", "Academic Conference", "Historical Research", "Literary Experimentation", "Informed Imagination", "Archival Silences", "Underrepresented Figures", "Nonfiction Writing", "Authorship", "Truth Exploration", "Submission Guidelines"...
[ "International Symposium", "Biography", "Speculative Biography", "Academic Conference", "Historical Research", "Literary Experimentation", "Informed Imagination", "Archival Silences", "Underrepresented Figures", "Nonfiction Writing", "Authorship", "Truth Exploration", "Submission Guidelines"...
Statistics in Plain English, Third Edition - ISBN 13: - ISBN 10: - Edition: 3rd - Format: Paperback - Copyright: 05/25/2010 - Publisher: Taylor and Fran Note: Not guaranteed to come with supplemental materials (access cards, study guides, lab manuals, CDs, etc.) Extend Your Rental at Any Time Need to keep your rental past your due date? At any time before your due date you can extend or purchase your rental through your account. List Price $45.81 Save This inexpensive paperback provides a brief, simple overview of statistics to help readers gain a better understanding of how statistics work and how to interpret them correctly. Each chapter describes a different statistical technique, ranging from basic concepts like central tendency and describing distributions to more advanced concepts such as t tests, regression, repeated measures ANOVA, and factor analysis. Each chapter begins with a short description of the statistic and when it should be used. This is followed by a more in-depth explanation of how the statistic works. Finally, each chapter ends with an example of the statistic in use, and a sample of how the results of analyses using the statistic might be written up for publication. A glossary of statistical terms and symbols is also included. New features in the third edition include: -a new chapter on Factor and Reliability Analysis especially helpful to those who do and/or read survey research, -new "Writing it Up" sections demonstrate how to write about and interpret statistics seen in books and journals, -a website at http://www.psypress.com/statistics-in-plain-english with PowerPoint presentations, interactive problems (including an overview of the problem's solution for Instructors) with an IBM SPSS dataset for practice, videos of the author demonstrating how to calculate and interpret most of the statistics in the book, links to useful websites, and an author blog, -new section on understanding the distribution of data (ch. 1) to help readers understand how to use and interpret graphs, -many more examples, tables, and charts to help students visualize key concepts. Statistics in Plain English, Third Edition is an ideal supplement for statistics, research methods, and/or for courses that use statistics taught at the undergraduate or graduate level, or as a reference tool for anyone interested in refreshing their memory about key statistical concepts. The research examples are from psychology, education, and other social and behavioral sciences. "Statistics in Plain English is a gift to students, teachers, and researchers. Urdan clearly explains statistical topics using straightforward, conversational language. The book is particularly unique because it covers everything from basic statistical principles to complex multivariate techniques, all in an extremely user-friendly manner." - Eric M. Anderman, The Ohio State University, USA "This approachable book provides an excellent introduction to statistical principles and terminology. Urdan clearly understands the bewildering experience of novices in the domain, and he smoothes the path with his clear prose and relevant examples." - Avi Kaplan, Temple University, USA
[ "statistics textbook", "research methods", "statistical techniques", "social science research", "data interpretation", "factor analysis", "repeated measures ANOVA", "regression analysis", "t-tests", "educational statistics", "psychological statistics", "SPSS dataset", "PowerPoint presentatio...
[ "statistics textbook", "research methods", "statistical techniques", "social science research", "data interpretation", "factor analysis", "repeated measures ANOVA", "regression analysis", "t-tests", "educational statistics", "psychological statistics", "SPSS dataset", "PowerPoint presentatio...
How does CR work? Is CR the same as DR (digital flat panel detector)? CR is an X–ray indirect conversion technique that uses IP as an X–ray medium. After the IP is irradiated with X-rays, the intensity variation of the X-rays is recorded in the form of a latent image. The latent image signal strength decreases with time. The laser scanner produces a red laser or a near-infrared laser. When the laser beam scans the surface of the IP step by step, the latent image signal is converted into visible light (photoluminescence effect) by laser, and the fluorescence emitted from each point on the IP passes through a dedicated optical system. Coupled to a photomultiplier tube, the photomultiplier tube converts optical signals of different intensities at different points into electrical signals, which are amplified and sampled, sent to an analog-to-digital converter for quantization, and then sent to a computer for imaging. However, at present, there are no manufacturers in China producing CR. Thanks to the more advanced alternative DR, the DR does not need to be converted and can be imaged directly on the computer and printed out. Newheek is a manufacturer of DR. We have a 14’x17′ cable version, a 14’x17′ wireless board, a 17’x17′ cable version and a 17’x17′ wireless board. If you need to buy a DR flat panel detector, please contact our customer service.
[ "Computed Radiography (CR)", "Digital Radiography (DR)", "X-ray Imaging", "Indirect Conversion Technique", "IP Plate", "Latent Image Signal", "Photoluminescence Effect", "Photomultiplier Tube", "Analog-to-Digital Converter", "Medical Imaging", "Radiology Equipment", "Imaging Technology", "Fl...
[ "Computed Radiography (CR)", "Digital Radiography (DR)", "X-ray Imaging", "Indirect Conversion Technique", "IP Plate", "Latent Image Signal", "Photoluminescence Effect", "Photomultiplier Tube", "Analog-to-Digital Converter", "Medical Imaging", "Radiology Equipment", "Imaging Technology", "Fl...
In a blog post on LinkedIn, Weiner said that the changes are being made to “streamline our operations and focus on our most important priorities.” The changes will affect roles in the GBO, which is responsible for LinkedIn’s global sales and marketing efforts. Weiner said that the company will be “reorganizing and consolidating some of our teams” in the GBO. He also said that LinkedIn will be “realigning our China strategy” and “reducing our investment in some areas.” Weiner said that the changes are “not easy” but that they are “necessary” to ensure LinkedIn’s long-term growth. He said that the company is “committed to providing affected employees with severance packages and outplacement services.” The changes to LinkedIn’s GBO and China strategy come at a time when the company is facing increasing competition from other social media platforms, such as Facebook and Twitter. LinkedIn has also been criticized for its slow growth in recent years. It remains to be seen how the changes will affect LinkedIn’s business in the long run. However, Weiner said that he is “confident” that the company will “emerge from this stronger than ever.”
[ "LinkedIn", "Reorganization", "GBO", "Sales and Marketing", "China Strategy", "Severance Packages", "Outplacement Services", "Social Media Platforms", "Facebook", "Twitter", "Slow Growth", "Long-Term Growth", "Jeff Weiner", "Business Operations", "Corporate Restructuring", "Employee La...
[ "LinkedIn", "Reorganization", "GBO", "Sales and Marketing", "China Strategy", "Severance Packages", "Outplacement Services", "Social Media Platforms", "Facebook", "Twitter", "Slow Growth", "Long-Term Growth", "Jeff Weiner", "Business Operations", "Corporate Restructuring", "Employee La...
J&K: Gulmarg Unveils Stunning Snow Replica Of Taj Mahal, Tourists Flock In Hordes Nature has endowed Kashmir with incredible beauty and is rightly called "Paradise on Earth" and there is no dearth of beautiful sites in Jammu and Kashmir. Now, Kashmir Valley's Gulmarg is adding a new site to the list of tourist attractions in this area -- is a snow sculpture. Kashmir’s winterland, Gulmarg has recently become home to a stunning snow sculpture replicating the Taj Mahal. Within a short span snow sculpture has become a sensation on social media. Take a look: Snow sculpture of the Taj Mahal has become the latest attraction for tourists in Jammu and Kashmir’s Gulmarg after the igloo cafe. The replica of the Taj Mahal, one of the seven wonders of the world, has been sculpted by members of the hotel Grand Mumtaz. Gulmarg is already on the tourists’ top list of destinations for snow-lovers. By building this new sculpture with zero material cost in 17 days, the locals have managed to not cease to excite tourists from across the world. The sculpture reaching a height of 16 feet and covering an area of 24 feet x 24 feet, captivated the attention of many with people flocking to click pictures alongside it. Taj Mahal was built in Agra by Mughal emperor Shah Jahan in memory of his wife Mumtaz. Yusuf Baba, head member of the team who made the sculpture said that a 4 member team was involved in the work and no other material besides snow has been used. He also said that it has become an attraction for several tourists already.
[ "Tourism", "Snow Sculpture", "Taj Mahal Replication", "Kashmir Tourism", "Winter Attractions", "Gulmarg", "Local Artisans", "Social Media Sensation", "Igloo Cafe", "Historical Sites", "Snow Sports", "Mughal Architecture", "Travel Destinations", "Tourist Attraction", "Indian Heritage", ...
[ "Tourism", "Snow Sculpture", "Taj Mahal Replication", "Kashmir Tourism", "Winter Attractions", "Gulmarg", "Local Artisans", "Social Media Sensation", "Igloo Cafe", "Historical Sites", "Snow Sports", "Mughal Architecture", "Travel Destinations", "Tourist Attraction", "Indian Heritage", ...
US 3060797 A Abstract available in Claims available in Description (OCR text may contain errors) Oct. 30, 1962 N. D. ANDREAS SLIDE PROJECTOR Filed Sept. 3, 1959 NORMAN D. AN DREAS IN VENTOR. aw/(F PM ATTORWY United States Patent() 3,060,797 SLIDE PROJECTOR Norman D. Andreas, Greece, N.Y., assignor to Bausch & Lomb Incorporated, a corporation of New York Filed Sept. 3, 1959, Ser. No. 837,794 1 Claim. (CI. 88-24) The present invention relates in general to slide projectors and is more particularly concerned with projection lens assemblies therefor. The principal object of the present invention is to provide an improved housing or mounting tube for a projection lens assembly which will readily admit of longitudinal focusing adjustment of the lens assembly, but will prevent the lens assembly from being accidentally removed from the slide projector. In this connection, it is contemplated that the projection lens mounting tube will be provided with a peripheral collar at its rear end which cooperates with the rear end of a V-shaped trough within which the projection lens assembly is seated in order to limit the relative movement of the projection lens assembly in a forward direction but which will, upon tilting of the projection lens assembly, readily permit removal of the lens assembly from the projector. The foregoing objects and others, as well as numerous advantages will become apparent from the following detailed description when read in conjunction with the acoompanying drawing wherein: FIG. 1 is a side elevational view shown partly in section and illustrating the principal features of the present invention; FIG. 2 is a sectional view taken substantially along the line 22 in FIG. 1 and looking in the direction of the arrows; FIG. 3 is a sectional view taken substantially along the line 33 in FIG. 1 and looking in the direction of the arrows; and FIG. 4 is a fragmentary side elevational view illustrating the projection lens assembly tilted just prior to removal thereof from the slide projector. With reference now to the drawings, wherein like reference numerals have been used in the different views to identify identical parts, the present invention comprises a slide projector having a mounting base on which the various elements of the slide projector are mounted. The slide projector includes a projection lamp 11, the details of which form no part of the present invention, and which, therefore, will not be described in any greater detail, a condenser lens assembly 12, a projection lens assembly 13, and a transparent slide mounting means 14. The projection lamp 11, condenser lens assembly 12, and projection lens assembly 13 are all adapted to be optically aligned and a transparent slide 15 is adapted to be disposed within the slide mounting means 14 in order to form the object, the image of which is adapted to be projected upon a viewing screen (not shown). The transparent slide 15, of course, is also mounted in optical alignment with the condenser lens assembly 12 and projection lens assembly 13. The projection lens assembly 13 is disposed generally within a projection lens assembly housing 16, which comprises a box-like member, having sides 17 suitably affixed to the mounting plate 10 and a top 18. The projection lens assembly 13 comprises an elongated substantially cylindrical tube 19 with a plurality of lenses 20 mounted therein and is formed with a rear peripheral collar 21, which projects slightly beyond the outer periphery of the tube portion 19, and a forward peripheral collar 22 which is rotatably mounted on the leading end of the tube 19 in order to permit of slight adjustment of one or more of the lenses 20. The projection lens assembly tube 19 is adapted to be seated within a V-shaped trough 23 which is secured to the base 10 by means of suitable bolts 24. The trough 23 is accurately positioned so as to maintain optical alignment of the projection lens assembly 13 with respect to the condenser lens assembly 12 even though the projection lens assembly 13 is longitudinally adjusted. In order to retain the projection lens assembly 13 in relatively fixed position in the trough 23, a pair of spring pressed nylon beveled rollers are rotatably mounted on a shaft 25, which extends through a pair of U-shaped slots formed in upstanding portions 26, integral with the top 18 of the projection lens assembly housing 16. A flat spring 27 having one end mounted fixedly at 28, has its other end pressing against peripheral ridges 25 formed around shaft 25, in order to maintain the nylon rollers in continuous engagement with the outer periphery of the projection lens assembly tube 19. In order to permit ready longitudinal adjustment of the projection lens assembly 13, a rubber coated roller 29 is rotatably mounted on a mounting shaft 30 in a position such that the periphery of the roller is adapted to be engaged by the outer surface of the projection lens assembly mounting tube 19 when the latter is disposed in seated position within trough 23. Suitable means 31 may be provided in order for manually rotating the roller 29 and
[ "slide projector", "projection lens assembly", "Norman D. Andreas", "Bausch & Lomb Incorporated", "patent", "optical alignment", "lenses", "projector components", "V-shaped trough", "longitudinal focusing adjustment", "mounting tube", "nylon rollers", "spring mechanism", "transparent slide...
[ "slide projector", "projection lens assembly", "Norman D. Andreas", "Bausch & Lomb Incorporated", "patent", "optical alignment", "lenses", "projector components", "V-shaped trough", "longitudinal focusing adjustment", "mounting tube", "nylon rollers", "spring mechanism", "transparent slide...
Ukrainian President Volodymyr Zelenskyy said an explosion would mean “the end for Europe,” while experts have downplayed the threat of a nuclear catastrophe. It’s OK, and even logical, to be afraid. But don’t give in to panic. Europe’s largest power plant is now under Russian control, the agency also confirmed Putin has threatened the West twice this week with nuclear war. VICE News asked experts how worried we should be. “I order to move Russia's deterrence forces to a special regime of duty,” President Vladimir Putin announced Sunday. Ukrainian officials have said there’s fighting occurring at one of the most radioactive locations on the planet. “If you’re worried about nuclear war, this shouldn’t change how you feel because it doesn’t change the fact that, if they really wanted to, China can vaporize American cities.” The nuclear-powered submarines are seen as a counterweight to China’s military ambitions. The Nazis tried to develop nuclear weapons during WWII. This uranium cube at a Washington laboratory may have been part of this secret program. Solar panels wrapped around tritium tubes generate just enough energy to power a simple 'Tetris' style handheld. Details about passwords, secret codes, and nuclear missile location were uploaded by U.S. service members to flashcard websites. For decades the Duga-1 radar array warned the Soviet Union of incoming missiles, now it’s a monument to a nuclear disaster.
[ "Nuclear threats", "Russian invasion of Ukraine", "European security", "Military conflict", "International politics", "Deterrence forces", "Power plants", "Radioactive sites", "Nuclear warfare", "World War II history", "Chinese military", "Submarines", "Flashcard websites", "Missile defens...
[ "Nuclear threats", "Russian invasion of Ukraine", "European security", "Military conflict", "International politics", "Deterrence forces", "Power plants", "Radioactive sites", "Nuclear warfare", "World War II history", "Chinese military", "Submarines", "Flashcard websites", "Missile defens...
The Cannon Crew is an entegral part of the Parsons Mounted Calvary. The cannon is actually a Model 1902 3-inch field gun. The 3-inch field gun was the Army's preferred field artillery piece until World War I when the 75 mm was adopted for munitions compatibility with the Allies. It was the late 1970's when the cannon was first found at a bonfire cut site. In September of 1982, "The Spirit of '02" was first fired on the Corps of Cadets Quadrangle. In 1984, the cannon became part of the Aggie football tradition by firing a shot every time the team scored. This six piece set inlcudes the faithful depiction of the cannon, two senior cadets, two underclassmen cadets and the traditional sign that reads, "Warning Cannon Fires When Aggies Score." $325 (includes free ground shipping)
[ "Model 1902 3-inch field gun", "Parsons Mounted Cavalry", "Aggie football tradition", "Cannon crew", "Field artillery", "Military history", "College traditions", "Cadet corps" ]
[ "Model 1902 3-inch field gun", "Parsons Mounted Cavalry", "Aggie football tradition", "Cannon crew", "Field artillery", "Military history", "College traditions", "Cadet corps", "Model 1917 75mm field gun", "World War II era weapon", "Navy tradition", "Baseball game tradition", "Civil War era...
When Ali Fazal met Al Pacino at London screening Ali Fazal recalls meeting Hollywood megastar Ali Pacino at London screening As Ali Fazal turned a year older on October 15, he marked the occasion with an intimate dinner with Death On The Nile co-stars Gal Gadot and Annette Bening in London. Interestingly, the actor jokes that he received his birthday gift a day earlier — Fazal, who was attending the London Film Festival, met his screen idol Al Pacino at the screening of The Irishman. View this post on Instagram I post this today. My best gift of 2019, hell actually my whole life as ive known it because the people who know me know very well what this meant. I told him i pirated his movies just to catch up at one point. Id neva do that now but we all done bad things. We spoke a little about my work and then for some reason i remembered my two mamu’s and my mum being great fans of him as well.. so, i told him they were the ones who got me hooked on to you. My first fairytale i remember as a child is a story about an italian family in newyork. And years later i asked my mom why she did that. Who tells a kid about the godfather and she said - “i thought it was a nice story but i dont think i told it right. Go Watch it “. Anyway.. this was long overdue. And it happened at a private screening for the irishman with Mr De niro, Martin scorsese, harvy kietel, anna paquin and Al ofcourse. The movie? Flawless and if i can say the perfect film. Now u must understand an actor can never say that but it is. Its long tho. "It has been a lifelong journey to finally arrive at this moment when I got to meet the man himself," enthuses Fazal. The actor says that he grew up on a steady diet of Pacino’s classics, including The Godfather series and Scarface (1983). He further reveals that he harboured the dream of meeting the legend since his college days. "My friends Vijay and Aalaap, and I used to fill up the walls of our hostel room with posters of the movies that we would like to watch. Over the years, I watched each and every film on that list. And that day, I could not believe that I was meeting those very actors whom I had seen while growing up." During his interaction with the Hollywood superstar, Fazal told Pacino how his mother — an avid fan of the legend — had narrated the story of The Godfather to him as a fairytale. Sign up for all the latest news, top galleries and trending videos from Mid-day.comSubscribe Ayushmann Khurrana's Shubh Mangal Zyada Saavdhan will now release on this date
[ "Actor", "Film festival", "Meeting celebrities", "London screening", "Al Pacino", "Ali Fazal", "Death On The Nile", "Birthday celebration", "Hollywood", "Movie premiere", "Celebrity encounter", "The Irishman", "Screening event", "London Film Festival", "Cinema", "Co-star reunion", "G...
[ "Actor", "Film festival", "Meeting celebrities", "London screening", "Al Pacino", "Ali Fazal", "Death On The Nile", "Birthday celebration", "Hollywood", "Movie premiere", "Celebrity encounter", "The Irishman", "Screening event", "London Film Festival", "Cinema", "Co-star reunion", "G...
Three years ago, a bone marrow transplant gave eight year old Rachel Ancer a new life. In Rachel’s Second Chance, the book that she wrote with a little help from her parents Jonathan and Jean Ancer – she tells her story and the mysteries of bone marrow transplants are simply explained. The book is available through the SA Bone Marrow Registry on www.sabmr.co.za In this Lupus Awareness month of May, a young woman describes in a book called Crazy Became Me, how this unpredictable disease took hold of her life. Lupus (meaning wolf) is so called because centuries ago it was said the rash looks like a wolf bite.
[ "Bone marrow transplant", "Lupus awareness", "Children's health", "Memoir", "Health advocacy", "Rare diseases", "South Africa", "Patient stories", "Books for children", "Parental support" ]
[ "Bone marrow transplant", "Lupus awareness", "Children's health", "Memoir", "Health advocacy", "Rare diseases", "South Africa", "Patient stories", "Books for children", "Parental support", "Cancer treatment", "Heart transplant", "AIDS awareness", "Diabetes management", "Organ donation", ...
Libya’s oil blockade is entering its 7th month and the war-torn country’s oil output is hovering at just 100,000 b/d instead of the pre-crisis 1.2 million b/d. Without a peaceful solution on the horizon, its expected restart is delayed to fourth-quarter 2020, according to a recent Rystad Energy forecast. In the most optimistic of scenarios, Libya’s 2020 exit production rate will be 700,000-800,000 b/d. But this estimate itself carries downside risk: once oil production comes back online, it would take Libya another 3-4 months to ramp up production to the 1 million b/d mark. The damage is not just limited to the short term, according to the analyst, the prolonged blockade has negatively impacted both infrastructure and oil wells, so the eventual production ramp up will demand capex spending to rehabilitate wells and pipelines. For this purpose, Libya’s National Oil Company (NOC) estimates that between $500 million and $1 billion is needed just to reach the pre-blockade levels of 1.2 million b/d. Not only oil output has languished, but Libya’s production capacity itself has lost 100,000-150,000 b/d due to the ongoing blockade, according to Rystad Energy estimates. If the deadlock is not resolved in the coming months, it may drop by an additional 200,000-300,000 b/d, putting the country’s desired oil production level of 1.5 million b/d further out of reach. “Our latest global liquids balances report still suggests there will be a shift towards a surplus from August and for the ensuing three months, but it is less precarious than previously estimated and developments in Libya have a lot to do with this revision,” said Bjornar Tonhaugen, Rystad Energy’s head of oil markets. Rystad Energy is now also reducing supply expectations for OPEC heavy hitters such as Saudi Arabia, the UAE, and Kuwait as it expects slower ramp-up phases given the wobbly demand recovery outlook. Significant upward revisions were applied to Canada, as oil sands projects are exhibiting a resilient production recovery.
[ "Libya's oil industry", "Oil blockade", "Production capacity", "National Oil Company (NOC)", "Infrastructure damage", "Prolonged conflict impact", "Rystad Energy forecasts", "Libyan oil output", "Economic sanctions", "Crude oil production", "War-torn Libya", "Capital expenditure (capex)", "E...
[ "Libya's oil industry", "Oil blockade", "Production capacity", "National Oil Company (NOC)", "Infrastructure damage", "Prolonged conflict impact", "Rystad Energy forecasts", "Libyan oil output", "Economic sanctions", "Crude oil production", "War-torn Libya", "Capital expenditure (capex)", "E...
Small Aquarium Shipwreck Ornament 22.5cm X 7cm x 22.5cm High This aquarium lost cruise ship decoration looks very historic. Offers the natural environment feeling which can change your aquarium into a beautiful scenery. It had vivid colour detail to add lively and natural looking life to your fish tank. This shipwreck is great for decorating your aquarium all the time with minimum maintenance.They are 100% safe for fish made from special resin that is non toxic and designed specifically for use in aquariums and fish tanks. See our full range here
[ "Aquarium ornament", "Shipwreck decoration", "Fish tank decor", "Resin decoration", "Non-toxic for fish", "Historic shipwreck", "Aquarium scenery", "Special resin material" ]
[ "Aquarium ornament", "Shipwreck decoration", "Fish tank decor", "Resin decoration", "Non-toxic for fish", "Historic shipwreck", "Aquarium scenery", "Special resin material", "Live coral", "Plastic plant", "LED light decoration", "Saltwater only", "Requires frequent cleaning", "Hand-painted...
Metro workers have been much more productive over the past year than in the recent past, General Manager Paul Wiedefeld said, according to an internal report due to be released next week. DULLES, Va. — Metro workers have been much more productive over the past year than in the recent past, General Manager Paul Wiedefeld said, according to an internal report due to be released next week. “Our what we call ‘wrench time’, the amount of time that people are out on the system working, has increased. Our productivity has gone up 34 percent,” Wiedefeld said at a Loudoun County Chamber of Commerce event Thursday. “We’re paying those people to be out there and do work,” Wiedefeld said. “And just through different efficiencies, by tightening that up we’ve increased literally the amount of work they’re delivering.” The report next week is meant to justify the hours cutbacks Metro implemented last year as well as explain some of the specific work that has been done along with the track testing and inspection programs that are just getting underway. “Before, we had so much time lost because we didn’t have enough window of a time to put people out there doing work, so now, with those additional hours, we’re physically getting more time out on the tracks which means much more productivity out of the same amount of people,” Wiedefeld said after the event ended. He has also credited a crackdown on workers taking time off.
[ "Transportation infrastructure", "Public transportation", "Productivity improvement", "Workforce efficiency", "Infrastructure maintenance", "Employee performance metrics", "Track inspections", "System upgrades", "Management strategy", "Operational changes", "Labor policies", "Safety improvemen...
[ "Transportation infrastructure", "Public transportation", "Productivity improvement", "Workforce efficiency", "Infrastructure maintenance", "Employee performance metrics", "Track inspections", "System upgrades", "Management strategy", "Operational changes", "Labor policies", "Safety improvemen...
Asthma is a common chronic inflammatory disease of the airways that afflicts people of all ages. Some of the symptoms include shortness of breath, wheezing, coughing and chest tightness. It is thought to be caused by a combination of genetic and environmental factors (such as allergens, air pollution, chemicals…). Asthma is associated with exposure to indoor allergens, such as dust mites, animal dander and mold. One way of managing asthma is to reduce or eliminate exposure to allergens. Thorough and regular cleaning of your home (especially your carpets, upholstery and ducts) can eliminate a lot of the hidden allergens. Using a professional service, such as Rivers Edge Carpet and Duct Cleaning, is the best way to get rid of a lot of asthma triggers. Just because a home looks clean, it doesn’t mean that it is. Carpets and upholstery can collect dust and soil below the surface. Even with regular vacuuming, dirt, dander and allergens can get embedded into the fibers. Rivers Edge’ multi-step carpet cleaning process, using cleaning solutions that are safe for kids and pets, delivered by professional, trained technicians, will create a healthier home environment. Dust, dirt, dander and allergens also get trapped inside a home’s air ducts. As the air circulates, if the ducts are dirty, all of these asthma triggers travel throughout your home. It is important to have the air ducts and HVAC system cleaned professionally, to reduce exposure to dirty air. Once again, Rivers Edge can come to your rescue with their powerful and effective air duct cleaning system. Their professional, trained technicians use specialized tools to dislodge the dirt and debris from the ducts, pulling it away from your home. Although not much can be done about the genetic factors causing asthma, the environmental ones can be controlled to some extent by ensuring the indoor air quality in your home is as clean as possible.
[ "Chronic inflammatory disease", "Asthma symptoms", "Indoor allergens", "Environmental factors", "Allergen reduction", "Home cleaning", "Professional cleaning services", "Carpet cleaning", "Duct cleaning", "HVAC system maintenance", "Healthy home environment", "Indoor air quality", "Genetic f...
[ "Chronic inflammatory disease", "Asthma symptoms", "Indoor allergens", "Environmental factors", "Allergen reduction", "Home cleaning", "Professional cleaning services", "Carpet cleaning", "Duct cleaning", "HVAC system maintenance", "Healthy home environment", "Indoor air quality", "Genetic f...
For the last decade, businesses in San Francisco have been adamant that the city’s payroll tax is holding back job growth. First, companies must pay the tax when they reach $250,000 in payroll, which discourages new hiring. Second, they must pay it when employees exercise their stock options — a strong incentive for any company considering an IPO to leave the city. The Stockton Street Enhancement Project, spearheaded by Chinatown Community Development Center (CCDC) and SPUR, brought Chinatown and SPUR stakeholders together to discuss ways to preserve the economic and cultural vitality of Stockton Street while offering opportunity areas for improvement through the next decade. On March 9, 2012, San Francisco issued its first zoning permit for “neighborhood urban agriculture.” The change of use permit, given to Little City Gardens, allows the small urban farming business to grow produce for sale at its three-quarter-acre market garden in the Mission Terrace neighborhood. Let’s say you’ve got a great jam recipe. Or perhaps you make some mean pickles. Your friends keep telling you that you should quit your day job and follow your culinary passion. But unless you’ve got quite a bit of savings or other access to capital, following your friends’ advice is a pricey proposition. This June’s primary election will bear little resemblance to the contentious ballot San Franciscans considered last November. Gone are the competing pension reform measures, sales taxes and bonds. We’re left with two measures, both placed on the ballot by voter petition. This year at our 32nd annual Good Government Awards, SPUR honored Ed Harrington with a Lifetime Achievement Award for his service to the City and County of San Francisco, including unparalleled fiscal leadership and managerial excellence through five mayoral administrations. This year at our 32nd annual Good Government Awards, SPUR honored the SFpark Pilot Program team — Jay Primus, George Reynolds, Steven Lee and Lorraine Fuqua — for its implementation of its groundbreaking smart parking management program. As the rest of the country eagerly watches the Republican presidential primary drama unfold, San Francisco prepares for a comparatively uneventful June election. Five proposed initiatives have dropped off the ballot, leaving the city to consider just two measures this election. Prop. A would change the competitive procurement and franchising for solid waste disposal in the city. On February 28, Salesforce announced its was suspending plans to build a 2-million-square-foot campus on the 14 acres it had acquired in San Francisco’s Mission Bay. Citing that it has grown faster than expected, the company will instead lease existing space two miles north, near Market Street in San Francisco’s Central Business District. Two sites owned by the Public Utilities Commission (PUC) in San Francisco moved closer to becoming urban agriculture projects this week. As the economy struggles to recover in the Bay Area, what are the prospects for city revenues in San Francisco? City budget staffers and experts on the local economy gathered at the 2012 Annual Economic Briefing, hosted by SPUR's Municipal Fiscal Advisory Committee, to discuss regional trends and projections for the city’s major revenue streams. The upshot: Our experts are starting to see some good news on the horizon. Unemployment has finally begun to decline, and San Francisco... Redevelopment agencies across the state closed their doors on February 1, marking the end of an era for planning in California. How are San Francisco, Oakland and San Jose dismantling their agencies? What’s going to happen to the on-going projects and existing assets held by redevelopment agencies? And will any new planning tools emerge to do some of the work previously done by redevelopment agencies? Can you make a living selling what you grow in a city? That’s a question a number of urban farming entrepreneurs have been working to answer in the past few years, and initial numbers are beginning to become public. Members-only walking tours are one of the great benefits of joining SPUR. Tour leaders such as planners, architects, elected officials and other insiders spend a few hours with us, sharing their expert lens on our region. Want to know what's in store for 2012? Our new calendar of spring tours and other events is now online. How can a rich historical space welcome visitors and new community members while ensuring that it continues to work for current residents? This question is central to the future of San Francisco’s Chinatown. Stockton Street, one of the busiest corridors in the city, must decide how to accommodate additional growth and change in the coming years. To address these concerns while maintaining affordable housing, transit equity, pedestrian safety and a sense of community, SPUR and the... On December 20, the California Supreme Court upheld the legislature’s elimination of redevelopment agencies. Each city now needs to figure out how to do what has been traditionally been done with redevelopment funds. What does this surprising turn
[ "San Francisco", "Payroll Tax", "Urban Agriculture", "Stockton Street", "Chinatown", "SPUR", "Good Government Awards", "Economic Recovery", "Salesforce", "Mission Bay", "Public Utilities Commission", "Redevelopment Agencies", "Urban Farming", "City Budget", "Local Economy", "Primary El...
[ "San Francisco", "Payroll Tax", "Urban Agriculture", "Stockton Street", "Chinatown", "SPUR", "Good Government Awards", "Economic Recovery", "Salesforce", "Mission Bay", "Public Utilities Commission", "Redevelopment Agencies", "Urban Farming", "City Budget", "Local Economy", "Primary El...
OrthoSelect will use orthobrain’s SimplyClear aligner system as its official clear aligner partner for the company’s clients. Orthobrain’s SimplyClear aligner system will be OrthoSelect’s official clear aligner partner, offering its clients a system that combines premium plastic and orthodontist-led treatment planning and support. “We’re thrilled to be partnering with orthobrain who shares our passion for providing exceptional patient experiences and clinical outcomes,” said Steven Gardner, OrthoSelect’s president. “Orthobrain’s game-changing aligner system offers the full package when delivering orthodontic care, and we are excited to be able to offer its comprehensive treatment plan to our clients.” In August 2022, orthobrain launched its new SimplyClear aligner system. Developed by orthodontists and industry leaders with decades of orthodontic experience, every SimplyClear case features comprehensive support and complete case management, allowing providers to confidently deliver quality orthodontic outcomes while minimizing doctor time. “Expanding access to healthy smiles is the cornerstone of what we do,” said Dan German, DDS, founder of orthobrain. “Together, with OrthoSelect, our shared vision will allow for transformative growth and quality patient outcomes.” Orthobrain was established with the goal of providing orthodontic options to dentists looking to offer orthodontic services to patients. The orthobrain dental practice growth system is designed to make integrating orthodontics easy and profitable with a total solution that combines digital technology, proprietary AI and learning systems with the expertise of orthodontists. OrthoSelect is a digital orthodontics company with the mission of helping orthodontists achieve greater clinical efficiency through technology and provide improved treatment outcomes for their patients.
[ "Orthodontics", "Clear aligners", "Orthobrain", "OrthoSelect", "Dental practices", "Clinical outcomes", "Patient experience", "Digital orthodontics", "Aligner system", "Orthodontist-led treatment", "Comprehensive support", "Case management", "Provider confidence", "Healthy smiles", "Trea...
[ "Orthodontics", "Clear aligners", "Orthobrain", "OrthoSelect", "Dental practices", "Clinical outcomes", "Patient experience", "Digital orthodontics", "Aligner system", "Orthodontist-led treatment", "Comprehensive support", "Case management", "Provider confidence", "Healthy smiles", "Trea...
The Beamspliter/Combiner can be used in several set ups, combining several instruments. One possibility is to combine a Fluorescence and an Absorbance application. By using the DA Beam combiner we can measure Absorbance and Fluorescence at the same time. The Da Beam combiner will receive both Absorbance and Fluorescence signals and can switch between these signals. So we see both Absorbance and Fluorescence spectra in the software, the spectrum will only be updated when the Beamcombiner is in the right position. Click HERE for this set up.
[ "Beamsplitter", "Beam combiner", "Fluorescence measurement", "Absorbance measurement", "Optical instrument", "Multi-application device", "DA Beam combiner", "Dual-signal measurement", "Optical setup", "Spectroscopy equipment", "Signal switching", "Software integration", "Real-time spectrum u...
[ "Beamsplitter", "Beam combiner", "Fluorescence measurement", "Absorbance measurement", "Optical instrument", "Multi-application device", "DA Beam combiner", "Dual-signal measurement", "Optical setup", "Spectroscopy equipment", "Signal switching", "Software integration", "Real-time spectrum u...
VATICAN CITY — Harsh criticisms meted out by Pope Francis on free-market capitalism have sparked backlash from some fiscal conservatives and have led some people to call him “anti-capitalist” or even Marxist. Ahead of his apostolic visit to the United States in September, some are bracing themselves for more criticisms from the pope, this time directed specifically at the U.S. culture and economy. Joseph Kaboski, a professor of economics at the University of Notre Dame and president of CREDO, an international organization of Catholic economists, said, “As an individual, the pope probably views redistribution programs as a more effective way of tackling poverty than economic growth,” though “most mainstream economists would disagree.” In addition, he said, the pope would probably “like more government involvement in the economy than many Americans would be comfortable with.” However, Kaboski said he views the pope “as neither pro- nor anti-capitalist, but instead a measured critic.” Kaboski said he is “confident Pope Francis finds much to commend” in U.S. economic life, such as private property, the entrepreneurial spirit, human creativity, technological advances, the way it creates jobs, income and products, and the way charities, government and the private sector pitch in to provide services to those in need. At the same time, the pope “would also criticize the vast disparities in income and wealth … point to the poor in the inner cities, and argue that they are not fully participating in society,” Kaboski said. In addition, the pope would “point to the fact that the global economic crisis started in the U.S. financial sector and wound up shaking economies of many poor nations,” he said. Kaboski said he is “very excited” about the pope “emphasizing the needs of the poor, but then if he talks about the roots of the financial crisis, it’s hard for me to fully go along with his confidence because academic economists are still debating the root causes of the Great Depression.” “There are some statements (he makes) that can leave people scratching their heads,” he conceded. However, it is important to keep in mind that the pope is “never teaching economics,” added Kaboski, who is also a consultant for the U.S. bishops’ Committee on Domestic Justice and Human Development. Rather, the pope is “catechizing on how our Christian view ought to impact our view of a good economy and society.” Christians are called to evaluate economic activity through the lens of their relationship with God and others, which must be central to their lives, he added. In homilies and at various audiences throughout his two-year pontificate, Pope Francis has sought to raise awareness and inspire action that would narrow the imbalances between the world’s rich and poor. He has criticized the current global economy, which is says is based on a “throwaway culture” that encourages consumption and waste, and marginalizes or even discards people seen as economically unproductive. His main criticisms of “unregulated capitalism” are spelled out in his apostolic exhortation, “The Joy of the Gospel,” which calls people to turn from the idolatry of money and indifference to the needs of the poor. The economy must be based on the primacy of the person, honor human dignity and care for the poor, especially by including them in the economy, he said. Pope Francis’ encyclical on the environment, “Laudato Si’, on Care for Our Common Home,” took up the same themes and extended his reflection to the devastating impact of the throwaway culture on the environment and on the poor who live closest to nature and rely most heavily on the land for their livelihood. “This is related to what the pope has been talking about long before the environment: lifestyle,” said Greg Burke, senior communications adviser to the Vatican’s Secretariat of State. “This encyclical is as much about wealth and poverty as it is about the environment.” The call to action in “Laudato Si'” is “not just taking out your trash,” Burke told Catholic News Service, “but how much trash … you produce because of rampant consumerism.” Carolyn Woo, president of Catholic Relief Services and a former business professor, told CNS that the encyclical also includes a call to action for the business sector. “Pope Francis actually invites business to be a part of the solution,” she said. “But it cannot be business as usual.” Rather, businesses need to shift out of “the same short-term thinking or the same obsession with short-term profits and disregard for people,” she said. Practically, it means businesses would need to adopt the values of “solidarity and sustainability, oriented toward the common good and the true development of all peoples” and engage in more environmental impact assessments of their activities, she said at the Vatican’s
[ "Pope Francis", "Free market criticism", "Capitalism critique", "Economic disparity", "Christian ethics", "Global economy", "Environmental issues", "Social justice", "Throwaway culture", "Consumerism", "Poverty alleviation", "Unregulated capitalism", "Catholic social teachings", "Apostolic...
[ "Pope Francis", "Free market criticism", "Capitalism critique", "Economic disparity", "Christian ethics", "Global economy", "Environmental issues", "Social justice", "Throwaway culture", "Consumerism", "Poverty alleviation", "Unregulated capitalism", "Catholic social teachings", "Apostolic...
Launchers and Propulsion SSO-A (Sun Synchronous Orbit – A) — first Rideshare mission of Spaceflight Industries In 2015, Spaceflight Industries of Seattle WA (simply referred to as 'Spaceflight'), initiated a dramatic new vision: buy a full Falcon 9 and fill it totally with Rideshare spacecraft. There was to be no ‘prime' satellite. There was the potential for ‘co-lead' status for a couple of customers, but otherwise it was an egalitarian mission. This mission was dubbed SSO-A for ‘Sun Synchronous Orbit – A" with "A" standing for the first of a planned series of such launches. 1) The SSO-A mission takes the concept of a Rideshare – or ‘Multi Manifest Mission' – to a new level. A full Falcon 9 launch vehicle is being dedicated purely to Rideshare spacecraft – there is no ‘Primary' satellite that defines the mission (Figure 1).The approach is analogous to buying a seat on an airplane: everyone is leaving at the same time and going to the same place. No single passenger gets to change the departure time or destination. There are ‘Co-Lead' customer who get limited involvement in determining the launch date, as well as other enhanced services. In the air travel analogy, this would be equivalent to a special first-class ticket that would allow one or two passengers to ask for the departure to be delayed accommodating their schedule. For the SSO-A mission, there is only one commercial customer who has this special Co-Lead status. In all, there are 51 different customers, representing 14 different countries on the SSO-A mission. There are 16 MicroSats, as well as dozens of CubeSats ranging from 0.25U to 6U. IPS (Integrated Payload Stack): The SSO-A configuration features an IPS. As shown in Figure 2, the IPS structure consists of multiple structural elements. The two major deployed elements designated the UFF (Upper Free Flyer) and LFF (Lower Free Flyer), as well as various sub-elements as shown in Figure 3. UFF (Upper Free Flyer): The UFF consists of four primary structural elements: 1) ESPA (EELV Secondary Payload Adapter) 4) Top Section of the MPC (Multi Payload Carrier) The ESPA is a standard aluminum ESPA ring with six port with 15" bolt pattern attachment points. This unit is built by Moog CSA Engineering of Mountain View, CA and has flown multiple times. The CubeStack is an aluminum structure developed for the SSO-A configuration. It houses the UFF avionics, as well as providing port for up to five 6U-size CubeSat dispensers. It was built by LoadPath Engineering. The Hub is similar to an ESPA Grande but is composite versus aluminum construction. It has six 24" diameter ports. It is built by Airbus Defense and Space (formerly CASA) in Madrid, Spain. LFF (Lower Free Flyer): The LFF is a hexagonal aluminum structure designed to hold up to twelve 12U – or QuadPack – size CubeSat dispensers. It also includes avionics to autonomously separate all of the CubeSats on the LFF. MPC (Multi Payload Carrier): The MPC is a load-carrying composite structure. There is a separation mechanism between the lower and upper halves of the MPC. This separation join allows the UFF to be released and to then autonomously deploy the spacecraft attached to it. There are also four platform on the MPC on which four microsats are mounted and deployed. The MPC is an adaption of the ASAP-S multiple payload structure previously built and flown on Soyuz launch vehicles by Arianespace. The overall mission scenario is shown in Figure 4. Once the UFF and LFF are separated by the launch vehicle, their avionics power up, initialize, and begin separating the spacecraft in a predetermined sequence. The UFF and LFF both have S-band transmitters for downlinking status to the ground. This data will be received by Spaceflight's ground station network and linked back to the Mission Operations Center (MOC) at Spaceflight's main office in Seattle, WA. In addition, the UFF is utilizing a Globalstar relay to provide a GPS positional solution and telemetry data throughout the mission. This data will also be linked from the Globalstar ground station network back to the MOC. The telemetry includes verification indicators for each spacecraft separation. Switches on the deployers – separation systems and CubeSat dispensers – are monitored by the UFF and LFF avionics transmitted to ground stations to provide verification of spacecraft separation. Figure 6 shows the preliminary ground track prediction for
[ "Rideshare mission", "Falcon 9 launch vehicle", "Sun Synchronous Orbit", "CubeSats", "MicroSats", "Payload stack", "ESPAs", "Free Flyers", "Avionics", "Separation mechanisms", "Globalstar relay", "Ground station network", "Mission Operations Center", "Multiple payload carrier", "Spacecra...
[ "Rideshare mission", "Falcon 9 launch vehicle", "Sun Synchronous Orbit", "CubeSats", "MicroSats", "Payload stack", "ESPAs", "Free Flyers", "Avionics", "Separation mechanisms", "Globalstar relay", "Ground station network", "Mission Operations Center", "Multiple payload carrier", "Spacecra...
Attack of the Drones Road & Bridges Scranton Gillette Communications South Carolina is just completing a significant roadwork program where bonds have been leveraged so that 27 years of maintenance and construction activities could be completed in just seven years. During this period, the number of South Carolina interstate work-zone-related crashes and fatalities has been rising, with the state accounting for nearly 10% of the nation’s work-zone fatalities. The number of crashes in work zones in South Carolina nearly tripled in five years, increasing from 677 in 1998 to 2,601 in 2003. In all of these years, a leading cause of vehicle crashes is driving too fast for conditions. Because of the increasing number of work-zone crashes and fatalities in South Carolina, research into innovative ways to improve driver attention and reduce vehicle speeds in work zones has become a priority for the South Carolina Department of Transportation (SCDOT). Please use publisher's recommended citation.
[ "roadwork programs", "bonds leveraging", "maintenance activities", "construction activities", "interstate work-zones", "crashes", "fatalities", "driver behavior", "vehicle speed control", "safety measures", "research priorities", "innovative solutions", "South Carolina Department of Transpor...
[ "roadwork programs", "bonds leveraging", "maintenance activities", "construction activities", "interstate work-zones", "crashes", "fatalities", "driver behavior", "vehicle speed control", "safety measures", "research priorities", "innovative solutions", "South Carolina Department of Transpor...
Tomorrow, voters will head to the polls in Alabama and Georgia to settle primary races that were forced into runoff elections. Alabama’s the home to the biggest race on June 21, the Senate GOP primary runoff that’s been set and reset by former President Donald Trump’s shifting loyalties. After pulling his endorsement from Rep. Mo Brooks, Trump is squarely on board the train for Katie Britt, the former top Senate aide running to replace her retiring once-boss, Sen. Richard Shelby. The state is also holding runoffs in primaries in two other races likely to decide the ultimate general election winner — secretary of state and the 5th Congressional District. In Georgia, Democrats Bee Nguyen and Dee Dawkins-Haigler face off for the right to take on Secretary of State Brad Raffensperger in the fall and deny him re-election. Two runoffs in the 6th and 10th Congressional Districts will likely decide who comes to Congress from their next year — Vernon Jones or Mike Collins, and Jake Evans or Rich McCormick — and a runoff between Jeremy Hunt and Chris West in the 2nd District could set up an interesting general election against Democratic Rep. Sanford Bishop. Elsewhere on the campaign trail: Alabama Senate: Sen. Tim Scott, R-S.C., backed Britt ahead of Tuesday’s runoff, calling her “a strong conservative who will fight to expand 21st century opportunity for every American family and preserve the American Dream.” Pennsylvania Senate: The National Republican Senatorial Committee launched a new TV ad in Pennsylvania as part of a seven-figure ad buy, tying Democratic Lt. Gov. John Fetterman to Biden and rising gas prices. Michigan Governor: Democratic Gov. Gretchen Whitmer reserved $3.4 million in broadcast airtime from September through Election Day. Illinois-07: Democratic Rep. Danny Davis spent $27,000 on cable in his fist ad buy ahead of his June 28 primary against fellow Democrat Kina Collins, who has been endorsed by Justice Democrats. Ohio-09: Democratic Rep. Marcy Kaptur is up with a new ad focused largely on her economic record, but also includes her criticizing calls to “defund the police.” New York Lt. Governor: The New York Times reports on how Lt. Gov. Antonio Delgado, the former congressman who gave up his seat for the post, faces a difficult primary challenge.
[ "Alabama primary", "Georgia primary", "runoff elections", "Katie Britt", "Mo Brooks", "Richard Shelby", "Bee Nguyen", "Dee Dawkins-Haigler", "Brad Raffensperger", "Vernon Jones", "Mike Collins", "Jake Evans", "Rich McCormick", "Jeremy Hunt", "Chris West", "Tim Scott", "John Fetterman...
[ "Alabama primary", "Georgia primary", "runoff elections", "Katie Britt", "Mo Brooks", "Richard Shelby", "Bee Nguyen", "Dee Dawkins-Haigler", "Brad Raffensperger", "Vernon Jones", "Mike Collins", "Jake Evans", "Rich McCormick", "Jeremy Hunt", "Chris West", "Tim Scott", "John Fetterman...
323.8mm*9.5mm API 5L Seamless Pipe.China Zhonghai Steel Pipe Manufacturing is specialized in producing steel pipes which applied to oil and gas field according to API 5L and other domestic and international standards.The products are applied to the transmission of oil,natural gas,water.Application:Seamless Pipe is used for Oil and Gas,Water.ASTM A252 pilling pipe and tube Grade 3 OD 219mm -ASTM A252 pilling pipe and tube Grade 3 OD 219mm.Grade 3 DRL Pipe Outside Diameter.8inch /219.1mm.Diameter Tolerance.216.909~221.291mm (± 1 % from the specified outside diameter as per ASTM A252) Grade 3 DRL Pipe Wall Thickness.5mm 25mm (SCH 20,SCH 40,STD,SCH 80 etc.) Wall Thickness Tolerance. ASTM A53 Steel Pipe Weight 323.9mm X 9.53 Bevelled,ASTM A53 Steel Pipe Dimensions 508 DRL Grade B Tube,ASTM A53 Steel Pipe Mill OD 323.9 x 9.53 DRL 2013 BLACK DIAMOND ANTWERP BELGIUM ASTM A53 Grade B Steel Pipe 20 inch SCH40 Black China,ASTM A53 B SCH40 Welded Tube,ASTM A53 Steel Pipe Gr.B ERW OD 219 SCH40 DRL 2013 TAR 2013 NETHERLANDSAlloy Steel Pipe Suppliers,Alloy Steel Seamless Tubes in ANSI B36.19 STAINLESS STEEL PIPE DIMENSION IN MM WEIGHT PER KG.Nominal Pipe Size.Outside Diameter.Schedule 5 S.Schedule 10 S.Schedule 20C.s Seamless Pipe Astm A333 Gr.6 Nace Mr0175 Sour Service C.s Seamless Pipe Astm A333 Gr.6 Nace Mr0175 Sour Service Pipe Used In Low Temperature Condition,Find Complete Details about C.s Seamless Pipe Astm A333 Gr.6 Nace Mr0175 Sour Service Pipe Used In Low Temperature Condition,Seamless Steel Pipe Used In Power Plant,Seamless Tubular,A333 Pipe from Steel Pipes Supplier or Manufacturer-Tianjin Youfa Pipeline Technology Co., The SCH 40 Carbon Steel Seamless Pipe is a medium range pressure capacity pipe where the schedules can range from sch5 through XXS.There are casing pipes and line pipes.The Carbon Steel Line Pipe is used for the transportation of fluid,mostly in the oil and gas industry where the casing pipes cover the line pipes to protect them from wear China ASTM A213 T22/P22 Alloy Seamless Steel Pipe/Tube Model NO.323.9mm*9.50mm alloy seamless pipe Type Seamless Technique SAW Material Carbon Steel Surface Treatment Black Usage Pipeline Transport,Boiler Pipe China ASTM A53/GB/JIS/En Pre-Galvanized Seamless/ ERW Now,we have 3 hot dip galvanized steel pipe lines,4 hollow section production lines,3 ERW steel pipe production lines.The annual output is 200,000 tons.Our main products are galvanized steel pipe,ERW steel pipe,square/rectangular steel tube,seamless steel pipe and galvanized steel coil. D273.1 -0.40 ~ +1.59D 323.9 -0.79 ~ +2.38. Standard Specification for Pipe,Steel,Black and Hot-Dipped,Zinc-Coated,Welded and Seamless.API 5L.Specification for Line Pipe(Two levels PSL 1 and PSL 2 of seamless and welded steel pipes for use in pipeline transportation systems in the petroleum and natural gas industries.)ERW Steel Pipe - SHINESTAR STEEL GROUP CO.,LTD.ERW steel pipe ERW steel pipe.(3) ERW tube is high frequency resistance welding steel tube,and the common welding process is different,the weld line is from the base material of the steel belt body melted,the mechanical strength is better than the general welded.ERW stands for resistance welding,resistance welding has the Energy Fact sheetLine pipe API 5L 4.5 - 8.625 3.6mm - 8.2mm Gr A,Gr B,X42-X52,PSL 1 Romania Roman Seamless * Temporary protective coating with black or uncoloured lacquer * Premium connections for castings - PTB007 and extreme line casings Line pipe API,ASTM,ASME,EN 3.0 - 20 (88.9mm - 508mm) 4.0mm - 50mm A,B
[ "API 5L Seamless Pipe", "Oil and gas field application", "Steel pipe manufacturing", "ASTM A252 pile pipe", "ASTM A53 steel pipe", "ERW steel pipe", "Carbon steel pipe", "Galvanized steel pipe", "Seamless steel pipe", "Pipeline transport", "Boiler pipe", "Alloy seamless pipe", "Low temperatu...
[ "API 5L Seamless Pipe", "Oil and gas field application", "Steel pipe manufacturing", "ASTM A252 pile pipe", "ASTM A53 steel pipe", "ERW steel pipe", "Carbon steel pipe", "Galvanized steel pipe", "Seamless steel pipe", "Pipeline transport", "Boiler pipe", "Alloy seamless pipe", "Low temperatu...
Keyword Analysis & Research: mass general laws chapter 190b Keyword Research: People who searched mass general laws chapter 190b also searched Search Results related to mass general laws chapter 190b on Search Engine What is Artificial Intelligence (AI)? | IBM Jun 03, 2020 · While a number of definitions of artificial intelligence (AI) have surfaced over the last few decades, John McCarthy offers the following definition in this 2004 paper (PDF, 106 KB) (link resides outside IBM), " It is the science and engineering of making intelligent machines, especially intelligent computer programs. It is related to the similar task of using computers to … DA: 65 PA: 97 MOZ Rank: 96 What is Artificial Intelligence (AI)? | Oracle AI which stands for Artificial intelligence is a technology that mimics human intelligence to perform tasks and can iteratively improve themselves based on the information they collect. Artificial intelligence (AI) delivers business growth, helps improve decisions, and transforms businesses to become more intelligent, automated, and scalable. DA: 39 PA: 62 MOZ Rank: 17 Artificial Intelligence (AI) - United States Department of State Artificial Intelligence (AI) A global technology revolution is now underway. The world’s leading powers are racing to develop and deploy new technologies like artificial intelligence and quantum computing that could shape everything about our lives – from where we get energy, to how we do our jobs, to how wars are fought. DA: 92 PA: 55 MOZ Rank: 58 Artificial Intelligence (AI) Definition - Investopedia Mar 08, 2021 · Artificial intelligence (AI) refers to the simulation of human intelligence in machines that are programmed to think like humans and mimic their actions. The term may also be applied to any machine... DA: 48 PA: 58 MOZ Rank: 25 Artificial intelligence | NIST Overview. Artificial Intelligence (AI) is rapidly transforming our world. Remarkable surges in AI capabilities have led to a wide range of innovations including autonomous vehicles and connected Internet of Things devices in our homes. AI is even contributing to the development of a brain-controlled robotic arm that can help a paralyzed person feel again through complex direct … DA: 35 PA: 26 MOZ Rank: 17 Artificial Intelligence (AI) – What it is and why it matters | SAS Artificial intelligence (AI) makes it possible for machines to learn from experience, adjust to new inputs and perform human-like tasks. Most AI examples that you hear about today – from chess-playing computers to self-driving cars – rely heavily on deep learning and natural language processing. Using these technologies, computers can be trained to accomplish specific tasks … DA: 98 PA: 93 MOZ Rank: 20 artificial intelligence | Definition, Examples, Types, Applications Artificial intelligence (AI) is the ability of a computer or a robot controlled by a computer to do tasks that are usually done by humans because they require human intelligence and discernment. Although there are no AIs that can perform the wide variety of tasks an ordinary human can do, some AIs can match humans in specific tasks. DA: 77 PA: 27 MOZ Rank: 33 What is AI? / Basic Questions - Stanford University A. It is the science and engineering of making intelligent machines, especially intelligent computer programs. It is related to the similar task of using computers to understand human intelligence, but AI does not have to confine itself to methods that are … DA: 21 PA: 96 MOZ Rank: 72 A tool that enables scientists, data journalists, data geeks, or anyone else to easily find datasets stored in thousands of repositories across the web. A new framework for flexible and reproducible reinforcement learning research DA: 69 PA: 35 MOZ Rank: 76 We would like to show you a description here but the site won’t allow us. DA: 51 PA: 22 MOZ Rank: 2
[ "Massachusetts General Laws", "Chapter 190B", "Legal research", "Artificial Intelligence", "IBM AI definition", "Oracle AI explanation", "US Department of State AI overview", "Investopedia AI definition", "NIST AI overview", "SAS AI applications", "Stanford University AI basics", "Reinforcemen...
[ "Massachusetts General Laws", "Chapter 190B", "Legal research", "Artificial Intelligence", "IBM AI definition", "Oracle AI explanation", "US Department of State AI overview", "Investopedia AI definition", "NIST AI overview", "SAS AI applications", "Stanford University AI basics", "Reinforcemen...
Hand-painted brush strokes in a free flowing design make this print calming and easy on the eye. Created by Noosa artist Cass Deller, Rose Connected is a muted pink with depth and contrast. This soft and stretchy bamboo jersey fabric allows you to swaddle your babe snugly and comfortably. Made from 95% bamboo and 5% elastin for stretch, this fabric is perfect for delicate skin. These wraps/swaddles are generous in size and have so many uses! Keep this on hand as a traditional swaddle, blanket, privacy for feeding, shade or an extra layer in your baby bag. Please note that colours may vary slightly from the photos and differ between batches. 100 x 100cm Made by Mulberry Threads Australia. Bamboo is a natural fabric and not treated with any chemicals, it may experience slight pilling during initial use in response to friction, however this is removed or reduced through the washing and drying process.
[ "hand-painted art", "calming design", "Noosa artist", "Cass Deller", "muted pink", "bamboo jersey fabric", "stretchable fabric", "baby swaddle", "comfortable swaddle", "multi-use wrap", "privacy for feeding", "shade cloth", "extra layer baby bag", "natural bamboo fabric", "chemical-free ...
[ "hand-painted art", "calming design", "Noosa artist", "Cass Deller", "muted pink", "bamboo jersey fabric", "stretchable fabric", "baby swaddle", "comfortable swaddle", "multi-use wrap", "privacy for feeding", "shade cloth", "extra layer baby bag", "natural bamboo fabric", "chemical-free ...
Indexed on: 01 Dec '70Published on: 01 Dec '70Published in: Earth, Moon, and Planets The previously developed geomorphic index of lunar surfaces is applied to the surface distribution of the lunar hot spots. It was found that the hot spot number density is the highest in areas of intermediate geomorphic index, corresponding to mature maria. Young and old maria and the terrae have fewer hot spots per unit area. An hypothesis is presented relating the probability of formation of a hot spot by impact with the evolutionary stage of the regolith of the target surface. The older is the surface, the deeper is the regolith and also the smaller is the average boulder size. For these reasons hot spots will be less probable. The paucity of hot spots in young maria could also be related with the evolution of the regolith, but fundamental changes in the petro-physics of the mare effusions cannot be ruled out.
[ "Geomorphic index", "Lunar hot spots", "Moon geology", "Regolith evolution", "Impact cratering", "Mare regions", "Terrae regions", "Surface age dating", "Planetary science", "Space exploration", "Geophysical processes", "Lunar surface characteristics", "Hot spot distribution", "Crater morp...
[ "Geomorphic index", "Lunar hot spots", "Moon geology", "Regolith evolution", "Impact cratering", "Mare regions", "Terrae regions", "Surface age dating", "Planetary science", "Space exploration", "Geophysical processes", "Lunar surface characteristics", "Hot spot distribution", "Crater morp...
California Creamery On-The-Go Guacamole Style Dip & Nacho Chips (Single) Regular priceSale price Unit price/ per Country of Origin: Product of USA Halal: Yes What better way to enjoy snack time than dipping crunchy tortilla chips in a guacamole dip. Satisfy your Mexican cravings with the classic combination of guacamole dip and tortilla chips. Convenient packaging for an on-the-go snack. Certified Halal Ingredients. Perfect combination of crispy tortilla and guacamole dip. Tasty all-in-one snack pack. comes with 1 Packet of Chips 2 Tubs of Guacamole Dip › Guten Free › Non-GMO verified › Contains: Milk › Made in a facility which handles wheat, gluten, dairy and soy
[ "Guacamole", "Tortilla chips", "Snack food", "Halal certified", "On-the-go snack", "Mexican cuisine", "Convenient packaging", "Non-GMO verified", "Dairy containing", "Made in USA", "All-in-one snack pack", "Gluten-free claim", "Crunchy chips", "Satisfies cravings", "Contains milk" ]
[ "Guacamole", "Tortilla chips", "Snack food", "Halal certified", "On-the-go snack", "Mexican cuisine", "Convenient packaging", "Non-GMO verified", "Dairy containing", "Made in USA", "All-in-one snack pack", "Gluten-free claim", "Crunchy chips", "Satisfies cravings", "Contains milk", "Ve...
18th March 2020: Coronavirus Update : As per the advice from the NSRA – The Government has advised everyone to avoid all but essential travel and that social gatherings should be avoided particularly groups that are deemed to be “vulnerable” or include vulnerable people. We believe that clubs should follow this common sense approach. The Chiltern Rifle Club range will remain closed till further notice.
[ "coronavirus update", "government advisory", "avoid non-essential travel", "social distancing", "club closure", "public health measures", "NSRA guidance", "vulnerable group protection", "range closure" ]
[ "coronavirus update", "government advisory", "avoid non-essential travel", "social distancing", "club closure", "public health measures", "NSRA guidance", "vulnerable group protection", "range closure", "reopening announcement", "mandatory quarantine", "travel restrictions lifted", "face mas...
Pet friendly care services Pets are important to people who need domiciliary care and support. They provide companionship, unconditional love and help focus the mind. Caring for a pet provides purpose, a routine and consistency to many people’s lives. Individuals may find the prospect of caring for their beloved pet becomes more daunting and stressful when they are ageing or unwell. However, there are proven benefits of living with a pet. At Bluebird Care, we offer a variety of services to help you or your loved one remain at home with the love and companionship of your furry friend. Our carers are dedicated to providing support and care so individuals can continue with their daily routines in the comfort and safety of their homes. Get in touch today to find out more about how we can help you and your family, and provide care and support at home. Benefits of Pets for the Elderly PDSA’s 2021 PAW report found that 87% of owners agree that having a pet makes them mentally healthier. Being around pets and animals has been proven to reduce stress, alleviate loneliness and even help children with emotional and social skills. Having a pet provides its owner with a sense of purpose. For someone living alone, this can bring structure and routine to their daily lives. Forbes found that when older adults were asked what an important benefit was of owning a pet, 63% of those who lived alone stated that the pet ‘gives a sense of purpose’ and ‘gives me someone to talk to’. The benefits of pets for the elderly aren’t just emotional – they can have a biological impact too. HABRI (Human Animal Bond Research Institute) states that the bond between owner and pet influences levels of blood pressure, heart rate and hormones. Even if older adults don’t live with a pet at home, they can experience great benefits just from interacting with an animal. Individuals can experience the same benefits as above by playing with and stroking the pets of family and friends. Cats and dogs that visit the elderly are known to bring joy and relaxation. Personal Pet and Home Care The onset of old age or illness doesn’t have to be a reason to give up your current lifestyle. Many pet owners worry about what happens to their pets when they get older. Pet and home care can go hand-in-hand so your loved one and their pet can stay at home together and continue making memories. If your loved one has a pet, as part of our domiciliary care service we will try and match them to a care assistant who also enjoys and understands animals. Your loved one and their carer will be able to share the pleasure of the special pet together. *Not all Bluebird Care offices provide this service. Please check with your local office if this service is available. How to find the right care for you or your relative Bluebird Care delivers care from locally based offices, find yours to start your care journey today. 2. Get in touch with us Fill in our call back form or give us a call to find out how we can help you. We’ll come out to you to find out what you or your loved one needs to help stay independent at home. 4. Care team chosen & care starts You'll be cared for by our specially trained team to support you to remain at home for as long as possible. Find care near you Enter your city or postcode below to find your local office
[ "pet friendly care", "domiciliary care services", "elderly pet ownership", "mental health benefits of pets", "companion animals for seniors", "home care assistance", "care for aging individuals", "animal-assisted therapy", "benefits of pets for mental health", "support for pet owners", "senior c...
[ "pet friendly care", "domiciliary care services", "elderly pet ownership", "mental health benefits of pets", "companion animals for seniors", "home care assistance", "care for aging individuals", "animal-assisted therapy", "benefits of pets for mental health", "support for pet owners", "senior c...
Getting Started with MATLAB: A Quick Introduction for - download pdf or read online By Rudra Pratap MATLAB, a software program package deal for high-performance numerical computation and visualization, is likely one of the most generally used instruments within the engineering box this day. Its wide allure lies in its interactive surroundings, which gains 1000s of integrated features for technical computation, snap shots, and animation. furthermore, MATLAB offers effortless extensibility with its personal high-level programming language.Enhanced through enjoyable and beautiful illustrations, Getting began with MATLAB employs an off-the-cuff, available writing kind that exhibits clients the way to get pleasure from utilizing MATLAB.Features* Discusses new good points and functions, together with the recent engine of symbolic computation in MATLAB 7.8 (released March 2009)* offers units of self guided tutorials for studying crucial beneficial properties of MATLAB* comprises up to date instructions, examples, determine, and graphs* Familiarizes clients with MATLAB in exactly a couple of hours even though self-guided classes* Covers common, complicated, and targeted services* vitamins any direction that makes use of MATLAB* Works as a stand-alone instructional and referenceVisit the spouse site at http://www.oup.com/us/pratap for additional information on updates to MATLAB software program. Read Online or Download Getting Started with MATLAB: A Quick Introduction for Scientists and Engineers PDF Similar software: systems: scientific computing books This ebook offers an individual wanting a primer on random signs and tactics with a hugely available creation to those topics. It assumes a minimum volume of mathematical history and makes a speciality of strategies, comparable phrases and fascinating functions to a number of fields. All of this can be prompted through various examples carried out with MATLAB, in addition to various workouts on the finish of every bankruptcy. Prof. Dr. Benker arbeitet am Fachbereich Mathematik und Informatik der Martin-Luther-Universität in Halle (Saale) und hält u. a. Vorlesungen zur Lösung mathematischer Probleme mit Computeralgebra-Systemen. Neben seinen Lehraufgaben forscht er auf dem Gebiet der mathematischen Optimierung. May be shipped from US. Used books won't contain spouse fabrics, could have a few shelf put on, may possibly include highlighting/notes, won't contain CDs or entry codes. a hundred% a refund warrantly. - Kalman Filtering: Theory and Practice Using MATLAB®, Third Edition - MATLAB® in bioscience and biotechnology - PTC Engineering Mathcad Worksheets - Finanzmathematik mit MATLAB - The Elements of MATLAB Style Extra resources for Getting Started with MATLAB: A Quick Introduction for Scientists and Engineers Same is true for columns. An array with m rows and n columns is called an m x n array and it has a total of m n entries. An element of the array is recognized by its location-its row number and column number. These row and column identifiers are called indices of t he maLrix. Thus A( i, j) refers to a specific element of matrix A located in the ith row and jth column. These locations are unique. In MATLAB, you can also use a list of numbers for the row and column indices to access more than one element of the matrix at a time. Here of A. x is the transpose of the tirst row 1 2 3 >> X I *X Matrix o r vector products are well define d be tw een c ompatibl e pairs. A ans ( x ) times a column vector ( x) of the same length gives the inner row vector 14'product, which i s a scalar, but a column >> vector times a row vector of the same x*x'length gives the outer product, which is ans a matrix. 1 2 3 >> 2 4 6 3 6 9 A*x ans Look how easy it is to multiply a vector w ith a matrix, compared with = 14 Fortran or Pascal. 32 50 » A" 2 You can even e xp onenti ate 30 66 102 >> 36 42 126 150 81 A *A. How to access an element, a row, a column, or a submatrix of a matrix. • How to multiply a matrix with a vector. • How to distinguish between array operation and matrix operation. Method: We will take a simp le 3 x 3 matrix and use its row and columns indices to manip ul at e the matrix, extract a vector, compute inner and outer product of vectors, multiply the matrix with a vector, exponentiate the matrix, and exponen tiat i ng each element of the matrix using an arra y operation. Commen ts: Arrays are the backbone of MATLAB computation.
[ "Matrix manipulation", "Vector multiplication", "Array operations", "Matrix exponentiation", "Software tutorial", "Mathematical computation", "Technical documentation", "Scientific computing", "Engineering education", "Programming guide", "MATLAB basics", "Numerical analysis", "Linear algebr...
[ "Matrix manipulation", "Vector multiplication", "Array operations", "Matrix exponentiation", "Software tutorial", "Mathematical computation", "Technical documentation", "Scientific computing", "Engineering education", "Programming guide", "MATLAB basics", "Numerical analysis", "Linear algebr...
Qatar and Online Censorship Qatar is a country with freedom of speech enshrined into its Constitution. Qatar is undoubtedly providing its citizens with a more open internet experience than other Middle Eastern countries in the region, however, Qatar still has online restrictions for its citizens. For example, the country blocks adult websites, along with censoring some political dissidents. The country also censors any content online that is critical of Islam. Because Qatar’s censorship denies citizens the ability to view certain websites on the web, many have turned to VPNs in order to be able to access content that would otherwise be blocked. How a VPN Can Help Qatar Internet Users Virtual private networks, or VPNs, are a great way for citizens of Qatar to access websites that are blocked within their specific geolocation. VPNs make the internet more accessible to those living in countries where the government makes the decision to block specific websites, however, VPNs are also useful for when a school, office, or other network blocks specific websites. For example, a school might block social media that might otherwise be available in the rest of the country. VPNs are relatively simple to setup, and work by hiding your IP address, encrypting your communications, and offering a secure connection to the internet. The ease of setting up a VPN means that you can use one on your desktop, laptop, or your mobile phone. No matter where you use the internet, a VPN can keep your device protected, your online activity hidden, and allow you access to websites that have been blocked in your specific geolocation. This is invaluable to citizens of Qatar, who cannot access all the websites the internet has to offer without using a VPN. VPNs have made the internet more accessible to those living in countries like Qatar. Making The Internet Experience More Private and Secure If you want to ensure that your online experience is completely private, then you need to maintain secure, encrypted connections to the internet. Unfortunately, most internet users aren’t using secure connections, which leaves them vulnerable to hackers, identity thieves, and other prying eyes. Hackers are everywhere, and anytime you use a public Wi-Fi network with an unsecure connection, you are putting your device, your personal and financial data, and anything else that you view online at risk. That is why VPNs have become so popular. VPNs aren’t only proficient at helping users access blocked websites. They are also great tools to keep your device secure and your online experience private and anonymous. All of the information that passes through a VPN is encrypted, meaning that even if some of the data that you viewed online was accessed, a hacker couldn’t read it due to the encryption. Whether you want to keep your online activities private from hackers, government entities, internet service providers, corporations, or all of the above, VPNs are the perfect tool for keeping your web surfing habits hidden. Download Hotspot Shield VPN. It’s Free! Join over 650 million users already enjoying absolute Internet Freedom around the world by downloading Hotspot Shield VPN.
[ "Internet censorship", "Freedom of speech", "Middle East politics", "Online restrictions", "VPN usage", "Citizens' rights", "Blocked websites", "Religious censorship", "Political dissent", "Privacy protection", "Encryption", "Secure connections", "Public Wi-Fi security", "Identity theft pr...
[ "Internet censorship", "Freedom of speech", "Middle East politics", "Online restrictions", "VPN usage", "Citizens' rights", "Blocked websites", "Religious censorship", "Political dissent", "Privacy protection", "Encryption", "Secure connections", "Public Wi-Fi security", "Identity theft pr...
Christ... loved the church and gave Himself for her, that He might sanctify and cleanse her with the washing of water by the word. Walk in love, as Christ also has loved us and given Himself for us, an offering and a sacrifice to God for a sweet-smelling aroma. Having been born again, not of corruptible seed but incorruptible, through the word of God which lives and abides forever. § Sanctify them by Your truth. Your word is truth. § Unless one is born of water and the Spirit, he cannot enter the kingdom of God. § Not by works of righteousness which we have done, but according to His mercy He saved us, through the washing of regeneration and renewing of the Holy Spirit. § Your word has given me life. The law of the Lord is perfect, converting the soul; the testimony of the Lord is sure, making wise the simple; the statutes of the Lord are right, rejoicing the heart; the commandment of the Lord is pure, enlightening the eyes. Eph. 5:25–26; 5:2; 1 Peter 1:23; John 17:17; 3:5; Titus 3:5; Ps. 119:50; 19:7–8 Through Him we both have access by one Spirit to the Father. I in them, and You in Me; that they may be made perfect in one. Whatever you ask in My name, that I will do, that the Father may be glorified in the Son. If you ask anything in My name, I will do it … And I will pray the Father, and He will give you another Helper, that He may abide with you forever—the Spirit of truth, whom the world cannot receive, because it neither sees Him nor knows Him; but you know Him, for He dwells with you and will be in you. § There is one body and one Spirit, just as you were called in one hope of your calling; one Lord, one faith, one baptism; one God and Father of all, who is above all, and through all, and in you all. § When you pray, say: Our Father in heaven. Brethren, having boldness to enter the Holiest by the blood of Jesus, by a new and living way …, let us draw near. Eph. 2:18; John 17:23; 14:13–14, 16–17; Eph. 4:4–6; Luke 11:2; Heb. 10:19–20, 22
[ "Christian theology", "Biblical passages", "Sanctification", "Regeneration", "Holy Spirit", "Divine love", "Prayer", "Salvation", "New Testament", "Spiritual rebirth", "Faith", "God's word", "Religious devotion", "Redemption", "Scriptural references", "Church teachings", "Heavenly fa...
[ "Christian theology", "Biblical passages", "Sanctification", "Regeneration", "Holy Spirit", "Divine love", "Prayer", "Salvation", "New Testament", "Spiritual rebirth", "Faith", "God's word", "Religious devotion", "Redemption", "Scriptural references", "Church teachings", "Heavenly fa...
Henry V Tamil Dubbed Movie Torrent ->->->-> DOWNLOAD (Mirror #1) In the midst of the Hundred Years War, the young King Henry V of England embarks on the conquest of France in 1415. Download Formats: M4V, AVI, MTS, MKV, M2TS, 3GP, ASF original title: Henry V duration: 2h 17min tags: The great adventure of a king who defied the odds to prove himself a man. keywords: king, battle, shakespeareplay, battleofagincourt, hundredyearswar, swordandshield, warviolence, henryv, shakespeare'shenryv, battlefield, france, england, kingdom, britishrenaissance, directorialdebut DOWNLOAD (Mirror #1) King Henry V of England is insulted by the King of France. As a result, he leads his army into battle against France. Along the way, the young king must struggle with the sinking morale of his troops and his own inner doubts. The war culminates at the bloody Battle of Agincourt. Young King Henry of England invades France in order to claim his right to a kingdom and to the daughter of the King of France in this second film adaptation of the Shakespeare play. Henry's small but embattled army meet the French forces on the field of Agincourt. The unique think about this film is that there aren't any weak performance amongst any of the actors, however small their role. One actor I feels merits a mention is Christopher Ravenscroft for his portrayal of the French Herald, Mountjoy. He plays a key part in this ply as the only character who meets both English and French leaders until after the battle. His shock and awe in the tennis balls scene when her realises that Henry isn't a silly young man is terrific. Great film. I've got on video and watch two or three times a year. My teenage sons were gripped by it. This is the way to introduce teenagers to Shakespeare. I admit that bringing Shakespeare to the big screen is tough. There are subtleties and nuances - and limitations - about stage productions that cinema simply can't capture. That being said, this is by far the best adaptation of Shakespeare to the big screen of the past fifteen years. The director does an admirable job of making every scene seem plausible - with slight suspension of disbelief - on stage. Kenneth Branagh, while he strikes me as a bit full of himself, is fantastic as the young, vain, ambitious title character, while Paul Scofield, Henry's French counterpart, delivers an equally impressive performance as the king who understands the gravity of Henry's invasion of France. Aside from Shakespeare's obvious bias toward British interests - which have little to do with the big-screen production - this is an amazing film. Straightforward, energetic, updated Bard. 28-year-old star-director-adapter Kenneth Branagh's spellbinding version of Shakespeare's Henry isn't superior to Olivier's 1944 version - it's different, and complementary to it. On your imaginary forces work. The Real Deal malayalam full movie free download A Gathering Storm full movie torrent The Negotiator 720p movies Midway tamil dubbed movie download Devil Hunter Yohko 5 full movie with english subtitles online download Metal Gear Solid 3: Snake Eater 720p Classic Thieves and Mynah Birds in hindi free download Download hindi movie The Adventures of Ford Fairlane Avengers: Infinity War tamil dubbed movie download Winner Takes All malayalam full movie free download
[ "Henry V", "Shakespearean adaptation", "Battle of Agincourt", "Hundred Years' War", "English-French conflict", "Film adaptation", "Historical drama", "Christopher Ravenscroft", "Kenneth Branagh", "Paul Scofield", "Tennis balls scene", "British Renaissance", "Directorial debut", "Teen-frien...
[ "Henry V", "Shakespearean adaptation", "Battle of Agincourt", "Hundred Years' War", "English-French conflict", "Film adaptation", "Historical drama", "Christopher Ravenscroft", "Kenneth Branagh", "Paul Scofield", "Tennis balls scene", "British Renaissance", "Directorial debut", "Teen-frien...
20" x 24" multimedia painting composed of acrylic paint and mirror pieces Cruel Universe was one of the first abstract paintings I used metallic and iridescent paints on. The border of the piece is lined with shards of broken mirror so the piece not only reflects random images as you walk by or stand in front of it, but it changes with the light levels in the room. With high light, the silver and gold pop out; in low light, they fade into the background. I wanted to create a piece that looked mystical, severe, and was as mutable as the day.
[ "Abstract art", "Multimedia painting", "Metallic paints", "Iridescent paints", "Mirror pieces", "Reflective artwork", "Light-sensitive art", "Silver and gold colors", "Room lighting effect", "Mutable art", "Severe aesthetics", "Mystical appearance", "Broken mirror shards", "High contrast a...
[ "Abstract art", "Multimedia painting", "Metallic paints", "Iridescent paints", "Mirror pieces", "Reflective artwork", "Light-sensitive art", "Silver and gold colors", "Room lighting effect", "Mutable art", "Severe aesthetics", "Mystical appearance", "Broken mirror shards", "High contrast a...
Watersports Algarve & Boa Vista Discovery the activities we have to offer!!! Active Sports Holidays is a water sports company that find the best places in the world to guarantee your enjoyment. We bet on a quality of service always with updated equipment and a very professional team. THE BEST PLACES IN THE WORLD!!! We offer activity for 365 days a year, you can make your vacation during the summer in Europe and enjoy a magnificent spot in Portugal or escape the cold weather from the European winter and spend a dream holidays in Cape Verde the choice is yours. The Algarve is known for its warm climate and its paradise beaches. The region is one of the best summer destinations in Europe for water sports, located in the extreme south of Portugal, 280 km from the capital Lisbon, about 2 to 3 hours from the big European capitals. The Boavista island is undoubtedly one of the most beautiful and with the best conditions for water sports of the 13 islands of Cape Verde located about 500-600 km in front the North African coast of Dakar, about 1000 kilometers south of the Canary Islands. DON’T WORRY THEY ORGANIZE EVERYTHING!!! We work with tour operators from several countries they are very professional in windsurf, kitesurf, Sup or surf trips, if you want a complete package including flights, accommodation and transfers contact us will inform you the best operators for what you need they find the best option for what you are looking for. We have a big range of activities to ensure your enjoyment: Windsurfing is amazing sport, the sensation of sailing on a board is something incredible with the right equipment you can learn in one of our sports in 2 hours and grow very quickly, everything depends on your willpower and dedication, you can also rent equipment and enjoy this magnificent sport in one of our centers. Kitesurfing is one of the most popular sports, easy to learn and with a very fast evolution you can make incredible maneuvers and feel the sensation of flying. Our experienced instructors will help you progress in this magnificent sport. We have lessons for all levels and equipment rental. always with maximum security and all our centers. The wingfoiling is a great innovation of water sports. You can sail above the water surface holding a kite in your hand and using a board with a foil you do not need any experience of another sport. We are pioneers in teaching wingfoiling in the Algarve and Boa Vista our instructors are also the best riders of both spots and developed their own teaching techniques very effective. Stand Up Paddle Surf is easy to learn just needs some balance and after a brief instruction you can already practice in flat water, to practice on the waves you need some instruction in our centers we have courses for all levels, our range of boards and very complete you can rent your favorite model and have fun in one of our magnificent spots. Surfing is an incredible sport the feeling of surfing is amazing, Algarve and Boa Vista are spots with fantastic waves you can do a surf course in one of our centers will be an unforgettable experience, we have a range of boards for all levels you can rent a beginner soft board, a classic long board or a short board depends on your skill or style of surfing. WHAT WE HAVE TO OFFER YOU!!! Search our services we have everything you need for spend the best holidays in your life. Our team will be ready to help you. Very nice and friendly staff that is really into windsurfing and kitesurfing Excelente sails, kites and boards Nice bar to relax between the battles! Best place in the World. Activities and services bookings Algarve: +351 939485321 Algarve 9.00 am -7.00 pm Mon. a Sun. Boa Vista 9.00 am -6.00 Mon. a Sun.
[ "water sports", "Algarve", "Boa Vista", "windsurfing", "kitesurfing", "surfing", "stand-up paddleboarding", "wingfoiling", "tourism", "travel packages", "vacation destination", "European tourism", "Portugal travel", "Cape Verde travel", "sport holiday", "summer destination", "winter ...
[ "water sports", "Algarve", "Boa Vista", "windsurfing", "kitesurfing", "surfing", "stand-up paddleboarding", "wingfoiling", "tourism", "travel packages", "vacation destination", "European tourism", "Portugal travel", "Cape Verde travel", "sport holiday", "summer destination", "winter ...
We visited PLAYMOBIL FunPark one Saturday morning in celebration of our youngest child’s third birthday. The name aptly says it all — a whole lot of different kinds of fun in a family-oriented play park! With over a dozen themed indoor and outdoor attractions, this leisure park did not disappoint. My children’s favorite outdoor features were the Medieval Knight’s Castle, Pirate Ship and Power Paddle Lake. They had a lot of fun exploring the watchtower, dungeon and underground passage of the castle, balancing through the wooden planks to get to the pirate ship, and riding on the paddle boats in the man-made lake. The climbing and winter play areas provided a nice setting for indoor fun and a much needed break for parents to sit down on benches while the kids burn more energy in a large, enclosed space. The HOB Center, PLAYMOBIL’s main hub for dining and entertainment, was equally impressive. A cafe and snack bar sit behind a large slew of dining booths where families can hang out. There is an adjoining pub and beer garden to purchase delicious meals and drinks. An impressive stage envelopes a corner of the center, where special shows are held on a regular basis. The highlight of the HOB center is PLAYMOBIL City, which is home to the life-sized versions of the beloved PLAYMOBIL Playtime Worlds. How to Get There Located in the town of Zirndorf near Nuremberg, PLAYMOBIL FunPark is 2 1/2 hours away from Stuttgart, a little over 3 hours from Kaiserslautern and just over 2 1/2 from Wiesbaden. Click on DB Bahn for train information. PLAYMOBIL’s regular hours and all attractions will open come spring season, commencing March 28. Click on PLAYMOBIL for more information about the park.
[ "PLAYMOBIL FunPark", "family-oriented play park", "themed indoor attractions", "themed outdoor attractions", "Medieval Knight's Castle", "Pirate Ship attraction", "Power Paddle Lake", "climbing area", "winter play area", "HOB Center", "PLAYMOBIL City", "cafes and snack bars", "dining booths"...
[ "PLAYMOBIL FunPark", "family-oriented play park", "themed indoor attractions", "themed outdoor attractions", "Medieval Knight's Castle", "Pirate Ship attraction", "Power Paddle Lake", "climbing area", "winter play area", "HOB Center", "PLAYMOBIL City", "cafes and snack bars", "dining booths"...
Who is Richard C Armitage? Richard Armitage is an English stage, film, TV, and voice actor, best known for playing ‘Thorin Oakenshield’ in ‘The Hobbit’ film series. A graduate from the ‘London Academy of Music and Dramatic Art’ (LAMDA), Armitage started his journey in the entertainment industry with theater. He then forayed into films and TV projects. His breakthrough role was that of ‘John Standring’ in the ‘BBC’ drama ‘Sparkhouse.’ He rose to fame in the UK with the lead role of ‘John Thornton’ in the British series ‘North & South.’ Following this, he gained worldwide fame for his portrayal of ‘Thorin Oakenshield’ in ‘The Hobbit’ film trilogy. He gained more fame with series such as ‘Robin Hood,’ ‘Spooks,’ and ‘Hannibal’. He earned an ‘Olivier Award’ nomination for the ‘Best Actor’ for his portrayal of ‘John Proctor’ in the stage production of ‘The Crucible’ at ‘The Old Vic. Armitage.’ He utilized his baritone voice to establish himself as a skilled voice actor. He has lent his voice to various TV and radio programs and commercials and has narrated several audio books. He voices lead roles in the web series ‘Castlevania’ and in the scripted podcast serial ‘Wolverine.’ Childhood & Early Life Richard Crispin Armitage was born on August 22, 1971, in Huncote, Leicestershire, England, to engineer John Armitage and his wife, Margaret, a secretary. He grew up with his older brother, Chris. Armitage studied at the ‘Huncote Community Primary School.’ He then attended a ‘Church of England’ mixed secondary school named ‘Brockington College,’ located in Enderby, Leicestershire, England. He played the cello, both in school and as part of local orchestras. He also learned to play the flute during this time. After obtaining a grant from the ‘Leicestershire Authority,’ Armitage transferred to the non-selective independent school named ‘Pattison College,’ which specializes in performing arts. He cleared his A Levels in music and English and completed his program in 1988. While attending the school, he also featured in local amateur and professional stage productions. He played an elf in a stage production of ‘The Hobbit’ at the ‘New Alexandra Theatre,’ Birmingham. Following his stint with ‘Pattison College,’ Armitage went to Budapest, Hungary, and remained part of ‘Nachtcircus’ for 6 months to earn his ‘Equity Card,’ so that he could start his professional entertainment career in the UK. Continue Reading Below You May Like Armitage commenced his career with musical theater as an assistant choreographer for Kenn Oldfield. During this time, he was part of musicals such as ‘Cats’ and ‘42nd Street.’ Meanwhile, he also started featuring in dramatic stage plays such as ‘Death of a Salesman’ and ‘The Real Thing.’ Armitage was a bit sceptical of choosing musical theater as his career path and thus resolved to continue his studies in acting. He joined ‘LAMDA’ in 1993 and did a 3-year program there before making his comeback on stage. He worked in ‘Hamlet’ (1998) and ‘The Four Alice Bakers’ (1999 for the ‘Birmingham Repertory Theatre.’ He also worked in ‘Macbeth’ (1999-2000) and ‘The Duchess of Malfi’ (2000–2001) for the ‘Royal Shakespeare Company.’ He starred as ‘Jez’ in the 2002 production of ‘Use Me as Your Cardigan’ by ‘Charm Offensive.’ One of his most notable stage performances was that of ‘John Proctor’ in ‘The Old Vic’ production of ‘The Crucible’ in 2014. The critically acclaimed and commercially successful play, directed by Yaël Farber, won Armitage the ‘Broadway World: UK Award’ for the ‘Best Leading Actor in a New Production of a Play’ that year. It also fetched him an ‘Olivier Award’ nomination in the ‘Best Actor’ category. The popularity of ‘The Crucible’ led ‘Digital Theatre’ to record it. It was then distributed to cinemas across the UK and Ireland. On March 17, 2015, ‘Digital Theatre’ made it available for digital download worldwide. Armitage played ‘Kenneth’ in the ‘Laura Pels Theater’ production of the play ‘Love, Love, Love’ in 2016. It marked his first leading theatrical role on the American stage. Films & Television While doing theater, Armitage started featuring in bit roles in both films and TV projects. He bagged his first starring role on TV when he was cast as ‘John Standring’ in the ‘BBC’ drama ‘Sparkhouse
[ "Actor", "Richard Armitage", "Thorin Oakenshield", "The Hobbit", "Film actor", "TV actor", "Voice actor", "Stage actor", "English actor", "John Thornton", "BBC", "LAMDA", "Nominated for Olivier Award", "The Crucible", "John Proctor", "Broadway World: UK Award", "Robin Hood", "Spook...
[ "Actor", "Richard Armitage", "Thorin Oakenshield", "The Hobbit", "Film actor", "TV actor", "Voice actor", "Stage actor", "English actor", "John Thornton", "BBC", "LAMDA", "Nominated for Olivier Award", "The Crucible", "John Proctor", "Broadway World: UK Award", "Robin Hood", "Spook...
Benjamin Gachet House facts for kids Quick facts for kids Benjamin Gachet House |Nearest city||Barnesville, Georgia| |Area||65 acres (26 ha)| |Architectural style||plantation plan| |NRHP reference No.||97000301| |Added to NRHP||April 17, 1997| The Benjamin Gachet House ( historically spelled Gachette) is a historic residence on GA 18, 3 miles west of Barnesville, Georgia. It was added to the National Register of Historic Places on April 17, 1997. The home is located at the crossing of Five Points Road and Piedmont Road, now known as the Milner Cross Roads, originally used as trails by Native American tribes. The General LaFayette connection Benjamin Gachet was a French nobleman who fled from a revolution in San Domingo and settled in what is now Lamar County. A historical marker dedicated by the Lamar-LaFayette Chapter of N.S.D.A.R. is at the site, stating that General Marquis de LaFayette stayed with Gachet at the home on March 19, 1825, during an official visit to Georgia. Additionally, Benjamin Gachet lived in Jones county adjacent to Baldwin county, where Milledgeville was being visited by General LaFayette in 1825. Historians surmise that the general visited Gachet around that time and location. So a family connection existed between the Gachets and the LaFayettes. The home was placed on the register, in part, due to it being an almost pristine example of plantation plan architecture. The chimneys and much of the clapboards are original. The kitchen, on the back of the house, off of the porch, was rebuilt. The two front bedrooms originally had separate entrances for each. The rooms have been referred to as "traveler's rooms", "preacher rooms" and "stranger's rooms". The Gachet house was known as a stagecoach stop in its history. Benjamin Gachet died at age 36 leaving several minor children and Mrs. Gachet likely earned a living to support her children by operating this stagecoach stop. Caroline M. Gachet Mrs. Gachet eventually sold the property to her son-in-law, Benjamin M. Milner, and moved to Alabama. The gravesite of Caroline M. Gachet (November 12, 1792 USA - December 24, 1876) is believed to be at the Enon Cemetery in Bullock County, Alabama. Benjamin Gachet House Facts for Kids. Kiddle Encyclopedia.
[ "Historic Residence", "National Register of Historic Places", "Plantation Plan Architecture", "Native American Trails", "General Lafayette Connection", "Stagecoach Stop", "Jones County, Georgia", "Lamar County, Georgia", "Milledgeville, Georgia", "French Nobleman", "San Domingo Revolution", "F...
[ "Historic Residence", "National Register of Historic Places", "Plantation Plan Architecture", "Native American Trails", "General Lafayette Connection", "Stagecoach Stop", "Jones County, Georgia", "Lamar County, Georgia", "Milledgeville, Georgia", "French Nobleman", "San Domingo Revolution", "F...
Broadnax in Brunswick County, Virginia — The American South (Mid-Atlantic) Bridges of Brunswick County Almost forty years later, to permit the operation of heavier steam locomotives, the Southern Railway installed new timber structural reinforcement called falsework. However, the timber falsework created a problem. Whenever the river rose there was the danger of the new falsework washing out and breaking the line. ln response, bridge gangs were sent by the railroad to keep it free of drift. In 1939 the problem was resolved when the Meherrin River Bridge was renewed with a new heavier truss and concrete piers as seen in the 1948 photo. The new prefabricated bridge span for the Tobacco Heritage Trail is supported by the 1939-installed piers. Steam locomotive 575 on the A&D line between West Norfolk and Suffolk H. Reid Railroad Trestle Bridge over Roses Creek, Lawrenceville Meherrin River Bridge, 1948William E. Griffin, Jr. Upper view of Railroad Trestle Bridge in Lawrenceville Erected by Tobacco Heritage Trail. Topics. This historical marker is listed in these topic lists: Bridges & Viaducts • Railroads & Streetcars. A significant historical year for this entry is 1893. Location. 36° 44.085′ N, 77° 56.919′ W. Marker is in Broadnax, Virginia, in Brunswick County. Marker is on Tobacco Heritage Trail, 0.6 miles east of Evans Creek Road (County Route 623), on the left when traveling east. Located at the Meherrin River crossing. Touch for map. Marker is in this post office area: Brodnax VA 23920, United States of America. Touch for directions. Other nearby markers. At least 8 other markers are within 5 miles of this marker, measured as the crow flies. You are Traveling Through the Scenic Meherrin River Watershed! (approx. 0.2 miles away); Tobacco As a Way of Life (approx. 0.6 miles away); The American Thoroughbred in Brunswick (approx. 3.3 miles away); Rolling Post Office (approx. 3.6 miles away); Hospital and School of the Good Shepherd (approx. 3.8 miles away); Staunton River Raid (approx. 4.2 miles away); Native Americans and Fort Christanna (approx. 4.6 miles away); Fort Christanna: Established 1714 (approx. 4.6 miles away). Touch for a list and map of all markers in Broadnax. Also see... Tobacco Heritage Trail. (Submitted on May 1, 2016.) Credits. This page was last revised on June 16, 2016. It was originally submitted on May 1, 2016, by Bernard Fisher of Richmond, Virginia. This page has been viewed 254 times since then and 15 times this year. Photos: 1, 2, 3. submitted on May 1, 2016, by Bernard Fisher of Richmond, Virginia.
[ "Historical marker", "Brunswick County, Virginia", "Southern Railway", "Meherrin River Bridge", "Bridge construction", "Railroad infrastructure", "Steam locomotives", "Concrete piers", "Prefabricated bridges", "Tobacco Heritage Trail", "American South", "Bridges and viaducts", "Railroads and...
[ "Historical marker", "Brunswick County, Virginia", "Southern Railway", "Meherrin River Bridge", "Bridge construction", "Railroad infrastructure", "Steam locomotives", "Concrete piers", "Prefabricated bridges", "Tobacco Heritage Trail", "American South", "Bridges and viaducts", "Railroads and...
Washington (Aug. 3) A spokesman for the War Department said today that authorization to send representatives to Germany to act as liaison officers between the U.S. military authorities and stateless and other Jews still held in camps, will be given to all principal Jewish organizations, and is not limited to any one group. “However, it is up to UNRRA to decide which groups are going, who is to be represented, and how many representatives they are to have,” he added. The War Department, he explained, decides only whether the individuals selected to go are satisfactory to the military authorities. The rest is up to UNRRA. UNNRA headquarters here told the JTA today that details have not yet been worked out, but that it is now considering applications from several organizations. The present relations between Jewish labor and industry in Palestine threaten: the continued prosperity of the country and is hampering industrial development, the Jewish Industrialists Association charged today in a cable to the World Zionist Conference in London. The cable urged that the conference empower the Jewish Agency to introduce compulsory arbitration of industrial disputes. Labor groupshave been opposed to such a proposal. Meanwhile, spokesmen for demobilized Jewish soldiers expressed the hope today that the London parley would demand that the Palestine Government make available for settlement by veterans all waste and government land in the country.
[ "War Department", "Jewish organizations", "UNRRA", "World Zionist Conference", "Palestine", "Jewish labor", "Industrial disputes", "Demobilized Jewish soldiers", "Arbitration", "Settlements", "Veterans", "Government land", "Jewish Agency", "London parley", "Stateless Jews", "Military a...
[ "War Department", "Jewish organizations", "UNRRA", "World Zionist Conference", "Palestine", "Jewish labor", "Industrial disputes", "Demobilized Jewish soldiers", "Arbitration", "Settlements", "Veterans", "Government land", "Jewish Agency", "London parley", "Stateless Jews", "Military a...
The Bibiyana gas field in Habiganj now contributes to more than half of the country’s total daily gas production. Even, the production volume exceeds its capacity when the demand surges. In the aftermath, the gas reserve in the field has already depleted by 95 per cent, while the remaining stock is anticipated to run out within a year if the current production trend persists. Experts, against such a backdrop, have warned that there might be a massive disaster in the gas supply if the gas field runs out of stock soon. Amidst the ongoing gas crisis, the country has witnessed a falling trend in production in the three largest gas fields – Titas in Brahmanbaria, Kailastila in Sylhet, and Rashidpur in Habiganj. The experts blamed the energy and mineral resources division’s negligence and inefficiency for the production slump. The authorities have geared up gas production in the Bibiyana field, though it has a lower reserve. In contrast, they do not have the required technical skills and technology to scale up production at the site with abundant stock of natural gas. There are a total of 28 active gas fields in the country. The Bangladesh Gas Field Company Limited (BGFCL) extracts gas from the largest Titas gas field, while Sylhet Gas Field Limited (SGFL) extracts gas in Kailastila and Rashidpur fields. They all are state-run entities. Chevron Bangladesh, the local chapter of US-based multinational company Chevron Corporation, produces the largest amount of gas from Bibiyana, even though the field ranks fourth in terms of gas reserves. According to Petrobangla and the energy and mineral resource division’s hydrocarbon unit, the Bibiyana gas field has a production capacity of 1,200 million cubic feet per day. Currently, the daily production at the site exceeds 1,100 million cubic feet from 26 wells. The authorities installed larger diameter pipes in the wells to boost production in 2021. The gas field had a gas storage of 254 BCF (billion cubic feet) until March this year. Around 120 BCF has been extracted in the last four months, with an average extraction rate of 30 BCF per month. The remaining stock is projected to be slightly over 130 BCF. The gas field is expected to run out of stock within four months if the current trend of gas extraction continues. Experts believe that the production rate will gradually go down at the site, while the reserve is likely to be completely exhausted by 2025. Sheikh Zahidur Rahman, spokesperson of Chevron Bangladesh, said they are using global expertise in reserve management to meet the current gas demands. They are also working to explore the production possibilities. Hope for more gas reserve The authorities had initially estimated the Bibiyana gas field’s reserve at 8,383 BCF during discovery, while the recoverable reserve was at 5,755 BCF. Around 5,501 BCF of gas has already been extracted from the field by March this year. Officials of Petrobangla said the gas reserve was estimated a long time ago. Chevron Bangladesh has extended its contract to operate the Bibiyana gas field until 2034 and is planning to enhance the reserve through new well drilling to meet the mounting demand. The company could not provide any specific figure for gas reserves. However, Petrobangla chairman Zanendra Nath Sarker ruled out the claim of imminent gas reserve exhaustion at Bibiyana, saying that it is inaccurate information and is being rectified. They are now collecting information again about the reserves. Besides, different measures are being taken to maintain the production levels. Interest in LNG Imports The 9 August marks the national energy security day. It is being observed with the theme of “Smart Bangladesher Prottay Jalani Sasray,” though there are no noticeable measures to curb gas consumption. Bangladesh has witnessed a decline in gas production since 2018, which prompted the authorities to go for liquefied natural gas (LNG) imports to bridge the deficit. Noted geologist Badrul Imam voiced concerns over the gas exhaustion as the government reports asserted the gas stock depletion. Gas production will go down on a large scale in the future. There will be no other choice if drilling of new wells does not ensure more gas reserves. Thus, overreliance on a single gas field may cause suffering, he said. The geologist further added that the authorities could have boosted production from the top three largest gas fields, but they are now focused on importing LNG.
[ "Gas field", "Energy production", "Natural gas", "Resource depletion", "Production capacity", "Gas crisis", "Technical skills", "State-run companies", "Reserve management", "Extraction rate", "Contract extension", "Exploration efforts", "National energy security", "Liquefied Natural Gas (L...
[ "Gas field", "Energy production", "Natural gas", "Resource depletion", "Production capacity", "Gas crisis", "Technical skills", "State-run companies", "Reserve management", "Extraction rate", "Contract extension", "Exploration efforts", "National energy security", "Liquefied Natural Gas (L...
Oly-Ola has Been Providing Professional Grade Lawn Edgings, Hardscape Edgings and Specialty Edgings to Landscape Contractors, Designers and Architects Since 1978 Made of 100% recycled PVC construction, our versatile 'L'-shaped design paver edgings keep pavers in place for the life of your projects, easily install under or outside pavers, allow for healthy turf growth alongside pavers and simply bend to make beautiful curves without the need for cutting. Constructed of 100% recycled polyethylene, our round top lawn edgings provide long lasting quality on the job. They divide turf from planting areas, keep mulch & stone in place and minimize hand trimming and lawn edger use. Constructed of 100% recycled materials, our low-profile lawn edgings provide nearly invisible borders and clean, well-defined bed lines. With no sharp edges, our lawn edgings are a safe alternative to metal, wood and concrete edgings. They are easy to heat to form logos and patterns. Made from 100% recycled PVC strengthened by impact modifier and UV inhibitor, our specialty edge restraints are available in 6” and 4” heights with 1.5” drainage slots on its vertical base and engineered to keep green roof materials, stone walkways & permeable pavers in place. - Edg-KeeperTM (Disc.) Our accessories keep the edgings connected and in the ground where they belong! To complement each of our edging products, we offer high quality anchoring stakes and connectors. Our “Made in the USA” stakes and connectors are manufactured with the same care and quality control as our edgings.
[ "landscape contractors", "designers and architects", "lawn edgings", "hardscape edgings", "specialty edgings", "recycled PVC", "paver edgings", "turf growth", "project longevity", "round top lawn edgings", "low-profile lawn edgings", "green roof materials", "stone walkways", "permeable pav...
[ "landscape contractors", "designers and architects", "lawn edgings", "hardscape edgings", "specialty edgings", "recycled PVC", "paver edgings", "turf growth", "project longevity", "round top lawn edgings", "low-profile lawn edgings", "green roof materials", "stone walkways", "permeable pav...
Come and discover the Musée Yves Saint Laurent Paris during a 1h15 guided tour before public opening hours. Located in the historic former haute couture house, the Musée Yves Saint Laurent Paris opened in October 2017 and presents the work of one of the most famous couturiers of the twentieth century in over 450 sq. m. of exhibition space. The museum visit also includes the couturier’s Studio, which has been preserved within the elegant hôtel particulier in the 16th arrondissement. From June 17th to December 5th 2020: « Yves Saint Laurent, Behind the scenes of haute couture in Lyon » exhibition. During this experience, places you will visit include: Tour of the Musée Yves Saint Laurent Paris price starts from $26.88. Tour of the Musée Yves Saint Laurent Paris cancellation policy: For a full refund, cancel at least 24 hours in advance of the start date of the experience. Tour of the Musée Yves Saint Laurent Paris is hosted by Cultival. Read reviews, discover additonal experiences or contact on Tripadvisor.
[ "Fashion Museum", "Haute Couture", "Yves Saint Laurent", "Paris Tour", "Guided Tour", "Museum Opening Hours", "Couturier Museum", "Historic House", "Studio Preservation", "Exhibition Space", "Hôtel Particulier", "16th Arrondissement", "Behind the Scenes Exhibition", "Lyon Haute Couture", ...
[ "Fashion Museum", "Haute Couture", "Yves Saint Laurent", "Paris Tour", "Guided Tour", "Museum Opening Hours", "Couturier Museum", "Historic House", "Studio Preservation", "Exhibition Space", "Hôtel Particulier", "16th Arrondissement", "Behind the Scenes Exhibition", "Lyon Haute Couture", ...
“[Paul Gives Thanks to God] I always thank my God for you and for the gracious gifts he has given you, now that you belong to Christ Jesus. Through him, God has enriched your church in every way—with all of your eloquent words and all of your knowledge.” (1 Corinthians 1:4-5) Holy Bible. New Living Translation copyright ©1996, 2004, 2007, 2013, 2015 by Tyndale House Foundation. Used by permission of Tyndale House Publishers Inc., Carol Stream, Illinois 60188. All rights reserved. Powered by BibleGateway.com
[ "Thanksgiving prayer", "Christian gratitude", "New Living Translation", "Scripture verse", "Religious text", "Corinthians", "Eloquence praise", "Knowledge praise", "God's grace", "Church enrichment", "Spiritual gifts", "Christ followers", "Bible passage", "Biblical reference", "Faithful ...
[ "Thanksgiving prayer", "Christian gratitude", "New Living Translation", "Scripture verse", "Religious text", "Corinthians", "Eloquence praise", "Knowledge praise", "God's grace", "Church enrichment", "Spiritual gifts", "Christ followers", "Bible passage", "Biblical reference", "Faithful ...
Norfolk is the second-most populous city in Hampton Roads Virginia, behind neighboring Virginia Beach. In 2013 the population was estimated to be 246,392 and the median household income was $42,644. Norfolk is located at the core of the Hampton Roads metropolitan area, notable for the large natural harbor of the same name located at the mouth of Chesapeake Bay. The city is bordered to the west by the Elizabeth River and also shares land borders with the cities of Chesapeake to its south and Virginia Beach to its east. One of the oldest of the cities in Hampton Roads, Norfolk is considered to be the historic, urban, financial, and cultural center of the region. The city has a long history as a strategic military and transportation point. The largest Navy base in the world, Naval Station Norfolk, is located in Norfolk along with one of NATO’s two Strategic Command headquarters. The city also has the corporate headquarters of Norfolk Southern Railway, one of North America’s principal Class I railroads, and regional headquarters for Maersk Line Limited, which manages the world’s largest fleet of US-flag vessels. It is home to Old Dominion University, a dynamic research institution. Bordered by multiple bodies of water, Norfolk has many miles of river and bayfront properties, including beaches on the Chesapeake Bay. It is linked to its neighbors by an extensive network of Interstate highways, bridges and tunnels.
[ "Hampton Roads", "Virginia", "Navy base", "Military hub", "Transportation point", "Elizabeth River", "Chesapeake Bay", "Strategic location", "Financial center", "Cultural center", "Old Dominion University", "Norfolk Southern Railway", "Maersk Line Limited", "Interstate highways", "Bridge...
[ "Hampton Roads", "Virginia", "Navy base", "Military hub", "Transportation point", "Elizabeth River", "Chesapeake Bay", "Strategic location", "Financial center", "Cultural center", "Old Dominion University", "Norfolk Southern Railway", "Maersk Line Limited", "Interstate highways", "Bridge...
Hi there ~ I appreciate your concern and understand that you had pain after intercourse due to a frenulum tear. I would recommend that you consult with your doctor to find out what the cause is. I also think that it would be in your best interest to get a surgical opinion as well. I hope this helps. Take care and have a lovely day!
[ "Frenulum tear", "Pain during intercourse", "Medical consultation recommendation", "Surgical opinion suggestion" ]
[ "Frenulum tear", "Pain during intercourse", "Medical consultation recommendation", "Surgical opinion suggestion", "Erectile dysfunction", "Penis curvature correction", "Vasectomy reversal", "Testicular cancer diagnosis" ]
Mackamine® FB48 is a 30% active lauramidopropylamine oxide that is stable over a wide pH range. It provides excellent foam boosting properties, viscosity building and foam stability in a wide spectrum of formulations. Mackamine® FB48 is especially effective when formulated with alkyl sulfates or alpha olefin sulfonates. Mackamine® FB48 also acts as a conditioning agent, having cationic character when formulated on the acid side. Solvay Novecare is an innovative developer and manufacturer of ingredients for Household, Industrial, and Institutional Cleaner applications. Its Repel®-O-Tex laundry detergent additives deliver superior fiber protection and stain removal. Solvay Novecare’s Mirapol® Surf-S aqueous polymer solutions yield effective spot-free cleaning and water sheeting and drying properties in hard surface applications.
[ "Cleaning agents", "Foam booster", "Viscosity builder", "Conditioning agent", "Lauramide propyl amido oxides", "Alkyl sulfates", "Alpha olefin sulfonates", "Formulation chemistry", "Household cleaners", "Industrial cleaners", "Institutional cleaners", "Repel-O-Tex", "Mirapol Surfs", "Stain...
[ "Cleaning agents", "Foam booster", "Viscosity builder", "Conditioning agent", "Lauramide propyl amido oxides", "Alkyl sulfates", "Alpha olefin sulfonates", "Formulation chemistry", "Household cleaners", "Industrial cleaners", "Institutional cleaners", "Repel-O-Tex", "Mirapol Surfs", "Stain...
Fuel Master How to work, Save your millage Final video of the 6 part series for frontlines fuel of war. Check out the last vid before time runs out. The countdown to war is ending at exeoinc****! TMJ Channel 4 Milwaukee explains how you can save fuel and money with the MPG pill. These MPG tablets improve fuel efficiency by 7-14%. And you can earn money by distributing these fuel saving capsules. Run Car On Water Instead Of Fuel Wanna know how to easily save hundreds each month by running your car on water instead of fuel gasoline? You can do that quickly and easily these days and save the earth as well. BP Ultimate is not an ordinary fuel, it is a range of advanced performance fuels, and is the superior choice to help you get more out of your vehicle. Run Car On Water For Fuel Wanna know how to easily save hundreds of $$$ each month by running your car on water for fuel? You can do that quickly and easily these days and save the earth as well. water for fuel salt water for fuel water as fuel for cars burning salt water for fuel use water for fuel hot water music fuel for the hate game water fuel for cars using water for fuel hot water music fuel for the hate Know about life imprisenment for RJD MP, Fuel prices hike, Pappu Yadav, shiv sainiks thrash couple in Uttar Pradesh on velentine day, Notification on delimetation commission, John Gloster to quit indian cricket team. This is incredible and just a little hard to believe, but you can use water for gas fuel to your car, see this video how it works and how to make your car run on water A commercial from Shell where scientists in a factory conduct a musical fire-filled symphony with a freakin fuel injector!!! So cool and don't miss the explosive ending! -- *******ebooks-guides****/#jeuxvideos -- technique sympa pour commander des jeux récents sans dépenser d'€z. frontlines fuel of war est le petit frère de battlefield : les explosions de frontlines fuel of war sont impressionantes. L'univers de frontlines fuel of war est frappé par une guerre de fou. Les balles fusent dans frontlines fuel of war et c'est de toute beauté. Les voix françaises de frontlines fuel of war sont bien retranscritent. frontlines fuel of war propose un eventail d'armes très variés et des véhicules. De plus les maps créées pour frontlines fuel of war sont immenses et le plus beau c'est que frontlines fuel of war dispose d'un mode 32 multijoueurs. frontlines fuel of war est dispo sur ps3, xbox 360, wii, pc Epileptic Gaming host Marcus "djWHEAT" Graham wants you and your friends to know about GGL's Frontlines: Fuel of War video gaming tournament going on now. *******epilepticgaming.ggl**** for more info. Go to MYRIDE.COM for more car videos. Have you ever wondered how a fuel cell works? Watch this video from Ballard Power and learn how hydrogen fuel cells will power the cars of tomorrow.
[ "fuel efficiency", "MPG pill", "car fuel alternatives", "running car on water", "BP Ultimate fuel", "hydrogen fuel cells", "Shell fuel commercials", "Frontlines Fuel of War video games", "video tutorials", "environmental benefits", "gas savings tips", "automotive technology", "alternative en...
[ "fuel efficiency", "MPG pill", "car fuel alternatives", "running car on water", "BP Ultimate fuel", "hydrogen fuel cells", "Shell fuel commercials", "Frontlines Fuel of War video games", "video tutorials", "environmental benefits", "gas savings tips", "automotive technology", "alternative en...
Create your own olive grove Olive trees, with their attractive greyish foliage, can be successfully grown in backyards as well as in a large pot in a sunny courtyard. They're hardy, dry-tolerant plants that grow well in cool to temperate climates. Salads, pizza, tapenade, pasta and breads are just a few delicious ways to enjoy olives, which are usually harvested in autumn. Different varieties are suited to different uses, such as Manzanillo for pickling, Kalamata for eating fresh and cooking and Frantolo for oil, and also for different climates, so pick a variety suitable for your area (and your favourite recipe). Also check your chosen olive to see if it will produce a better crop if cross- pollinated with another olive, with trees taking four to five years to bear fruit. When planting a new olive tree, mix some Dynamic Lifter into the planting hole and keep the soil moist while the olive establishes. Reapply every spring and autumn to encourage healthy growth and lots of olives. Soil tip: olives prefer a slightly alkaline soil (pH 7 - 8). In areas with acidic soil, apply some liquid lime and dolomite around the root zone to increase the pH.
[ "Olive cultivation", "Backyard gardening", "Potted plant care", "Climate adaptation", "Autumn harvest", "Edible landscaping", "Olive varieties", "Pickling methods", "Fresh olive consumption", "Cooking with olives", "Tree pollination", "Fruit-bearing time", "Planting techniques", "Soil amen...
[ "Olive cultivation", "Backyard gardening", "Potted plant care", "Climate adaptation", "Autumn harvest", "Edible landscaping", "Olive varieties", "Pickling methods", "Fresh olive consumption", "Cooking with olives", "Tree pollination", "Fruit-bearing time", "Planting techniques", "Soil amen...
A 'Beyond' Extraordinary Piece of Filmmaking The Place Beyond The Pines is without a doubt, one of the best most flawless movies I've seen in quite some time. It is a triumphant exercise in how actions and consequences affect the lives of those around us. The Place Beyond The Pines is about a travelling motorcycle stunt rider named Luke (Ryan Gosling) who reunites with an old flame of his named Romina (Eva Mendes) and realizes she is mothering his child. Once he finds out, he decides to quit the stunt riding gig and provide for his family. In order to do so, he takes up bank-robbing and becomes followed by a rookie cop-turned-politician named Avery (Bradley Cooper). What I Liked About It: Where do I begin here? I loved everything: the acting, the direction, the story, the beautiful scenery, etc. I loved how the film is essentially three different stories: The first one deals with Luke, the second one deals with Avery after his pursuit of Luke, and the final one shifts over 15 years later with both Avery and Luke's sons wrestling with the legacies they've inherited. Ryan Gosling delivers a solid performance as Luke, and Bradley Cooper delivers the best performance in the entire film as Avery. In this film, Cooper really showcases his dramatic acting chops and proves why he is one of the best actors working today, and not just a handsome face. Eva Mendes gives her best performance to date as Romina, Luke's longlost love interest torn between her child's father and her loyalty to her husband. But a few actors that also really stood out were Ben Mendelsohn, who plays Luke's friend Robin who is a former bank robber with a heart of gold, and Dane DeHaan, who plays an older version of Luke's son Jason, who longs for the truth about his father, but struggles to grasp it when he finds out. Another thing I really liked about this marvelous film was the direction. This is the first film I've seen from Derek Cianfrance, who also did Blue Valentine, which I haven't seen yet, but when I watched this film, I fell in love with how he directed it. Plus, the scenery, which was in upstate New York, which isn't far from where I live, was gorgeous. What I Didn't Like About It: Overall, The Place Beyond The Pines is a stunningly flawless epic dealing with themes of redemption, consequences, love, anger, father-son relationships, and most importantly, legacy. I would recommend it to anybody I know as I feel it is noy only a fantastic film, but a rather important film.
[ "Drama", "Filmmaking", "Redemption", "Consequences", "Father-Son Relationships", "Legacy", "Love", "Anger", "Bank Robbery", "Police Chase", "Motorcycle Stunts", "Rookie Cop", "Romantic Drama", "Upstate New York", "Character Development", "Emotional Depth", "Scenic Beauty", "Actors ...
[ "Drama", "Filmmaking", "Redemption", "Consequences", "Father-Son Relationships", "Legacy", "Love", "Anger", "Bank Robbery", "Police Chase", "Motorcycle Stunts", "Rookie Cop", "Romantic Drama", "Upstate New York", "Character Development", "Emotional Depth", "Scenic Beauty", "Actors ...
List of Resources Update 2014Posted: January 14, 2014 I will be adding to my list of resources for 2014: Morrill, Mandy. (2014): “Sibling Sexual Abuse: An Exploratory Study of Long-term Consequences for Self-esteem and Counseling Considerations.” Journal of Family Violence 1-9. http://rd.springer.com/article/10.1007/s10896-013-9571-4#page-1 Great advances have been made regarding the study of child sexual assault since the 1970’s. In spite of these advances, the gravity of sibling sexual abuse has largely been overlooked in sexual abuse literature. This paper uses peer reviewed research to highlight some of the major issues and unique long-term consequences associated with sibling sexual abuse. Specifically, an altered version of the Conflict Tactics Scale Straus (Journal of Marriage and the Family 41:75-88, 1979) and The Rosenberg Self-Esteem Scale Rosenberg (1965) were used to explore the long-term impact on self-esteem for those having experience with sibling sexual abuse as a child. In addition, clinical considerations for working with survivors, offenders, and families are provided. The following is from the preview provided by Springer (check out the article on Springer for a fully referenced article with full content): The feminist movement in the 1970s served as a major catalyst in moving the issue of domestic abuse into the conscious of mainstream America. Since that time, there has been tremendous advance in the study of abuse in the family. Today, professionals recognize childhood sexual abuse within the family as a significant and widespread problem with consequences lasting long into adulthood. Despite this progression, the research related to interfamilial incest conducted by social science researchers over the past three decades has focused primarily on father to daughter incest; largely ignoring the experience of sibling sexual assault. Sibling sexual assault is more common than parental incest. Caffaro and Conn-Caffaro concluded that sibling incest and assault occur more frequently than parent-child incest and assault, even though sibling incest is one of the most under reported forms of abuse. Bess and Janssen found 60% of psychiatric outpatients had experienced some form of sibling incest. A study by Rudd & Herzberger indicated that 23% of incest survivors are sibling incest survivors. Clearly, sibling incest is a pandemic problem that requires more attention from mental health professionals. Understanding why sibling sexual abuse occurs is complex. One of the main factors contributing to this phenomenon is the family environment. Maladaptive parental behavior and dysfunctional family structures have an impact on the sibling relationship. When the family structure supports power imbalances, rigid gender roles, differential treatment of siblings, and lack of parental supervision, the risk for sibling sexual abuse increases. Rowntree conducted a qualitative study of 19 adult female survivors of sibling sexual abuse in which it was found that the minimization of the abuse when disclosed had an impact on the severity and perception of the abuse. In a study conducted by Wiehe, the normalization of abuse by parents was found to be a critical element in the severity and frequency of abuse among siblings. When parents either model inappropriate sexual interaction or are unable to acknowledge inappropriate sexual interactions in their children, it is likely that one child will begin or continue to inflict sexual abuse on a sibling because he or she is modeling the actions of his or her parents. Sibling Sexual Abuse In spite of lack of empirical research on the topic, it is likely that sexual abuse among siblings occurs more frequently than any other form of sexual abuse. Defining the specifics of sibling sexual abuse has lacked consistency and clarity in previous research, which has been a hindrance in terms of moving forward with needed empirical analysis. As such, this study offers a clear and detailed definition of sibling sexual abuse. Sibling sexual abuse is defined as sexual behavior between siblings that is not age appropriate, not transitory and not motived by developmentally appropriate curiosity. Some examples of this behavior include inappropriate fondling, touching, sexual contact, groping, indecent exposure, masturbation, exposure to pornography, oral sex, anal, sex, digital penetration, and intercourse. While there has been debate as to whether or not non-physical aspects of sibling sexual abuse, such as forced exposure to pornography or sexual leering, are as harmful as physical sexual assault, this study supports the notion that all acts of sibling sexual abuse hold the potential to be equally harmful. Ybarra and Mitchell found that exposure to pornography as a child, which is not self-seeking or developmentally appropriate, results in a high correlation with substance abuse, depression, attachment issues, and delinquent behavior. Seto conducted a meta-analysis of 59 studies in which the results suggest forced exposure to pornography (particularly in which sexually violent acts occur) can lead to significantly higher rates of anxiety, low self-esteem, and social isolation. Additionally, it has been shown that unwanted sexual
[ "Sibling Sexual Abuse", "Childhood Sexual Assault", "Family Violence", "Self-Esteem Impact", "Clinical Considerations", "Research Article", "Peer Reviewed Research", "Rosenberg Self-Esteem Scale", "Conflict Tactics Scale", "Domestic Abuse", "Interfamilial Incest", "Psychiatric Outpatients", ...
[ "Sibling Sexual Abuse", "Childhood Sexual Assault", "Family Violence", "Self-Esteem Impact", "Clinical Considerations", "Research Article", "Peer Reviewed Research", "Rosenberg Self-Esteem Scale", "Conflict Tactics Scale", "Domestic Abuse", "Interfamilial Incest", "Psychiatric Outpatients", ...
In September 2003, Friends of the Hervey/Point Loma Branch Library sponsored a concert in the brand new community room weeks after it opened. After the concert, Judy Eby, a member of the Friends of the Library, Glen Fisher, Larry Zieger and Christine Gonzalez, library branch manager, talked about the lack of opportunity to participate in choral music programs in the Point Loma community. Judy Eby proposed starting a chorus that would meet in the community room, and the library enthusiastically supported the idea. On December 3, 2003, an organizational meeting was held, attended by Judy Eby, Terry Russell, Glen Fisher, Christine Gonzalez, Larry Zieger, and Dean Hanna. At the 4th organizational meeting, the committee agreed on the name: Peninsula Singers. The non-profit organization has partnered with the Hervey Family/Point Loma Library, the Point Loma High School Choir, Southwestern Community College and other school and community choral groups in the San Diego area to create a model program. There are approximately 60 active singing members, with no audition requirement. Peninsula Singers accompanist Stewart Simon is an accomplished solo pianist and teacher beyond his commitments with the chorus. Artistic Director Sarah Suhonen frequently conducts, and the group Presidents have included singer Vanessa Dinning. As of 2018, the choir was performing a free concert at the Point Loma Hervey Branch Library every season. Members span all generations and abilities, from hobbyists to professional singers. The choir has sung at Carnegie Hall and, for its tenth anniversary, completed a European Concert Tour, as well as touring Ireland in June 2018.
[ "Community choir", "Hervey Branch Library", "Point Loma community", "Choral music programs", "Library partnership", "San Diego area", "Non-profit organization", "Free concerts", "Artistic director", "Accompanist", "Carnegie Hall performance", "European tour", "Ireland tour", "Organizationa...
[ "Community choir", "Hervey Branch Library", "Point Loma community", "Choral music programs", "Library partnership", "San Diego area", "Non-profit organization", "Free concerts", "Artistic director", "Accompanist", "Carnegie Hall performance", "European tour", "Ireland tour", "Organizationa...
Hydra close-up: New Horizons probe captures Pluto’s tiny moon Ahead of a rendezvous with Pluto in July 2015, NASA’s New Horizons space probe has imaged the dwarf planet’s tiny moon, Hydra. Pluto’s neighborhood is poorly explored and scientists want to make sure there is no space debris in the probe’s way. The spacecraft made a historic portrait of Pluto and its moons using a telescopic camera called LORRI (Long Range Reconnaissance Imager) from a distance of 430 million kilometers. The images were taken back in July, but released on the mission’s official page on September 12. The scientists did not expect to see Hydra because of its tiny size, but the probe’s 48 10-second exposure pictures, when combined into one high-contrast view of Pluto’s neighborhood, made it possible to identify the moon on the overexposed image. The fact that the LORRI camera managed to capture such a small space object from such a huge distance gave the New Horizons team confidence that, if there the probe meets an obstacle, they’ll notice it beforehand. “Using those techniques, Hydra popped right out of the data, though it’s still very faint — several times fainter than the faintest objects the New Horizons camera was designed to detect — and still very close to Pluto,” John Spencer, of the Southwest Research Institute and member of the New Horizons Science Team, told the Discovery science news outlet. “We’re thrilled to see it, because it shows that our satellite-search techniques work, and that our camera is operating superbly. But it’s also exciting just to see a third member of the Pluto system come into view, as proof that we’re almost there!” he added. The NASA specialists spotted Hydra, one of Pluto’s five moons, back in 2005, processing the photos taken by the Hubble Space Telescope. Launched in January 2006, the New Horizons spacecraft now traveling to Pluto and the Kuiper Belt is among NASA’s most famous and challenging exploration missions. The spacecraft will become the first manmade object to have a close encounter with Pluto on July 14, 2015. While approaching Pluto, the New Horizons probe will conduct two series of long-exposure mosaic photos, in May and June 2015. In late August this year, the piano-sized spacecraft full of sophisticated equipment crossed Neptune’s orbit some 4.25 billion kilometers from Earth. It has taken eight years and eight months, a record distance in space exploration. A series of photos taken in July this year of Pluto and its biggest moon Charon orbiting its icy master planet at a very close orbit rose speculations in scientific circles that both might share the same atmosphere, being a so-called ‘binary planet’ system.
[ "Pluto", "New Horizons probe", "Space exploration", "NASA", "Solar System", "Dwarf planets", "Moon discovery", "Satellite imaging", "Telescopic cameras", "Kuiper Belt", "Planetary science", "Hubble Space Telescope", "Astrophysics", "Orbital mechanics", "Pluto's moons", "Space debris de...
[ "Pluto", "New Horizons probe", "Space exploration", "NASA", "Solar System", "Dwarf planets", "Moon discovery", "Satellite imaging", "Telescopic cameras", "Kuiper Belt", "Planetary science", "Hubble Space Telescope", "Astrophysics", "Orbital mechanics", "Pluto's moons", "Space debris de...
2019 CSCE Annual Conference - Laval (Greater Montreal) Conference Dr. Ossama Hosny, AUC Dr. Elkhayam Dorra, American University in Cairo Dr. Ahmed Waly, The American University in Cairo Whether forced by economic conditions or internal motivations, contractors may choose to minimize their mark-up margins in order to maximize their chances of winning a bid. In such cases, they are often more focused to submit bids with the lowest price possible with less regard to the proper profit or contingency margins needed to execute the project. Such drastic bidding conditions render contractors sensitive towards all types of risks associated with executing a project. This is why it is important for contractors to fully understand intricate risk dynamics for effective and efficient risk management. This paper explores risk identification and classification through the risk path approach as a substitute for the traditional risk source-risk factor approach mostly used in Egypt till this day. An ontology model is developed to illustrate the identified risk path, the interdependent relations amongst its elements, and its effect on projects’ costs overruns. The risk path identified in this paper consists mainly of risk elements and vulnerability factors, where risk elements are project uncertainties categorized according to their places within the risk path while vulnerability factors are project vulnerabilities that determines the extent or capacity to resist or cope with risk elements. Risk elements consist of risk sources, risk events, and risk consequences, while vulnerability factors consist of robustness factors, resistance factors and sensitivity factors. An artificial neural network (ANN) is then constructed based on the information logged in the ontology model, where training and testing cases are retrieved from surveying both the literature and experts in the Egyptian construction field. Simulations are conducted using the ANN algorithm to establish the sensitivity of cost overruns to each of the identified risk elements and vulnerability factors. Following this enhanced understanding of risk elements, their relation, and their effect on cost overruns, the paper identifies and develops contract conditions that effectively address the identified risk elements with the greatest impact on projects’ costs. Such information allows contractors to minimize such costs, thus enabling them to minimize their contingency estimates and, consequently, reduce their bid prices.
[ "Construction risk management", "Contractor bidding strategies", "Risk element identification", "Project uncertainty analysis", "Cost overrun prevention", "Artificial Neural Networks (ANN)", "Ontology models in construction", "Economic conditions influence on contracts", "Internal motivation in cont...
[ "Construction risk management", "Contractor bidding strategies", "Risk element identification", "Project uncertainty analysis", "Cost overrun prevention", "Artificial Neural Networks (ANN)", "Ontology models in construction", "Economic conditions influence on contracts", "Internal motivation in cont...
From our What a Coincidence! desk Several weeks ago the hardworking staff over at Campaign Outsider posted an item headlined Sign o’ the Time: Everything for Sale at Newsweekly, which included this ad from the December 29 Boston Sunday Globe: Imagine our surprise, then, when we saw this in yesterday’s Boston Sunday Globe: Seven things you should know about Ray Ciccolo Over the last half century, Village Automotive Group has grown into one of the state’s largest automobile dealers, with more than 400 employees at eight locations. President Ray Ciccolo recently chatted with Globe reporter Erin Ailworth about how it all started. Here’s what she found out: Ciccolo was only 24, but he already owned two coin-operated launderettes when he walked into the Gene Brown Rambler/Volvo dealership in Newton Centre looking to buy a “little, fuel efficient” Volkswagen to replace an old Buickhe had rebuilt from junkyard parts. Instead, he listened to a friend working at the dealership. Ciccolo left with a gas-guzzling Lincoln Continental — it got just three miles to the gallon — and plans to purchase the business... Not to get technical about it, but there are really eight things you should know about Ray Ciccolo. We’re not saying there was any explicit pay-for-play arrangement here, but it’s hard to believe that a business editor wouldn’t know if an interview subject had run full-page ads in the paper, especially such self-aggrandizing ones. That might give the average editor pause, yes? Well, in this case, no. Coals to Newcastle, there’s also this on Page One of today’s Globe Score section. When Globe owner John Henry gave a speech to the Greater Boston Chamber of Commerce the other week, he talked about new sponsored sections like Score that would deliver added valued to advertisers. That led the hardreading staff to wonder what exactly Globe sponsors would get. We’re wondering even more now.
[ "Media ethics", "Journalism integrity", "Pay-for-play", "Advertising controversy", "Business journalism", "Automotive industry", "Newspaper ownership", "Globe Score section", "Boston Sunday Globe", "Village Automotive Group", "Ray Ciccolo interview", "John Henry speech", "Greater Boston Cham...
[ "Media ethics", "Journalism integrity", "Pay-for-play", "Advertising controversy", "Business journalism", "Automotive industry", "Newspaper ownership", "Globe Score section", "Boston Sunday Globe", "Village Automotive Group", "Ray Ciccolo interview", "John Henry speech", "Greater Boston Cham...
OLYMPIA, Wash.--Five Washington school districts are being honored by the College Board for their students' Advanced Placement (AP) test participation. The districts are Olympia, Seattle, Bellevue, Northshore and Shoreline. Those districts are on the 2011 AP Achievement List for giving more students an opportunity to do college-level work while still in high school. Less than 400 school districts in the nation received this honor. College Board selected the Seattle School District for offering AP courses to a broader pool of students, while still maintaining or improving the percentage of students earning scores of 3, the score typically needed to earn college credit, or higher. In three years, the district also increased the number of students participating in AP classes by nearly 250 students. We are immensely proud of our Seattle Public Schools students who are taking AP exams and doing college-level work, said Dr. Susan Enfield, Interim SPS Superintendent. It is clear that a growing number of our students see the value in pursuing challenging educational opportunities while in high school, and we are fortunate to have outstanding teachers and principals to guide them along the way. The AP Achievement List is made up of all school districts that are simultaneously expanding opportunity and improving performance, so even low-performing districts are included if they have been able to maintain or improve scores while expanding access. The list includes 388 school districts representing 43 states. Participation in college-level AP courses can level the playing field for underserved students, give them the confidence needed to succeed in college, and raise standards and performance in key subjects like science and math, said College Board President Gaston Caperton. The AP Achievement List districts are defying expectations by expanding access while enabling their students to maintain or improve their AP Exam scores. The complete AP Achievement List can be found at www.collegeboard.org. The Associated Press contributed to this report.
[ "Advanced Placement", "School District Recognition", "College Board Awards", "Student Performance", "Educational Opportunities", "High School Curriculum", "College-Level Work", "Test Participation", "Seattle School District", "Bellevue School District", "Northshore School District", "Shoreline...
[ "Advanced Placement", "School District Recognition", "College Board Awards", "Student Performance", "Educational Opportunities", "High School Curriculum", "College-Level Work", "Test Participation", "Seattle School District", "Bellevue School District", "Northshore School District", "Shoreline...
A simple and efficient image viewer, editor and slideshow makerFreeVimager is a lightweight tool that lets you view your images in a clean layout with the possibility to resize, rotate and crop them as well as convert them to various other formats. In the straightforward interface you can quickly load images via drag and drop or using the built-in file browser. Also, you can view photos in full screen mode, zoom in and out, and navigate through them. The program provides a few basic customization options, allowing you to enable high quality stretch, hide the borders and select a different background color. However, FreeVimages lets you create a slideshow as well providing options to define its transition type and delay, use the random mode and turn on infinite loop. You can then play the slideshow in the app as well. Furthermore, the program offers a dedicated tool for renaming and resizing images with batch processing support. Other useful options include the ability to set file associations, view file details, run the app in multiple instances, set it to automatically launch at system startup and many others. FreeVimager Download Information May 17, 2022 4.6 / 5 (8 votes) Not yet reviewed
[ "Image Viewer", "Image Editor", "Slideshow Maker", "File Browser", "Full Screen Mode", "Zoom In Out", "Rotate Images", "Crop Images", "Resize Images", "Convert Formats", "High Quality Stretch", "Background Color Customization", "Batch Processing", "Rename Images", "Set File Associations"...
[ "Image Viewer", "Image Editor", "Slideshow Maker", "File Browser", "Full Screen Mode", "Zoom In Out", "Rotate Images", "Crop Images", "Resize Images", "Convert Formats", "High Quality Stretch", "Background Color Customization", "Batch Processing", "Rename Images", "Set File Associations"...
one cosmetic thing that annoys me with my MegaSTE is the extremely dim power LED. At first I assumed this was simply due to old age. But then I measured the current: only about 2 - 3 mA, which is much less than one can expect according to the schematic: http://gossuin.be/images/schemasatari/MEGA%20STE.pdf . According to that, only R290 (120 ohm) is in series between +5V and the power LED, so there should be around 20 mA, which is a typical current for LEDs. I measured with the continuity tester and found that in fact R421 (1 kohm) is in series with the power LED, while R290 is connected to the jumper W401 where R421 is supposed to be used. Like so (click on the picture to see a much less blurry version): I always assumed that a previous owner had rewired that resistors for whatever reason. However, today I planned to fix this and had a look at the bottom side of the PCB: that mixup is already in the PCB layout! No traces have been cut and rewired. The resistors were populated according to the BOM, but the layout doesn't match the schematic. Now I wonder: is this an error in the PCB revision of my MegaSTE only? Is it always the case? Wouldn't that mean that a lot power MegaSTE power LEDs are incredibly dim? I'm now thinking about either swapping the resistors or replacing the LED with a low-current type that already shines brightly at 2 mA. You do not have the required permissions to view the files attached to this post.
[ "Cosmetic issue", "Power LED problem", "Electronics repair", "PCB layout error", "Resistor mismatch", "Schematic vs PCB discrepancy", "MegaSTE troubleshooting", "LED brightness control", "Current measurement", "Continuity testing", "Electronic components", "DIY electronics", "Consumer electr...
[ "Cosmetic issue", "Power LED problem", "Electronics repair", "PCB layout error", "Resistor mismatch", "Schematic vs PCB discrepancy", "MegaSTE troubleshooting", "LED brightness control", "Current measurement", "Continuity testing", "Electronic components", "DIY electronics", "Consumer electr...
热门关键词:亚搏手机app官方网站入口 | 济南复合板 | 亚搏手机app官方网站入口 | 济南c型钢 | 济南钢结构 | In the construction industry, the pattern of brick, tile, ash and stone as the main building materials has been changed, and color steel plate structure buildings have emerged. But there are also its shortcomings, such as color steel plate. The main problem is that there is leakage at the rivets and plate joints of the roof, which affects the normal use. Through research, test and construction, relevant experts have summarized some effective maintenance methods for water seepage of large-scale color steel sheet roofs. Jinan color steel plate manufacturer explains: 1、 Repair method for water leakage at rivets: apply sunshine one-component waterproof adhesive for 4 times, with a thickness of about 1.5mm and a diameter of about 50-60mm. The next painting shall be subject to the non stick hand of the previous coating, and the diameter of each painting shall be larger than that of the previous painting, with a thickness of the middle and a thickness of the circumference. In this way, the rivet will not leak. 2、 Rain leakage method of color steel plate joints: 1. 60mm wide sunshine 2000Pa single component waterproof adhesive can be applied at both ends of the joint, and 20mm adjacent to the joint is not applied. 2. Non woven fabric, 150mm wide, pasted on the surface coated with sunshine 2000Pa waterproof adhesive. 3. Brush the non-woven fabric or glass fiber cloth for 3 times. When painting, the latter one is 50mm wider and 1.8mm thicker than the previous one. The next brushing shall be subject to the non stick hand of the previous coating. The comprehensive benefits of steel structure buildings are significant. Steel structure buildings are easy to realize factory and large-scale production. Compared with traditional brick concrete structures and reinforced concrete structures, they have shorter construction cycle, less on-site labor, higher labor productivity and easier quality assurance. Another outstanding advantage of steel structure building is its light weight, good ductility and excellent seismic performance. For a country with many earthquake disasters, it can obviously reduce the losses caused by earthquakes. The color steel room has good thermal insulation performance, which is conducive to building energy conservation. At the same time, the steel can be recycled, which is in line with the policy of "vigorously developing circular economy and building a conservation oriented society". China's steel supply is sufficient, and domestic steel can meet the needs of steel structure construction in terms of quality, price, variety and specification. The ratio of strength to gravity of the steel structure is 3, and the ratio of strength to gravity is 14. Therefore, the steel structure is a light structure with small structural area, good ductility and good seismic performance. The advantages of steel structure building such as fast construction speed, high space utilization rate, flexible indoor layout and small construction site are also very prominent, which are favored by developers. Pay attention to some details. Generally speaking, color steel plates will not have many problems, so color steel plates are good building materials in building materials. You can come to our website anytime you need Consult and understand!
[ "Construction materials", "Color steel plate", "Steel structure", "Building materials", "Roof maintenance", "Waterproofing techniques", "Rivets repair", "Seismic performance", "Thermal insulation", "Recyclable materials", "Factory production", "Labor efficiency", "Energy conservation", "Ec...
[ "Construction materials", "Color steel plate", "Steel structure", "Building materials", "Roof maintenance", "Waterproofing techniques", "Rivets repair", "Seismic performance", "Thermal insulation", "Recyclable materials", "Factory production", "Labor efficiency", "Energy conservation", "Ec...
The total scattering rate and the transition probability for electron-phonon interaction in 1-D and 2-D semiconductor materials are calculated in taking into account the finite dimensions of the structure. Although noticeable, size effects on the scattering rate are generally small, with more pronounced features for 1-D structures than for 2-D structures. For 2-D layers, our theory agrees with recent experimental results whereas it contradicts the previous theory predicting large size effects and mass-independent electron-phonon scattering rates. In 1-D structures singularities in the phonon emission rate appear as a natural consequence of the 1-D density of states. However, for high energy the 1-D emission rate is found smaller than the corresponding 3-D rate. An additional consequence of the confinement is the quenching of the phonon absorption rate. ASJC Scopus subject areas - General Physics and Astronomy
[ "Electron-phonon interaction", "Scattering rate calculation", "Semiconductor materials", "Finite dimensional structures", "Size effects on scattering", "Transition probabilities", "Density of states", "Experimental results comparison", "Theoretical contradictions", "Confinement effects", "Phonon...
[ "Electron-phonon interaction", "Scattering rate calculation", "Semiconductor materials", "Finite dimensional structures", "Size effects on scattering", "Transition probabilities", "Density of states", "Experimental results comparison", "Theoretical contradictions", "Confinement effects", "Phonon...
Helios is an open world Action RPG, with a action based combat system. Therefore the player is forced to aim in order to hit a monster rather then bashing buttons. But fighting is not the only thing that you can do, growing your own vegetables is an ease. Those vegetables can then be cooked into a tasty stew and consumed for more health. Also you have the ability to gather you're own ore's and craft these into the most amaizing weapons there are. Monsters won't drop any weapons, armor or gold. Instead they will drop more plausible items like fur, bones, teeth, etc. These can then be used for crafting your items.
[ "Action RPG", "Open World Game", "Combat System", "Vegetable Growing", "Cooking", "Crafting Weapons", "Monster Hunting", "Resource Gathering", "No Loot Drops", "Crafting Materials" ]
[ "Action RPG", "Open World Game", "Combat System", "Vegetable Growing", "Cooking", "Crafting Weapons", "Monster Hunting", "Resource Gathering", "No Loot Drops", "Crafting Materials", "Drop Weaponry from Monsters", "Gold Dropped by Enemies", "Level Up System", "Experience Points", "Charact...
Middle and low pressure valves The standard line of VAPTECH Butterfly valves cover a diameter range from 300 to 1400 mm and pressure ratings pf 6, 10, 16 and 25 bar. The standard valve actuation is realized with a hydraulic cylinder and is closed by counter weight. Outside of VAPTECHs’ standard product, butterfly valves are developed with specific pressure ratings of up to 40 bar and diameter up to 5000 mm. Depending on the relation between the inlet diameter, pressure and water speed, the rotor is designed as a disk or as a lattice. The valve function can be alternatively realized with a double acting hydraulic cylinder, an electrical actuator or manualy with a hand-wheel. Additionally the valve can be equipped with upstream and downstream pipes, bypass systems, hydraulic pressure units, aerating - deaerating devices, penstock rupture devices, and digital control systems.
[ "VAPTECH Butterfly Valves", "Butterfly Valve Specifications", "Valve Actuation Methods", "Pressure Ratings of Valves", "Hydraulic Cylinder Actuation", "Counter Weight Closure Mechanism", "Non-standard Butterfly Valve Development", "Disk vs Lattice Rotor Design", "Alternative Valve Function Realizati...
[ "VAPTECH Butterfly Valves", "Butterfly Valve Specifications", "Valve Actuation Methods", "Pressure Ratings of Valves", "Hydraulic Cylinder Actuation", "Counter Weight Closure Mechanism", "Non-standard Butterfly Valve Development", "Disk vs Lattice Rotor Design", "Alternative Valve Function Realizati...
WASHINGTON, Jan. 14 (UPI) -- President George W. Bush called for a national goal Wednesday of returning U.S. astronauts to the moon in preparation for establishing a permanent human presence elsewhere in the solar system. "Human beings are headed into the cosmos," Bush said at a speech at NASA headquarters in Washington, which proposed flights to the moon by 2014 and extended missions by 2015. The president's announcement, which was reported in detail by United Press International on Jan. 8, also called for retiring the space shuttle fleet as soon as the U.S. commitment to the build International Space Station is fulfilled and building a new generation of spacecraft capable of transporting astronauts to the moon and beyond. Speaking before a crowd of current and former astronauts, leaders from the Senate and House of Representatives and a large number of NASA employees, Bush noted the presence of Eugene Cernan, an Apollo 17 astronaut and "the last man to set foot on the lunar surface." "He said this as he left: 'We leave as we came and, God willing, as we shall return, with peace, and hope for all mankind,' the president said, adding, "America will make those words come true." Although Bush made the moon the immediate focus of his plan, he also cast his sights much farther. Under the new space plan, human flights to Mars would follow the moon landings, although Bush did not indicate a timetable for them. Moreover, the immediate priority for the space program would be returning the space shuttles to safe flight as soon as possible. He said the main task for the shuttle fleet would be to complete the U.S. portion of the International Space Station, which would be completed by 2010. "We will finish what we have started," Bush said of the station project. At that point, the shuttle fleet would be retired. "Then it would be time for America to take the next step," he said. That step -- new human missions to the moon, would be preceded by robotic exploration of the lunar surface beginning in 2008. Bush called the robots "trailblazers" for the astronauts who would follow them. In order to take humans to the space station and then to the moon and beyond, NASA would develop its first new manned spacecraft in three decades. The new craft, called the crew exploration vehicle or CEV, would replace the shuttle and serve multi-mission capabilities. Bush said the first orbital test flights of the CEV would begin as early as 2008. The president's speech outlined the new plan in broad terms, leaving many unknowns before humans can venture forth on long-duration missions in space. As reported previously by UPI, NASA would shift the research aboard the space station from its current wide range of topics to an effort focused on sustaining humans in space. The aspect of the plan that seems to have generated the most anticipation is its cost. Some critics and commentaries already have blasted the idea for its anticipated high cost at a time of large federal budget deficits. But Bush said NASA's annual budget would need to rise only about $1 billion, spread over the next five years, to pay for the initial missions. NASA may have to request additional funding from Congress as the plan progresses, but for now the president placed funding limits on the initiative. One potential money-saving aspect is participation of other space programs in the effort. "I call on other nations to join us on this journey, in the spirit of cooperation and friendship," he said. Harking back to the last great exploration effort, the Apollo program of the late 1960s and early 1970s, Bush said: "The vision I outline today is a journey, not a race." Bush named retired Air Force secretary Pete Aldridge to chair a committee of government and private-sector experts to review NASA's plans to implement this new policy. Their report will be due on the President's desk four months after the committee first meets. In closing his speech, Bush recalled the words of a member of one of the families of the shuttle Columbia's crew. "The legacy of Columbia must carry on for the benefit of our children and yours," Bush said, adding, "Columbia's crew did not turn away from the challenge, and neither will we." The president's speech was preceded by opening remarks by NASA astronaut Mike Foale, who spoke via live satellite link from the International Space Station. Frank Sietzen Jr. covers aerospace for UPI Science News. Keith L. Cowing is editor of nasawatch.com. E-mail email@example.com
[ "George W. Bush", "NASA", "Space Exploration", "Moon Mission", "International Space Station", "Apollo Program", "Shuttle Fleet Retirement", "Crew Exploration Vehicle", "Mars Mission", "Robotic Exploration", "Pete Aldridge Committee", "Astronaut Training", "Space Policy", "US Astronauts", ...
[ "George W. Bush", "NASA", "Space Exploration", "Moon Mission", "International Space Station", "Apollo Program", "Shuttle Fleet Retirement", "Crew Exploration Vehicle", "Mars Mission", "Robotic Exploration", "Pete Aldridge Committee", "Astronaut Training", "Space Policy", "US Astronauts", ...
(MENAFN- Jordan News Agency) Amman, Nov. 28 (Petra) -- Prime Minister, Hani Mulki, on Tuesday, met with presidents of Professional Associations on challenges facing Jordan on many levels, especially financial and economic challenges and the government's plans and programs to address them. The prime minister underlined the importance of the trade unions' role in meeting its members' needs, in addition to their social role, pointing out to the government's readiness to provide support in terms of the necessary legislations related to the work of unions, which represent a large segment of citizens. He said the government's priority, at this stage, is to focus on reforming the economy and public finances and dealing with the unemployment, maintain monetary stability and increase self-reliance as a strategic goal. The premier made a proposal to establish a joint fund for all associations, which would contribute to enhancing their investment capabilities. Jordan Engineers Association (JEA) President, and the President of the Council of Professional Associations, Majid Tabba, said the associations can support the government's efforts in addressing challenges and assuming their national responsibility. Tabba added that the associations are partners with the government, expressing hope that both sides would communicate more in order to establish a partnership in the reform process. He emphasized the importance of fighting tax evasion, and exert more efforts to market Jordanian competencies and reconsider the technical allowances of union employees in the public sector. Presidents of associations stressed the importance of setting up programs that would reduce unemployment among members of professional associations and boosting operational, mechanization and replacing programs as well as providing them with the necessary training. 28/11/2017 - 08:22:08 PM Legal Disclaimer: MENAFN provides the information “as is” without warranty of any kind. We do not accept any responsibility or liability for the accuracy, content, images, videos, licenses, completeness, legality, or reliability of the information contained in this article. If you have any complaints or copyright issues related to this article, kindly contact the provider above.
[ "Prime Minister Hani Mulki", "Professional Associations Meeting", "Economic Challenges", "Government Reforms", "Unemployment Issues", "Monetary Stability", "Self-Reliance Strategy", "Joint Fund Proposal", "Tax Evasion", "Marketing Jordanian Competencies", "Union Employees Allowances", "Program...
[ "Prime Minister Hani Mulki", "Professional Associations Meeting", "Economic Challenges", "Government Reforms", "Unemployment Issues", "Monetary Stability", "Self-Reliance Strategy", "Joint Fund Proposal", "Tax Evasion", "Marketing Jordanian Competencies", "Union Employees Allowances", "Program...
Destin Animal Clinic is pleased to offer these Veterinary Services Comprehensive Physical Examination Our client service representatives will be ready to take your call and schedule your pet for the exam that they need. We attempt to accommodate all request to the best of our ability. During your pets physical exam we look for any abnormalities and address all concerns that you may have pertaining to your pets health. Emergency & Urgent Care Emergencies are accepted anytime our clinic is open. If you feel you have an emergency with your pet, please call us or come to the hospital immediately. If possible it is best to call before coming in so that a staff member can advise you on your particular emergency. For After Hours Emergency Care Okaloosa-Walton Veterinary Emergency Clinic Our Full List of Services INTERSTATE HEALTH CERTIFICATES We offer interstate health certificates to. Due to the restrictions and limited time frame in regards to health certificates we ask that you contact our office as soon as you finalize your travel plans that way we can efficiently and appropriately have the paperwork completed prior to your departure date. All patients are carefully screened for safety, and anesthetics are specifically tailored to your pets medical needs. We offer soft tissue surgical procedures such as spays, neuters, declaws, growth removal and additional abdominal surgeries. Our fully trained veterinary and technical staff strive to ensure the safest, most efficient, state-of-the-art procedures for your pet; advanced sterilization techniques; ECG monitors; intensive after surgery care and full blood testing. Regular professional cleaning is important to maintaining your pet's teeth. We use modern and safe ultrasound to clean each tooth thoroughly - above and below the gum line. Dental technicians polish teeth to create a smooth, lustrous tooth surface more resistant to plaque buildup. Fluoride treatments help strengthen enamel and reduce tooth sensitivity. We also carry home care products to minimize tartar buildup on clean teeth. We offer therapeutic laser treatment as a patient care option. Therapeutic laser has proven the ability to reduce pain, speed healing, and reduce inflammation. Laser therapy can aid in managing diseases such as arthritis, spinal pain, ear infections, skin wounds, post-surgical procedures and more. To learn more visit http://www.litecure.com/compan... IMMUNIZATION AND WELLNESS CARE We strive to prevent illness whenever possible. The time and effort invested in Wellness programs has rewards for both pets and owners. Our Wellness programs are designed specifically for your pet and include: Comprehensive physical exam; internal parasite testing; heartworm and flea control; vaccination program; spay and neuter package; and specialized blood tests for all life stages. FULLY STOCKED PHARMACY We stock a complete pharmacy for the treatment of animal diseases and maintenance. In addition to prescription medications we also stock both prescription and non-prescription diets, flea and tick medicines, and nutritional supplements to help keep your pet as healthy as possible. Radiology - or X-rays - help our veterinarians evaluate muscular-skeletal, cardiovascular(cardiopulmonary), gastrointestinal, reproductive and urinary systems. With all of our radiology being digital, we can provide faster image viewing and therefore a faster diagnoses for our patients. This also allows us to provide a copy of each image to our clients. Veterinary patients feel pain and discomfort under the same circumstances as people do. We know that recognizing and alleviating pain in animals is the essence of good patient care. We use the latest and most effective products to eliminate/reduce pain and discomfort in our patients. EMERGENCY AND CRITICAL CARE In any emergency, seconds count. Our experienced staff is backed up by our mobile resuscitation unit, stocked and equipped to administer the ABCs of basic life support - Airway, Breathing, Circulation/Cardiac compressions. Emergency care is offered during regular business hours. In addition, we are active members of the Okaloosa-Walton Emergency Clinic - providing a fully staffed after hours clinic for emergencies and extended care. NUTRITIONAL AND DIETARY COUNSELING Some pets require special food, and all pets benefit from a balanced diet. Our staff is available to help you choose the right diet for your pet to keep them happy, healthy and active. Additional supplementation is indicated for diseased and older pets. We can help you provide the best nutrition for your pet. Microchips have helped reunite thousands of pets with their families. We use Home Again microchip services to increase the chances of a safe recovery. A microchip is the size of a grain of rice and is inserted beneath your pets skin. The Home Again microchip is your pets permanent ID and is recognized internationally. Treat your pet to a luxurious bath. Our cleansing bathing services remove dirt, debris and the distinct pet odor - your pet will feel fresh and revitalized. If scratching is a problem, our medic
[ "Veterinary services", "Physical examination", "Emergency care", "Dental care", "Surgery", "Immunizations", "Wellness programs", "Pharmacy", "Radiology", "Pain management", "Nutritional counseling", "Microchipping", "Bathing services", "After-hours emergency care", "Spaying and neutering...
[ "Veterinary services", "Physical examination", "Emergency care", "Dental care", "Surgery", "Immunizations", "Wellness programs", "Pharmacy", "Radiology", "Pain management", "Nutritional counseling", "Microchipping", "Bathing services", "After-hours emergency care", "Spaying and neutering...
We may not be riding around on hoverboards or powering to work with jet packs. But with the likes of self-driving cars and space tourism already making in-roads, who’s to say sci-fi style transport won’t soon become part of our daily lives? When it does, it could spell opportunity for the business centre and coworking industry. Consider the massive impact that the daily commute has on a prospect’s decision to move into your workspace. When it comes to choosing a serviced office and particularly a coworking space, priorities such as distance from home, proximity to public transport and local parking are usually up there with cost and number of workstations. Many workers are heavily reliant on public transport, but let’s face it – the infrastructure is ancient, overworked and more often than not, in desperate need of a facelift. London’s underground is over 150 years old. The Tokyo Subway, the world’s busiest metro system, dates back to 1927. Russia’s Moscow Metro was opened in 1935. The New York Subway launched in 1904. These systems were built to last, and they’ve certainly done that. But given our massive reliance on public transport and huge advances in technology, isn’t it time for some radical alternatives? Elon Musk thinks so. And if anyone has the vision (and the finances) to shake up the public transport industry, he does. We’re talking about the Hyperloop, a futuristic public transportation system that could whisk passengers from San Francisco to Los Angeles – more than 380 miles – in just 30 minutes. It would knock half an hour off the standard one-hour flying time, and it promises to be cheaper too. How? The Hyperloop would use electromagnetic pulses to shoot pod-like carriages along a tubular overland system at speeds of up to 800mph. The system would be solar-powered, and some pods would be big enough to carry cars. Some have likened it to a Futurama-style existence, and in our current age of Victorian underground trains and overburdened metro systems, it’s difficult to imagine business centre clients Hyperloop-ing into work anytime soon. The Latest News Delivered To Your Inbox But guess what? It’s gaining interest from investors and private companies alike. Billed as a visionary extraordinaire, Musk has already delivered his fair share of era-defining creations, including PayPal, SpaceX and Tesla Motors. Other private companies are also actively pushing ahead with plans for their own beta systems based on similar Hyperloop technologies. Yes, it could happen. And if or when it does, the business centre industry could be looking at a goldmine. “The Hyperloop is privately funded and it’s way ahead of other older technology solutions,” says Frank Cottle, Chairman of ABCN. “My guess is that Hyperloop technology will be the first to arrive on the scene, and with their scheduling process, will generate a lot of business traffic and opportunity for business centers located nearby.” As Frank points out, this is the first conceptual transportation system that approaches high-speed public transit (privately funded and operated) in the US, and the outcome of location proximity will be a huge driver. “Think of how important being near a tube station is in London… or near a Metro station in Washington D.C.,” he added. The Hyperloop has been dubbed the fifth mode of transportation (after planes, trains, cars, and boats), and this article is one of many that demonstrates just how close we are to seeing this visionary system becoming reality. Today, there are more cars on the road than ever before, and with it comes constant road congestion and daily rush-hour commuting misery. It’s unsustainable, and despite the hype and investment around self-driving cars, the future of transportation must focus on better public access, streamlined services and cleaner, more reliable technology. We need a public transport solution that’s fit for 21st century businesses – and this could be it. What’s your take? Is the Hyperloop a multi-billion dollar investment worth its weight in gold? Or just a load of expensive ‘hype’?Share this article
[ "Hyperloop", "Futuristic Transportation", "Public Transport Innovation", "Self-Driving Cars", "Space Tourism", "Business Center Industry", "Coworking Spaces", "Transport Infrastructure", "Elon Musk", "Solar-Powered Technology", "Commuter Impact", "Technological Advancements", "Private Invest...
[ "Hyperloop", "Futuristic Transportation", "Public Transport Innovation", "Self-Driving Cars", "Space Tourism", "Business Center Industry", "Coworking Spaces", "Transport Infrastructure", "Elon Musk", "Solar-Powered Technology", "Commuter Impact", "Technological Advancements", "Private Invest...
The Verizon Building in Worcester houses offices and a telephone switching station. Verizon wanted to rehabilitate the deteriorating facade of its 1929, seven-story Art Deco-style building. The project architect recommended replacing the deteriorated limestone facade with precast concrete that would maintain the appearance of the building and SGH designed the supports for the new panels. While the original limestone blocks measured 8 in. thick, the new precast concrete panels were only 4 in. thick to accommodate a new thermal and water barrier system. We designed custom connections to secure the precast concrete panels. For this project, SGH completed the following: - Developed a solution to attach the precast concrete panels to the building through the thermal/waterproofing barrier - Determine the configuration of each of the existing limestone blocks and located connections for new panels by using the general contractor’s field dimensions and precast fabricator’s shop drawings - Detailed both lateral and vertical connections for every panel, which also attached adjacent panels to each other - Specified new steel columns located within sections of the mass masonry throughout the facade - Devised over 7,500 custom steel components welded to the columns with connectors slotted into the panels - Detailed the connectors to be adjustable to allow on-site adjustment during construction
[ "Building rehabilitation", "Architectural restoration", "Precast concrete", "Thermal barrier design", "Waterproofing", "Limestone replacement", "Custom connections", "Facade renovation", "Art Deco architecture", "Structural engineering", "Steel column installation", "Masonry work", "Field me...
[ "Building rehabilitation", "Architectural restoration", "Precast concrete", "Thermal barrier design", "Waterproofing", "Limestone replacement", "Custom connections", "Facade renovation", "Art Deco architecture", "Structural engineering", "Steel column installation", "Masonry work", "Field me...
ATLANTA - Children's Healthcare of Atlanta is celebrating the opening of its new Center for Advanced Pediatrics. The 260,000-square-foot outpatient facility is located at 1400 Tullie Circle at the northeast intersection of North Druid Hills Road and Interstate 85. CHOA's Center for Advanced Pediatrics will bring together multiple pediatric clinics and specialists to allow for a better way to treat children and teens with chronic diseases and complex care needs. FOX 5 attended a private ribbon-cutting ceremony at the facility Tuesday morning. The 8-floor building will provide care across more than 20 pediatric specialties with additional features including a cafe, conferences rooms, plus more than 250 rooms for patient care. There are also mother's rooms on every floor. To learn more, click here.
[ "Children's Healthcare of Atlanta", "Center for Advanced Pediatrics", "Atlanta healthcare", "Outpatient facility", "Pediatric clinics", "Specialists", "Chronic diseases treatment", "Complex care needs", "Ribbon-cutting ceremony", "North Druid Hills Road", "Interstate 85", "Fox 5 news coverage"...
[ "Children's Healthcare of Atlanta", "Center for Advanced Pediatrics", "Atlanta healthcare", "Outpatient facility", "Pediatric clinics", "Specialists", "Chronic diseases treatment", "Complex care needs", "Ribbon-cutting ceremony", "North Druid Hills Road", "Interstate 85", "Fox 5 news coverage"...
Human and mouse Cripto-1 (CR-1/Cr-1) proteins play an important role in mammary gland development and tumorigenesis. In this study, we examined the relationship between Cripto-1 and caveolin-1 (Cav-1), a membrane protein that acts as a tumor suppressor in the mammary gland. Cripto-1 was found to interact with Cav-1 in COS7 cells and mammary epithelial cells. Using EpH4 mouse mammary epithelial cells expressing Cr-1 (EpH4 Cr-1) or Cr-1 and Cav-1 (EpH4 Cr-1/Cav-1), we demonstrate that Cav-1 expression markedly reduced the ability of Cr-1 to enhance migration, invasion, and formation of branching structures in EpH4 Cr-1/Cav-1 cells as compared to EpH4 Cr-1 cells. Furthermore, coexpression of Cav-1 together with Cr-1 in EpH4 Cr-1/Cav-1 cells inhibited Cr-1-mediated activation of c-src and mitogen-activated protein kinase signaling pathways. Conversely, primary mammary epithelial cells isolated from Cav-1 null -/-/mouse mammary tumor virus-CR-1 transgenic animals showed enhanced motility and activation of mitogen-activated protein kinase and c-src as compared to Cav-1+/+/CR-1 mammary cells. Finally, mammary tumors derived from mouse mammary tumor virus-CR-1 mice showed a dramatic reduction of Cav-1 expression as compared to mammary tissue from normal FVB/N mice, suggesting that in vivo Cav-1 is down-regulated during the process of CR-1-mediated mammary tumorigenesis.
[ "Cripto-1", "Caveolin-1", "Mammary gland development", "Tumorigenesis", "Cell migration", "Cell invasion", "Branching morphogenesis", "Mitogen-activated protein kinase", "c-Src", "Mouse mammary tumor virus", "Transgenic animals", "FVB/N mice", "Epithelial cells", "COS7 cells", "EpH4 mous...
[ "Cripto-1", "Caveolin-1", "Mammary gland development", "Tumorigenesis", "Cell migration", "Cell invasion", "Branching morphogenesis", "Mitogen-activated protein kinase", "c-Src", "Mouse mammary tumor virus", "Transgenic animals", "FVB/N mice", "Epithelial cells", "COS7 cells", "EpH4 mous...
The Anti-Roll Stabilization of Ships. NAVAL POSTGRADUATE SCHOOL MONTEREY CALIF Pagination or Media Count: The theory of roll stabilization of ships is presented in the context of modern control theory. The most common systems used to reduce the roll are described, and the principal equations are formulated. A general approach for the analysis of roll stabilizers is developed and applied to an activated fin stabilizer system. For this approach parameter plane techniques were applied, and the system was simulated in a digital computer. A system is proposed which is intended to improve the performance of passive tank stabilizers. - Fluidics and Fluerics - Marine Engineering
[ "Ship stability", "Roll stabilization", "Naval engineering", "Control theory", "Fin stabilizers", "Tank stabilizers", "Marine dynamics", "Digital simulation", "Parameter plane analysis", "Modern control systems", "Fluidics applications", "Passive stabilization", "Active stabilization", "Sh...
[ "Ship stability", "Roll stabilization", "Naval engineering", "Control theory", "Fin stabilizers", "Tank stabilizers", "Marine dynamics", "Digital simulation", "Parameter plane analysis", "Modern control systems", "Fluidics applications", "Passive stabilization", "Active stabilization", "Sh...
An international team of aquanauts will travel again to the bottom of the Atlantic Ocean to simulate a visit to an asteroid in the 16th expedition of NASA Extreme Environment Mission Operations (NEEMO). Join us in June for these live interactive webcasts with NEEMO team members - Interview with Dr. Stan Love, Tuesday June 12th from 1:30-2:00pm ET - Interview with JAXA astronaut Kimiya You, Saturday June 16th, 3:35-4:05pm ET - Interview with former aquanaut and Mars rovers Principal Investigator Dr Steve Squyres, Sunday, June 17th, 3:10-3:40pm ET - Interview with the entire NEEMO 16 crew in the Aquarius underwater laboratory, Thursday, June 21st, 10:55-11:35am ET No registration is required and the webcast is free. To join the webcast, visit http://webcast.challenger.org. Adobe Flash Player is required to participate and view the webcast. A new web environment will open on your computer with a chat interface to ask questions. The NEEMO 16 expedition will focus on three areas: communication delays, restraint and translation techniques, and optimum crew size. The crew of four will spend 12 days living 63 feet below the Atlantic Ocean's surface on the National Oceanic and Atmospheric Administration's Aquarius Reef Base undersea research habitat off the coast of Key Largo, Fla. NASA astronaut and former space shuttle crew member Dottie M. Metcalf-Lindenburger will lead the crew. She will be joined by fellow astronauts Kimiya Yui of the Japan Aerospace Exploration Agency and Timothy Peake of the European Space Agency and Cornell University professor Steven Squyres, who was also a NEEMO 15 crew member. The NEEMO mission is sponsored by NASA's Advanced Exploration Systems Program. For more information about NEEMO and the crew and links to follow the mission on Facebook and Twitter, visit: http://www.nasa.gov/neemo
[ "NASA", "Space exploration", "Underwater research", "Aquariums", "International collaboration", "Aquanauts", "NEEMO", "Communication delays", "Restraint techniques", "Translation techniques", "Optimum crew size", "Oceanography", "Atlantis Ocean", "Key Largo", "Florida", "NOAA", "Aqua...
[ "NASA", "Space exploration", "Underwater research", "Aquariums", "International collaboration", "Aquanauts", "NEEMO", "Communication delays", "Restraint techniques", "Translation techniques", "Optimum crew size", "Oceanography", "Atlantis Ocean", "Key Largo", "Florida", "NOAA", "Aqua...
U.S. Small Cap equity funds are back in the spotlight and this time in a positive light given the impressive trailing one month performance. Interest in the largest ETF in the segment in terms of assets under management, IWM (iShares Russell 2000, Expense Ratio 0.24%) has been reinvigorated by solid recent performance, as IWM briefly traded as low as a $107 handle in mid-May before its resurrection to current levels which is above $118. This move is especially noteworthy heading into the annual Russell 2000 Reconstitution, which finalizes this Friday, June 27th at the close of the trading day. Despite the recent net inflows into IWM amid the rally, the fund has still net lost assets year to date, seeing greater than $2 billion flow out of the fund via redemptions. The second largest fund in the space, IJR (iShares Core S&P Small Cap, Expense Ratio 0.17%) has also had strong performance recently but it has fared no better in terms of asset retention (>-$800 mln year to date). Interestingly, the number three and number four “U.S. Small Cap Equity” funds in the space, VB (Vanguard Small Cap, Expense Ratio 0.09%) and SCHA (Schwab U.S. Small Cap, Expense Ratio 0.08%) have both impressively outpaced both IWM and IJR YTD in terms of performance, and evidence suggests that it has won some new assets for the funds in terms of net inflow activity (VB +>$900 mln YTD, SCHA +>$100 mln YTD).
[ "Equity funds", "Small cap funds", "ETF performance", "Russell 2000", "Asset Under Management", "Redemptions", "Net inflows", "Fund performance comparison", "Market trends", "Reconstitution", "Financial markets", "Investment strategies", "Stock market analysis", "Exchange Traded Funds", ...
[ "Equity funds", "Small cap funds", "ETF performance", "Russell 2000", "Asset Under Management", "Redemptions", "Net inflows", "Fund performance comparison", "Market trends", "Reconstitution", "Financial markets", "Investment strategies", "Stock market analysis", "Exchange Traded Funds", ...
Surface Photovoltage Characterization of Organic Photovoltaic Devices Surface photovoltage response in bulk heterojunction organic solar cells is determined using a Kelvin probe with variable illumination intensity and wavelength. The effect of device architecture, carrier transport layers, donor:acceptor combinations, and device processing conditions are studied. We observe a positive (negative) surface photovoltage response, corresponding to efficient accumulation of electrons (holes) at the top electrode in conventional (inverted) devices. The linear relationship between surface photovoltage and log(intensity) and the agreement with open circuit voltage indicate that surface photovoltage magnitude quantifies the separation of photogenerated carriers in organic solar cells at open circuit condition.
[ "Photovoltaics", "Organic Solar Cells", "Kelvin Probe", "Carrier Transport Layers", "Donor-Acceptor Combinations", "Device Processing Conditions", "Surface Photovoltage Response", "Electron Accumulation", "Hole Accumulation", "Top Electrode", "Conventional Devices", "Inverted Devices", "Line...
[ "Photovoltaics", "Organic Solar Cells", "Kelvin Probe", "Carrier Transport Layers", "Donor-Acceptor Combinations", "Device Processing Conditions", "Surface Photovoltage Response", "Electron Accumulation", "Hole Accumulation", "Top Electrode", "Conventional Devices", "Inverted Devices", "Line...
Katie Holmes to direct her first film Katie Holmes is working a new gig -- film director. The Dawson's Creek star and former Mrs. Tom Cruise will make her directorial debut and star in the mother-daughter tale All We Had. Holmes had optioned the first novel by artist Annie Weatherwax in July. The book is described as "a gritty portrait of mother and daughter, living on the edge of poverty, who find an unlikely home amid the quirky residents of small town America." Holmes said in a statement Thursday that she was "honored" and "excited" to take on the project, adding that she looks "so forward to bringing Annie's incredible characters to the screen." Jane Rosenthal will produce the project and Josh Boone (The Fault in Our Stars) will write the script.
[ "Katie Holmes", "film director", "All We Had", "Annie Weatherwax", "mother-daughter story", "poverty", "small town America", "Dawson's Creek", "Tom Cruise", "Jane Rosenthal", "Josh Boone", "The Fault in Our Stars" ]
[ "Katie Holmes", "film director", "All We Had", "Annie Weatherwax", "mother-daughter story", "poverty", "small town America", "Dawson's Creek", "Tom Cruise", "Jane Rosenthal", "Josh Boone", "The Fault in Our Stars", "Breaking Bad", "Sopranos", "Mad Men", "Lost", "Friends", "The Offi...
Add New Content Request a Feature Register for free Search by Cover Date Public User Lists Last 10 titles added: Rick and Morty Presents:... Team Sonic Racing (2018) Hilda and the Troll (201... Lazurus's Eye (2018) Biblioteca Marvel: Cabal... El Capitán Marvel (1947) Avance Rápido (1993) El Charro Temerario (195... The Ultimates 2 (2006) Last 10 creators added: Juan M. Ortiz Matías Alonso Andrés - 'Mat. Al.' Pedro Muñoz Palomo - 'P. Muñoz' José María Ortiz - 'J. M. Ortiz' Miguel Ambrosio Zaragoza - 'Ambrós' Last 10 characters added: Salmon Stunt Man Eddie (Marvel)(Werewolf... Aman (DC)(Post Flashpoin... Wrath (DC)(Post Flashpoi... Secret Wars II (1985) Change this cover or add a variant Allen 'Al' Milgrom Josef 'Joe' Rubinstein Richard 'Rick' Parker Allen 'Al' Milgrom (out of 10): You must be Other members' collections This issue is in 471 collections. This issue is available for sale/trade Edit this Issue Clone this Issue View this issue's contribution history Clone the creators of this issue Clone the characters of this issue Suggest a podcast for this issue Search for 'Secret Wars II' on Amazon US $ 0.75 Color; Standard Comic Issue There are other versions of this issue in the database: Secret Wars II (1985) #5 Newsstand Edition Add/remove story arcs to this issue Secret Wars II Geheime Oorlogen II (1985) #4 Secret Wars II (1985) Omnibus HC Secret Wars II (1985) TPB First Appearance of Boom Boom. Thing appears on the cover, but not in the issue itself. Add/remove characters to this issue Black Knight (Marvel)(03 - Dane Whitman) Boom Boom (Marvel) Captain America (Marvel)(01 - Steve Rogers) Captain Marvel (Marvel)(02 - Monica Rambeau) Colossus (Marvel)(03 - Piotr Rasputin) Dazzler (Marvel)(02 - Alison Blaire) Doctor Strange (Marvel)(02 - Stephen Strange) Eson the Searcher (Marvel) Gammenon the Gatherer Hawkeye (Marvel)(01 - Clint Barton) Human Torch (Marvel)(02 - Johnny Storm) Invisible Woman (Marvel)(01 - Sue Richards) Iron Man (Marvel)(01 - Tony Stark) Mockingbird (Marvel)(01 - Bobbi Morse) Mr. Fantastic (Marvel)(01 - Reed Richards) Nezarr the Calculator (Marvel) Nightcrawler (Marvel)(01 - Kurt Wagner) Rogue (Marvel)(01 - Anna Marie Raven) She-Hulk (Marvel)(01 - Jennifer Walters) Rachel Anne Summers (Marvel) Thing (Marvel)(01 - Ben Grimm) Thor (Marvel)(01 - Thor Odinson) Wasp (Marvel)(01 - Janet Van Dyne) Wolverine (Marvel)(01 - James 'Logan' Howlett) Wonder Man (Marvel) Ziran the Tester (Marvel) Add/remove groups to this issue Avengers (Marvel)(01 - Original Team) Fantastic Four (Marvel) New Mutants (Marvel) West Coast Avengers / Avengers West Coast X-Men (Marvel)(01 - Mutants) There is 1 review for this issue Add your review Multiple Stories in this Issue Add a story to this issue Multiple stories do not exist for this issue. © 2005-2018 ComicBookDB.com - Terms and Conditions Special thanks to for the ComicBookDB.com logo design
[ "Comic Book Database", "Superhero Comics", "Marvel Comics", "Secret Wars II", "Comic Book Collectors", "Digital Comic Collections", "Comic Book Issues", "Character Appearances", "Story Arcs", "Cover Art", "Creator Credits", "Issue Reviews", "Comic Conventions", "Comics Industry", "Pop Cu...
[ "Comic Book Database", "Superhero Comics", "Marvel Comics", "Secret Wars II", "Comic Book Collectors", "Digital Comic Collections", "Comic Book Issues", "Character Appearances", "Story Arcs", "Cover Art", "Creator Credits", "Issue Reviews", "Comic Conventions", "Comics Industry", "Pop Cu...
tangible benefitsrodmillin Annaba lebenefitsmedium aluminum hydroxide mining equipmentpricein Tangier MoroccoAfrica medium aluminum hydroxide ballmillin Tangier Morocco AfricaThe ballmillis a key piece of equipment for grinding crushed materials and is widely used in production of powders such ascementsilicates refractory material and glass ceramics as well as... As a leading global manufacturer of crushing equipment, milling equipment,dressing equipment,drying equipment and briquette equipment etc. we offer advanced, rational solutions for any size-reduction requirements, including quarry, aggregate, grinding production and complete plant plan. Configuration:Lime kiln, coal mill, cooling machine, jaw crusher, vibrating feeder, etc. The limonite is a kind of common iron mineral. Limonite shows various structures, such as massive, earthy, milky or grape-like structure. Limonite is mainly used in chemical industry, building materials, refractory materials, metallurgy and other industri Manganese Ore Crushing Project in South Africa is composed of coarse mobile crushing station including GZD1300×4900 vibrating feeder and PEW860 euro jaw crusher, medium and fine mobile crushing and screening station including HP300 cone crusher and 3YK186 Main Equipments: PE series jaw crusher, impact crusher, sand maker, raymond grinding mill, vibrating screen and vibrating feeder. The 700t/d Gold Concentration Plant in Sudan is designed by Henan Fote Heavy Machinery Co., Ltd. Fote Machinery has provided the whole service including ore beneficiation test, plant design and construction drawing design, complete equipment manufacture a Powder grinding plant is generally composed of jaw crusher, bucket elevator, electro-vibrating feeder, mainframe and auxiliary engine of grinding mill, draught fan, dust-removing equipment, centralized electronic control and other equipment. According to The 250t/h basalt crushing line owner has a large-sized mining field in Zambia. In accordance with the field visit of working site and technical guidance, Fote Machinery introduced 3 stages crushing process for our customer. tangible benefitsrodmillin Annaba lebenefitsmedium aluminum hydroxide mining equipmentpricein Tangier MoroccoAfrica medium aluminum hydroxide ballmillin Tangier Morocco AfricaThe ballmillis a key piece of equipment for grinding crushed materials and is widely used in production of powders such ascementsilicates refractory material and glass ceramics as well as tangible benefits medium soft rock gold ore separating line sell it at a bargain price in Belgium Europe We strive to keep gold mining and rock crushing accessible for small to medium size mining operations Small to medium size miners know that affordable production equipment such as jaw rock crushers hammer mills pulverizers portable gold processing mills are incredibly difficult to find tangible benefits gold mine gold ore separating line sell it at a bargain price in AfricaStart Your Own Gold Mine in 45 days with less than US 70000 in Africa with full help training assistance mentorship until your become competent in maintaining organizing and managing small scale mine Your small scale mining business may grow into medium and large scale mining Once you start in gold mining Rabat Morocco Africa tangible benefits new rockcement mill price medium barite ball mill inRabat Morocco Africaball mill iron ore mines owner inmoroccohigh energy ball mill system small ball mills southafricalarge capacity ball mill for sale ball nose end mill for wood chemical industry use small ball mill supplier of china size reduction by usin g ball mill what is the difference tangible benefits smallbauxiteimpact crusher sellit at a bargain price in Zimbabwe Africa Sharm el SheikhEgypt Africatangible benefits smalllimestone hammercrusher sellit at a bargain priceSharmelSheikh killingall 148 occupants • In January 2004 a Y ak40 crashed on landing at T ashkent killing all 37 occupants • In February 2004 aFokkerF50 crashed on approach in the Arab Emirates Lusaka Zambia Africa tangible benefits gangue cement mill sell it at a bargain price tangible benefitsriver sand ballmill sellin LivingstoneZambia AfricaCopper CobaltAfricaincorporating the 8th Southern African Base Metals Conference LivingstoneZambia6–8 July 2015 Southern African Institute of Mining and Metallurgy 499 An Overview of Copper Smelting in SouthernAfricaRodney T Jones1 and tangible benefits medium dust catcher price in Britain Europe tangible benefitslarge kaolin coal mill sellmedium potash feldspar ball mill in leuven belgium europefeldspar mineral processing equipment calcite deep processing plant in belgium calcite deep processing production line in belgium is composed of pe250400 jaw crusher Edinburgh Britain Europe small gold mine classifier sell it at a bargain price Leeds Britain Europe tangible benefits new mineral mining equipment sell at a
[ "mining equipment", "aluminum hydroxide mining", "ball mill", "gold concentration plant", "powder grinding plant", "basalt crushing line", "gold ore separation", "small scale mining", "cement mill", "kaolin coal mill", "calcite deep processing", "quarry equipment", "crushing equipment", "d...
[ "mining equipment", "aluminum hydroxide mining", "ball mill", "gold concentration plant", "powder grinding plant", "basalt crushing line", "gold ore separation", "small scale mining", "cement mill", "kaolin coal mill", "calcite deep processing", "quarry equipment", "crushing equipment", "d...
|Full Name||Denise Jackson| |Birth Name||Denise Jackson| |Profession||Author, Celebrity Wife| |Birth City||Newnan, Georgia| |Birth Country||United States| |Father Name||Dan Jackson| |Mother Name||Nell Jackson| |No Of Children||3 daughters (Mattie, Alexandra, & Dani)| |Education||West Georgia College| Denise Jackson is an author by profession who has authored books such as It’s All About Him, The Road Home, and others. Besides her professional life, Denise is grabbing wide media attention as the wife of popular singer and songwriter Alan Jackson. Denise Jackson was born in April 1960 in Newnan, Georgia, to the late parent’s Dan and Nell Jackson. As far as her education, she completed her BS degree at West Georgia College. Likewise, she grew up along with her twin brother Danny, a sister Jane and Ron. Denise Jackson was born on January 7, 1960(age 61 years) in Newnan Georgia, United States. She was born to parents Dan and Nell Jackson along with a twin brother named Danny. Her parents are no longer as per reports. Likewise, she has two more siblings named jane and brother Ron who is 21 years older than her. She was born and raised in a very religious Christian family as the church is a part of it. She belongs to an American Nationality and her sexual orientation is straight. Further her zodiac sign is Capricorn and belongs to Causation ethnicity. She has a very supportive family but due to their parent’s busy careers, they did not get time to discuss their dreams with their parents. Similarly, Denise completed her high schooling at Atkinson Elementary school in Newnan. Though there is not much information about her education she was a very ambitious student. She got her graduation from West Georgia College in business administration She was good at sports and has gained the title of homecoming queen, Captain of cheerleading, and star of the tennis team. Enjoying More Than Four Decades Of Marriage One of the most beloved and inspirational married couples is Alan and Denise Jackson. They continue to share a great deal of love, caring, and support even after four decades of marriage. Denise, a writer, and Alan, a country music performer, initially met when they were teenagers. They originally met in Newnan, Georgia, where they both grew up. At that time, they both attended Newnan High School, where their romance began to take off. Denise and Alan wed on December 15, 1979, after having been together for a number of years. Alan was 21 and Denise was 19 when the party took place. Additionally, because Denise’s maiden name was Jackson, she chose not to alter it after being married. The early 1960s couple hasn’t looked back since that time. They have a strong bond and are the ideal married couple. They are happily commemorating their 42nd wedding anniversary as of 2021. The marriage between Elaine and Dave Chappelle is also fulfilling. Once So Close to Divorce In 1998, after 18 years of marriage, the couple came dangerously close to divorcing. The singer’s extramarital affair shattered their marriage. Despite the criticism, the couple is currently very content together. The two didn’t get along all that well because of personal issues. Denise was restless even though Alan was preoccupied with his presentations. Later, Jackson claims, “People: “We were just kids when we started out,” “We didn’t ever have the chance to fall in love as adults and to learn who you are before making a commitment. I think we lost some of that original feeling. I did anyway.” They got back together in 1999 following their separation. In order to recover from the traumatic event that injured their families, Alan and Denise focused on counseling and building a solid Christian basis for their relationship. In addition, when Denise Jackson was given the news that she had cancer in 2010, it helped them get closer. Alan remained by her side the entire time. Fortunately, Denise was cancer-free because of their love for one another and for God. Blessed With Three Children The Jacksons are the delighted parents of three sweet girls. On June 19, 1990, they gave birth to Mattie Denise Jackson Selecman, their first child. Likewise, on August 23, 1993, they had their second child, Alexandra Jane Jackson, also known as Ali. On August 28, 1997, Denise and Alan also welcomed their youngest child, Dani Grace Jackson. Denise is a super-achiever girl. She started her career as an Elementary school teacher at Atkison Elementary School for 2nd and 3rd-grade students. After her marriage with
[ "Denise Jackson", "Alan Jackson's wife", "Author", "Country Music Influencer", "Christian Family Background", "Educated at West Georgia College", "Born in Newnan, Georgia", "Three Daughters", "Cancer Survivor", "Married Since 1979", "Homecoming Queen", "Cheerleading Captain", "Tennis Star", ...
[ "Denise Jackson", "Alan Jackson's wife", "Author", "Country Music Influencer", "Christian Family Background", "Educated at West Georgia College", "Born in Newnan, Georgia", "Three Daughters", "Cancer Survivor", "Married Since 1979", "Homecoming Queen", "Cheerleading Captain", "Tennis Star", ...
I guess you’ve probably heard that things are looking hopeful here in Paso Robles. Hope is starting to bloom along with our roses and bottlebrush bushes. Last week our City Council awarded a contract for more than a million dollars worth of street repairs. That sounds bigger than it actually is. It really involves the full lengths of only two streets along with portions of two others. But it’s a step, or dump-truck trip, in the right direction. Since the Great Recession in 2008, Paso Robles’ streets have pretty much been left to crumble, except for a few Band-Aids here and there and a project or two that were paid for with government grants. But this street repair work will be paid for with the sales tax increase that we Paso Robles voters approved in 2012. We agreed to a temporary half-cent increase in the city’s share of sales tax. City officials predict that $4 million will be available from it this year. So we can hope for more street repair. And you probably read in Wednesday’s Tribune that the March unemployment rate in San Luis Obispo County was the lowest for that month since 2008. The March rate of unemployment countywide was 6.1 percent. That was just a slight drop from the 6.2 percent rate in the previous two months, but still it was a hopeful improvement from the highest countywide March unemployment rate of 10.4 percent in 2010. But it’s still well above what it was in 2008 when it stood at 5.1 percent. And I’m sorry to say unemployment was even higher here in Paso Robles. One thousand of our 13,400 eligible workers were still out of jobs in March. That’s a 7.3 percent unemployment rate. But the countywide employment improvement may give our unemployed people hope that they’ll soon find jobs. I suppose some people think that hoping for things is foolish and useless, but I believe hope is human nature. Hope is what keeps many of us going when life is unkind, painful, debt-ridden, frightening, boring, overcrowded or lonely, as life often is. Hope keeps us from quitting. Of course, it’s possible to overdo hope. The Powerball and MEGA Millions lotteries come to mind. They bring on epidemics of hope running amok, accompanied by extravagant daydreams. But there are other widespread undertakings that give us justifiable hope. Examples are education, Social Security, Medicare and the Affordable Care Act. And in religion, of course, hope is a virtue. But the hope I like best is described in the poem by Emily Dickinson that begins, “Hope is the thing with feathers/ That perches in the soul/ And sings the tune without the words/ And never stops at all.”
[ "Paso Robles", "Street repairs", "Sales tax increase", "Unemployment rates", "City council", "Economic recovery", "Hope symbolism", "Emily Dickinson", "Poetry", "Local news", "Community development", "Government grants", "Infrastructure improvements", "San Luis Obispo County", "Affordabl...
[ "Paso Robles", "Street repairs", "Sales tax increase", "Unemployment rates", "City council", "Economic recovery", "Hope symbolism", "Emily Dickinson", "Poetry", "Local news", "Community development", "Government grants", "Infrastructure improvements", "San Luis Obispo County", "Affordabl...
Scarlett Johansson has reached out to OK! to clear the air regarding tabloid reports that she has had plastic surgery on her nose: “US Weekly’s cover story regarding Scarlett Johansson and its clear implication that she has had plastic or cosmetic surgery on her nose is an outrageous and defamatory fabrication lacking any conceivable basis or proof, despite vehement denials by Ms. Johansson prior to publication,” reads a statement from her rep, exclusively to OK!. “Not surprisingly, US magazine cannot provide the dates when she supposedly had this surgery, who performed the surgery, or what was supposedly done — all because there simply is no truth to the story. The publication made a pathetic attempt to validate its story by using two cover photos of Scarlett that were taken years apart with obviously different make-up and lighting, and then relying on an “expert’s opinion” (based solely on looking at the two photos) on what “might” have been done. It wasn’t.” And Scarlett herself has this to say to OK!: “I have always been straightforward with the press regarding my body image and I am very concerned that my fans (and perhaps even my employers) will feel mislead. Thus, I feel compelled to take immediate legal action against US Weekly.” Marilyn Monroe’s one-time best friend Jeanne Carmen wants Scarlett Johansson or Kate Bosworth to play her in a new biopic because mum-to-be Christina Aguilera is too focused on motherhood for the project. Pop star Aguilera was set to make her big screen debut in the story of the busty blonde pin-up and golfer, but Carmen can’t wait for her to have a child and get back into shape. So she has revealed she wants either Johansson or Bosworth to take the role in the film based on her son Brandon James’ biography The Wild, Wild Life Of Jeanne Carmen. Carmen says, “Christina was interested in playing the part and is a born pin-up girl at heart. She became pregnant, however, and the script is now in the hands of Scarlett Johansson’s agent and Kate Bosworth’s agent. “Either one of these girls have the talent to pull it off.” More about Jeanne Carmen herself after the cut! A new poster for The Other Boleyn Girl has surfaced online! It seems Scarlett in a more prominent role than the first one. Thanks to NataliePortman.com for the find and everyone who alerted me about this. – The Other Boleyn Girl Posters A wonderful new high quality production still of Scarlett Johansson as Mary Boleyn has been added in the gallery. Enjoy! – The Other Boleyn Girl Production Stills First of all, I wish to take a moment to thank our new donors: Jennifer from Germany, Maria from Switzerland and Reija from Finland. I really appreciate it! We are already getting a lot closer to getting something very special for the site so thank you to all of the contributors! I also want to thank Sandra, Maria and forum members rope and DoubleT for contributing some great pictures. We now have a HQ version of the first Vicky Cristina Barcelona still, four fabulous outtakes from the 2006 Elle photoshoot, scans from the September 2007 issue of Spanish Glamour magazine and, last but certainly not least, caps of the new The Other Boleyn Girl trailer. Have fun browsing! Check out the new international trailer for The Other Boleyn Girl! When rumours begin to circulate that King Henry VIII (Bana) is no longer intimate with his wife who has been unable to give him a male heir, Sir Thomas Boleyn concocts a plan to bring his family back to prominence: his daughter Anne (Portman) shall seduce the King and provide him with a son. However, the scheme goes off course when the King takes to the other Boleyn girl, Anne’s younger sister and best friend Mary (Johansson). Although married already, Mary gives in to family pressure and reluctantly provides the King with a boy, but along the way, she finds herself falling in love with the surprisingly tender monarch. Of course, this love affair is no obstacle for Anne whose hunger for the throne now overpowers her sisterly love, and she enacts a plan that eventually tears her family and her country apart while leading to her legendary demise. Scarlett Johansson comments on Penelope Cruz in the Spanish actress’ cover story for Vogue magazine: Johansson revealed that Allen wrote a part for the Spanish beauty after he saw her in her Oscar-nominated role in Volver. However, he was so infatuated by her that he was reduced to a stuttering mess in her presence. “Of course Wood
[ "Scarlett Johansson", "Plastic Surgery Controversy", "Legal Action Against Media", "Jeanne Carmen Biopic", "Kate Bosworth", "The Other Boleyn Girl", "Mary Boleyn", "Henry VIII", "Natalie Portman", "Vicky Cristina Barcelona", "Penelope Cruz", "Woody Allen", "Film Trailers", "Production Stil...
[ "Scarlett Johansson", "Plastic Surgery Controversy", "Legal Action Against Media", "Jeanne Carmen Biopic", "Kate Bosworth", "The Other Boleyn Girl", "Mary Boleyn", "Henry VIII", "Natalie Portman", "Vicky Cristina Barcelona", "Penelope Cruz", "Woody Allen", "Film Trailers", "Production Stil...
Why should you choose a beach wedding photographer from sunny beach weddings. Beach romantic wedding photography. As an experienced wedding photographer i have photographed a variety of wedding styles including traditional hindu indian weddings traditional catholic church weddings traditional synagogue jewish weddings as well as rustic farm weddings backyard diy weddings downtown pensacola weddings boho beach weddings elopements and destination. Wedding photography kindly read the useful pin info reference 9025288664 here. Our professional wedding photographers have offered their services in the horry county sc area for decades. On the beach beach wedding dresses wedding pictures beach romantic beach elegant stunning beach wedding photography with beautiful sunset wedding engagement photos wedding dresses and attires wedding hairstyles for brides wedding pics beach engagement by jasmine lee photography via engaged. Beach wedding photography is adventurous and thrilling too. Sunset beach wedding january 27 2019 at. Wedding photography beach photo ideas honeymoon pictures 61 ideas photography landscape photography photography tips. Choosing a photographer who specialize in beach wedding photography to take the pictures of your wedding is a very important decision. The soft sand the bright sparkling water and the sunset in the distance definitely make beaches one of the most romantic settings for a wedding. We offer wedding videography and photography that tells a story and captures priceless moments. Sunset photos at the beach sunset sessions beach engagement wedding photography beach sunset couple 58 ideas a n j a get inspiration for your beach engagement photos here. See what these 20 couples did and find ideas from poses to props to outfits that you will love. On the beach beach wedding dresses wedding pictures beach romantic beach rustic beach engagement session this engagement photo shoot by jasmine lee was full of creative touches such as a beach teepee and gorgeous photos of the bride to be and her horse. Beach wedding photos beach engagement by jasmine lee photography via engaged elegant stunning beach wedding photography with beautiful sunset wedding engagement photos wedding dresses and attires wedding hairstyles for brides on the beach beach wedding dresses wedding pictures beach romantic beach. Our photographers have photographed weddings all over the beaches of maryland and. Four tips for a beautiful beach wedding. Only celebrities and people with a large income held such wedding photoshoots. Ensure that your special day is properly captured and documented by contacting romantic myrtle beach weddings. Beach wedding photography is a great fun and thrilling experience. First of all our photographers are experienced. You will be thrilled even after so many years when you see the photos.
[ "beach wedding", "wedding photography", "romantic wedding", "photographer", "destination wedding", "traditional weddings", "catholic church wedding", "hindu indian wedding", "jewish wedding", "rustic farm wedding", "backyard wedding", "downtown Pensacola wedding", "boho beach wedding", "el...
[ "beach wedding", "wedding photography", "romantic wedding", "photographer", "destination wedding", "traditional weddings", "catholic church wedding", "hindu indian wedding", "jewish wedding", "rustic farm wedding", "backyard wedding", "downtown Pensacola wedding", "boho beach wedding", "el...
Agent Orange report 'too vague,' critics say Report doesn't make direct link between exposure to 2,4,5-T and cancer, or other illnesses A retired Ontario Hydro worker in Sudbury says a new report looking at the impact of the chemical 2,4,5-T is too little, too late. The report was released yesterday by an independent panel established by the province in 2011. The chemical is used in the herbicide know as Agent Orange — and hundreds of provincial employees were exposed to unsafe levels of the chemical between the 1950s and 1970s. The report still did not prove that a worker's illness was caused by the chemical exposure, however. Those employees worked for the Ministries of Natural Resources and Transportation and Ontario Hydro. One retired Hydro employee, 78-year-old Daniel Crawford, says he has seen several of his friends and former work colleagues die of prostate cancer. Crawford has the disease himself, and blames the four decades he spent working in the forestry division of Ontario Hydro, when his job involved spraying 2,4,5-T to clear brush. He thought this report would never came out, he said. And now that it has, it's too late. "It's not going to change my life because I've already been through it and some of the affects were not good for me." ‘Acceptable’ margin of safety 'exceeded' The report didn’t go far enough, said Carol Brown Parker, a spokesperson with the Agent Orange Association of Canada. "They should have had more answers … a lot more answers than what he was giving," she said. "It's too vague. I don't think there's any responsibility taken — yet. All that was said was that he was sorry it happened, but that's it." Panel chair Dr. Leonard Ritter defended the decision not to make a direct link between exposure to the chemical and cancer or other illnesses. "The risk assessment only indicates that an acceptable margin of safety has been exceeded based on the methodology we used for certain occupationally-exposed groups, and that their health could have been affected, but not necessarily so," he said. "The panel concluded that the risk of disease due to bystander exposure to 2,4,5-T would be very low." The provincial workers weren't the largest group exposed to the highly toxic herbicide, but the panel's mandate was limited in scope, added Ritter. "Most use of the herbicide in Ontario was not by the government of Ontario but rather by private and municipal users," he said. "The assessment of these non-government uses was beyond the panels' scope and not included in the evaluations." Close to 400 WSIB cases Brown Parker said she'd like to see former employees tested and have the government help with medical bills. Natural Resources Minister David Orazetti said people who think they may have gotten ill because of their exposure to the herbicide should contact the Workplace Safety and Insurance Board to file a claim. But he warned they will need medical evidence to prove their illness came from exposure to 2,4,5-T. Critics point out the WSIB has nearly 400 open cases from workers who claim the herbicide is to blame for their cancer, and say the report merely gives the agency and the government more time to drag their feet. Crawford said the WSIB told him they were waiting for this report. "So it would sound like they would be able to move forward at this point, but who knows." At the very least, Crawford said he hopes the report will teach future generations to think twice about the chemicals they're using in the workplace. With files from Canadian Press
[ "Agent Orange", "Chemical Exposure", "Health Risks", "Ontario Workers", "Herbicides", "Occupational Health", "Workplace Safety", "Retired Employees", "Environmental Impact", "Cancer", "Government Report", "Risk Assessment", "WSIB Claims", "Forestry Work", "Public Health Concerns", "Pro...
[ "Agent Orange", "Chemical Exposure", "Health Risks", "Ontario Workers", "Herbicides", "Occupational Health", "Workplace Safety", "Retired Employees", "Environmental Impact", "Cancer", "Government Report", "Risk Assessment", "WSIB Claims", "Forestry Work", "Public Health Concerns", "Pro...
When I press the fluid button the doors lock and when I turn on the headlights the doors lock this started today the wipers are on the off position and they act like they are on delay and when I turn my headlights on the doors lock and when I press the fluid button the doors lock never had a problem before Look on the floor under the dash for the Body Computer. Remove the connector, (on the left side as I recall), and check for the presence of corrosion between any of the pins. Clean it out if there is any. June, 1, 2012 AT 3:20 AM How about the over head message center it does not turn on the reading lights work but thats it I checked all the fuses June, 1, 2012 AT 5:55 AM Can't help you with that right off the top of my head. I wanted that in my '93 Dynasty when I ordered it but it wasn't available. The best I can suggest is to take it down and check for 12 volts on at least one wire when the ignition switch is turned on. If the display goes on and off intermittently, I repair a lot of car radios for that and I might be able to find the same cause on that module. Beyond that I would have to find a service manual to figure out what to have you test.
[ "Car trouble", "Vehicle electrical issue", "Headlight malfunction", "Door lock problem", "Wiper malfunction", "Body computer connection", "Overhead message center failure", "Fuse box inspection", "12-volt testing", "Car radio repair", "Service manual recommendation", "Dash panel maintenance", ...
[ "Car trouble", "Vehicle electrical issue", "Headlight malfunction", "Door lock problem", "Wiper malfunction", "Body computer connection", "Overhead message center failure", "Fuse box inspection", "12-volt testing", "Car radio repair", "Service manual recommendation", "Dash panel maintenance", ...
You will need - - passport (copy); - - medical insurance (OMS); - - pension certificate (copy); - - certificate of registration (residence permit); - - marriage certificate (copy); - - the documents confirming the pregnancy. First of all, purchase insurance, it's a guarantee that all the doctor visits, tests and examinations will be free. If no insurance policy, all medical services (except emergency cases) will be paid. Select the consultation, which will be more convenient to get on the account. Near the place of residence or work. If the woman is a citizen of Russia, she has a right to be observed in each female consultation in their country. In addition, she has the right to elect any gynecologist who works in this consultation. Write the application addressed to head of attached to the selected antenatal clinics. Upload the required documents (copies). The passport, an extract from the map (out-patient), the policy, certificate of withdrawal from the accountand etc. Record on reception to the doctor. To postpone the first visit to a later date is not worth it. As the statement on medical records, will help to early detect the problem and to take all necessary measures for successful elimination. Take the directions gynecologist for an ultrasound, lab work and referral to other specialists. When complete all assignments, show the results to your doctor, he will determine the period of pregnancy and make personal card of the pregnant woman. The date of issuance of this card will be the time of setting the account on pregnancy. Take the gynecologist's certificate stating that the consist on the account (before 12 week of pregnancy). This document allows you to issue a grant (lump sum). If the term of pregnancy more than 12 weeks, this benefit will not be paid. Make sure that the validity period of the insurance has not expired, otherwise health services will be paid. Every woman has the right to choose the place where to give birth or to be observed. If the clinic is a failure, it's illegal. Submit a complaint to the relevant authorities – management of health in your area.
[ "Pregnancy documentation", "Medical insurance requirements", "Passport requirement", "Residence permit", "Marriage certificate", "Pregnancy confirmation", "Antenatal care", "Gynecological consultations", "Insurance policy", "Healthcare rights", "Maternity benefits", "Grant eligibility", "Obs...
[ "Pregnancy documentation", "Medical insurance requirements", "Passport requirement", "Residence permit", "Marriage certificate", "Pregnancy confirmation", "Antenatal care", "Gynecological consultations", "Insurance policy", "Healthcare rights", "Maternity benefits", "Grant eligibility", "Obs...
In this article, here is the full details of Mayank Saxena about wiki, biography, date of birth, birthplace, zodiac sign, nationality, hometown, age, height, weight, father, mother, family, girlfriend, wife, relationship status, children, profession, education, career, net worth, facts, Wikipedia, and many more. Mayank Saxena was born on not known in United Kingdom. His age is not known as of 2021. He is real name Mayank Saxena and his nickname Mayank. He is interesting in fact his zodiac sign Leo. His nationality is Indian, American, British. Mayank Saxena height is 5 feet 10 inches and his weight is 72 kg. His hair color is black and he has mesmerizing brown eyes. Mayank Saxena is popular known for Westworld, 9-1-1 and How to Get Away with Murder. He is an Actor. As of 2021, Mayank Saxena net worth is estimated to be $900 thousand. Mayank Saxena hobbies not known. His favorite color is not known and his favorite destination is not known. |Known For||Westworld, 9-1-1 and How to Get Away with Murder| |Date of Birth||Not Known| |Birth Place||United Kingdom| |Height||5 feet 10 inches| |Nationality||Indian, American, British| |Net Worth||$900 Thousand| |Favorite Color||Not Known| |Favorite Destination||Not Known| |Favorite Food||Not Known| Mayank Saxena is educational qualification BFA. He is study in school name is not known and study in college name is Manhattan Film Institute, Hunter College. |College||Manhattan Film Institute, Hunter College| Mayank Saxena father’s name is not known and his mother’s name is not known. It is brother name is not known and his sister name is Mayuri Saxena. Mayank Saxena has no any relationship with girlfriend. His relationship status is single. He is no any children yet. |Father Name||Not Known| |Mother Name||Not Known| |Brother Name||Not Known| |Sister Name||Mayuri Saxena| |Wife Name||Not Known| Stay connected with the wikimavani to know more about other trending personalities the wiki, biography, date of birth, birthplace, zodiac sign, nationality, hometown, age, height, weight, father, mother, family, boyfriend, husband, girlfriend, wife, relationship status, children, profession, education, career, net worth, facts, Wikipedia, and many more.
[ "Mayank Saxena", "Actor", "Westworld", "9-1-1", "How to Get Away with Murder", "Biography", "Wiki", "Zodiac Sign Leo", "British Nationality", "Height 5 feet 10 inches", "Weight 72 kg", "Black Hair", "Brown Eyes", "Single Relationship Status", "No Children", "Educational Qualification B...
[ "Mayank Saxena", "Actor", "Westworld", "9-1-1", "How to Get Away with Murder", "Biography", "Wiki", "Zodiac Sign Leo", "British Nationality", "Height 5 feet 10 inches", "Weight 72 kg", "Black Hair", "Brown Eyes", "Single Relationship Status", "No Children", "Educational Qualification B...
No matter if you drive a Mustang, Camaro, Tundra, Jeep or a classic car, the billet parts you can get at Pirate Manufacturing is made with precision machinery to ensure that you’re getting the best show quality parts available. Pirate Mfg has been making parts for years and the guys know a thing or two about making quality products. Take for example the Chevy Camaro 6.2L V-8 Billet Engine Dress-Up Kit, Smooth Chrome. It’s absolutely stunning! You can easily dress up your vehicle with any of the parts Pirate makes to help you get that edge you’re looking for. Lucky for us, we found this great short documentary on how Ford came up with the new 2015 Ford Mustang. Will Pirate Mfg come out with Billet parts for the 2015 Ford Mustang? Well, I can neither confirm or deny that. That’s something Big Boss Josh will have to decide. For now, enjoy the video. You’ve seen various types of shift knobs used in cars before right? In fact we sell some of those that look like skulls and pistons. But this item is relatively new to us and we thought it deserved some attention. This is the U.S.M.C Fighting Knife Shift Knob. I know what you’re thinking, “AWESOME!” Yes indeed it is! Only $42.95. Chrome U.S.M.C. fighting knife shift knob for passenger vehicles, suvs and pick-ups. ka-bar shift knob ultra high quality chrome finish, cnc-machined grip universal hex screw mount design. Includes mounting hardware. Perfect for passenger vehicles and pick-ups We also carry other styles of shift knobs; skulls, pistons and even a pistol grip.Prices start at $11.95! One of the leading manufacturers of chrome and aluminum engine dress-up accessories & racing components, Racing Power Company (RPC) is now available on PirateMfg.com. You can now shop for just about anything RPC makes, from radiators, valve covers, steering wheels to steering columns. If you’ve got a classic car, then you’ll need curb feelers to complete the look. Not only do they look great on any vintage car, but they’re functional in making sure you don’t ruin your wheels or fenders. If these are too plain for you, Pirate Mfg carries a whole line of curb feelers that should cater to your needs. This is just the beginning of what’s to come from Pirate Mfg, motorcycle accessories. Check out these classically inspired tail lights. These tail lights are perfect for anyone that wants to give their motorcycle a custom look. I don’t blame you. Remember that article I posted about how the H2s were voted to have the best resale value by the Canadian International Autoshow. Anyhow, now that you’ve set your mind into getting your own, how do you buy one? Do you check it out much like a regular car? Well, there are some differences in how you do it. But before you do go. You may want to read up on this great article by Ebay: “How to buy a Hummer H2″ Well, if you are reading this guide then it is pretty clear that you are not the average individual who thinks that a vehicle is simply to take you from Point A to Point B. The Hummer H2 is definitely not for the staid person who goes through life without shaking things up. The Hummer H2 will get a second (maybe even third look) on the street. The Hummer look for the uninitiated is the impressed yet disappointed “Bummer, it’s not me” expression that washes over those who see “lucky you” in your Hummer H2. It could also be the “is that Hummer H2 going to take up both of those parking spaces” look that is more annoyance than admiration. Either way, trust me, you’ll get a second look. Okay, if you’ve read the first paragraph and decide that you are still a Hummer person then you are in luck. I am going to walk you through how to buy a Hummer H2 as well as throw in some interesting Hummer facts and history so that you’ll be able to spit out some pithy tidbits to all the people who are going to engage you in conversation when they learn that you own an Hummer H2. This guide is not intended to convince you to buy a Hummer but rather help you decide on and buy the right Hummer H2 model for you. So, I am not going to waste space telling you how many miles per gallon (11 to 12 mpg – couldn’t help it) your Hummer H2 gets
[ "Automotive parts", "Classic car parts", "Custom car parts", "Shift knobs", "Billet parts", "Ford Mustang parts", "Chevy Camaro parts", "Vehicle customization", "Precision manufacturing", "Chrome finishes", "Aluminum accessories", "Racing components", "Steering wheel", "Tail lights", "Cu...
[ "Automotive parts", "Classic car parts", "Custom car parts", "Shift knobs", "Billet parts", "Ford Mustang parts", "Chevy Camaro parts", "Vehicle customization", "Precision manufacturing", "Chrome finishes", "Aluminum accessories", "Racing components", "Steering wheel", "Tail lights", "Cu...
Former vice-president of Nigeria, Atiku Abubakar has joined the list of well-meaning Nigerians who have eulogised the late actor and comedian, Moses Adejumo also known as Baba Sala. In a tweet on Wednesday, October 10, 2018, Atiku described the late comedian as one of the pioneers of the entertainment industry in Nigeria. “Baba Sala belonged to a generation that pioneered Nigeria’s entertainment industry by investing to make high-quality home videos. He brought fun & laughter into our homes. It’s my prayer that he will find rest even as his family is comforted & strengthened,” he tweeted. The entertainment world is still in shock over the death of veteran comedian and actor, Baba Sala and eulogies have continued to pour in from celebrities. Among those who have reacted to the death of the famous comedian is Gbenga Adeyinka the 1st and music icon, King Sunny Ade. King Sunny Ade took to his Instagram page on Monday, October 8, 2018, where he posted a photo of the late comedy icon and had some really emotional words to say about him. “RIP Baba Sala you are truly a Legend & Thespian we all going to miss, I felt so sad when I heard the demise of the great comedian,” he wrote. For Gbenga Adeyinka the 1st, who also posted a photo of the late comedian on his Instagram page on Monday, October 8, 2018, revealed that Baba Sala was his mentor. The veteran comedian and actor passed away on Sunday.
[ "Actor", "Comedian", "Entertainment industry pioneer", "Late Nigerian personality", "Veteran entertainer", "Social media tribute", "Moses Adejumo", "Baba Sala", "Atiku Abubakar", "Well-wishers", "Public mourning", "Twitter tribute", "Instagram tribute", "Nigerian celebrity", "Home video ...
[ "Actor", "Comedian", "Entertainment industry pioneer", "Late Nigerian personality", "Veteran entertainer", "Social media tribute", "Moses Adejumo", "Baba Sala", "Atiku Abubakar", "Well-wishers", "Public mourning", "Twitter tribute", "Instagram tribute", "Nigerian celebrity", "Home video ...
Long Shot (Star Trek: Seekers 3) By: David Mack (author)Paperback Only 2 in stock The crew of the Starfleet scout ship Sagittarius follows peculiar sensor readings to an alien world, where the natives' efforts to harness a dangerous and unstable technology have thrown the laws of probability out of balance. As disasters and miracles multiply at an ever-increasing rate, it's up to Captain Clark Terrell and his crew to shut down the experiment gone wrong before it's too late-but the odds against them might already be too great to overcome. David Mack is the New York Times bestselling author of more than twenty-five novels, including the Star Trek Destiny and Cold Equations trilogies. He co-developed the acclaimed Star Trek Vanguard series and its sequel, Star Trek: Seekers. His writing credits span several media, including television (for episodes of Star Trek: Deep Space Nine), film, short fiction, magazines, comic books, computer games, and live theater. He currently resides in New York City. Number Of Pages: - ID: 9781476753096 - Saver Delivery: Yes - 1st Class Delivery: Yes - Courier Delivery: Yes - Store Delivery: Yes Prices are for internet purchases only. Prices and availability in WHSmith Stores may vary significantly © Copyright 2013 - 2017 WHSmith and its suppliers. WHSmith High Street Limited Greenbridge Road, Swindon, Wiltshire, United Kingdom, SN3 3LD, VAT GB238 5548 36
[ "Science Fiction", "Star Trek: Seekers", "Space Exploration", "Alien Worlds", "Captain Clark Terrell", "Disaster Prevention", "Unstable Technology", "Probability Imbalance", "Starfleet Scout Ship Sagittarius", "David Mack", "Novel" ]
[ "Science Fiction", "Star Trek: Seekers", "Space Exploration", "Alien Worlds", "Captain Clark Terrell", "Disaster Prevention", "Unstable Technology", "Probability Imbalance", "Starfleet Scout Ship Sagittarius", "David Mack", "Novel", "Star Trek: Voyager", "Deep Space Nine Novel", "Star Wars...
Montgomery Co. Food Bank facing critical shortage HOUSTON What the food bank needs most is canned meat and vegetables, along with nutritional foods like peanut butter and rice. The shortage is so low the Houston Food Bank sent over an emergency truckload of food. The Montgomery Co. Food Bank feeds about 30,000 people a day. They're in the process of planting a community garden to help keep their produce numbers up.
[ "food bank", "shortage", "canned meat", "vegetables", "peanut butter", "rice", "emergency food supply", "community garden", "Houston Food Bank", "Montgomery Co. Food Bank", "feeding people", "nutritional foods" ]
[ "food bank", "shortage", "canned meat", "vegetables", "peanut butter", "rice", "emergency food supply", "community garden", "Houston Food Bank", "Montgomery Co. Food Bank", "feeding people", "nutritional foods", "blood donation", "clothing drive", "medical supplies shortage", "donation...
The products includes five series: crusher, sand making machine, powder grinding mill, mineral processing equipment and building materials equipment.mobile aggregate cone crusher manufacturer malaysia,Mobile Crusher Malaysia. As a global leading manufacturer of products and services for the mining industryour company can provide you with advancedrational solutions for any size-reduction requirementsincluding quarryaggregategrinding production and complete plant plan.. coal crusher manufacturer in malaysia Small Coal Crusher Manufacturer In Malaysia L amp M Heavy Industry is a manufacturers of jaw Crusher cone Crusher sand making machine vsi impact crusher mobile crusher plant and vertical mill ultra-fine grinding Malaysia Manufacturers Tags: Cone crushercrusherjaw crusherMalaysia Aggregate crusher run malaysia calculator in meter gold ore crushers crusher run malaysia calculator in meter. liming is a complete gold processing plant manufacturer in Chinasupplies all kinds of best ore mining and crushing concrete admixtures manufacturers Malaysia Liming heavy industry is specialized in the designmanufacture and supply of crushing equipment used in mining industry. The product range of our company comprises mobile crushing plantjaw crushercone crusherimpact crushermilling equipmentball millvibrating feedersscreens and equipment cone crusher dealer in malaysia. Cone crusher malaysia mobile feeder and cone crusher malaysia elledue coltdew and used cone crushers for sale savona equipment is a cone crusher supplier worldwideone crushers are used in large primary ore crushing secondary and tertiary fine material as well as complete aggregate cone crushing lines get price jaw crusher used in malaysiaas a leading mobile iron ore jaw crusher manufacturer in malaysia. Iron Ore Crushers Iron Ore Crushers Suppliers and. A wide variety of iron ore crushers options are available to you such as cone crusher impact crusher You can also choose from free sampl There are 13 877 iron ore crushers suppliers mainly located in Asia The top supplying countries are China (Mainland) India and Algeria which mobile cone crusher for hire malaysia. mobile limestone cone crusher for hire malaysia mobile limestone cone crusher for hire malaysia Sandstone pulverizer machine And Malaysia Mobile Aggregate Screening Get Price Kleemann Brands and Products Wirtgen Malaysia KLEEMANN supplies a large range of jaw crushers impact crushers and cone The mobile tracked machines concrete cone crusher for sale in malaysia. Home concrete cone crusher for sale in malaysia concrete cone crusher for sale in malaysia jan the product range of our company comprises mobile crushing plant jaw crusher cone crusher impact crusher milling equipment ball mill vibrating feeders screens and equipment for washing sand our product is widely used in mining metallurgy construction China Mobile crushers catalog of Track Mounted Stone Mobile Crusher with Large Capacity for Aggregate Mobile Crushing PlantTruck-Mounted Mobile Jaw Crusher for Mobile Stone Crushing Plant provided by China manufacturer - Nanjing Sinonine Heavy Industry Science & HGT Gyratory Crusher. concrete crusher exporter in malaysia. concrete mobile crusher exporter in indonessia jaw crusher made in indonesia tfg 800th Jaw Crushing Equipment From Morocco phosphate fertilizer manufacturers in morocco rock cone crusher 50 800th jaw crusher is a new mobile rock cement crusher plant for sale in pakistan Mobile. Dec 142020 Browse our inventory of new and used Crusher Aggregate Equipment For Sale near you at MachineryTrader.com. Top manufacturers include KINGLINKMETSOPOWERSCREENMCCLOSKEYCEDARAPIDSSANDVIKKLEEMANNKPI-JCITEREX PEGSONand RUBBLE MASTER. Page 1 of 101. Get info of suppliersmanufacturersexporterstraders of Sand Crusher Machine for buying in India.machines for stone crushing plant malaysiamachines for stone crushing plant malaysia Crusher machine manufacturer in malaysia sbm is the world leader in stone crushing technologys global crusher machine supplier and manufacturerwe have As a leading global manufacturer of Mining Crushing and Gridhing mill equipmentswe offer advancedreasonable solutions for any size-reduction requirements including quarryaggregateand different kinds of minerals. We can provide you the Mobile Crushing PlantsAggregate crushing plantGridning millscomplete stone crushing and beneficiation plant. Dec 292019 Linyi Shanmu Machinery Co.Ltd. Is located in Linyi cityShandongChinaand covers an area of 80000square meters. Shanmu Company is specialized in manufacturing various models of crushing equipmentscreening machinesand washervibrating feederand belt conveyor as well as artificial sand and aggregate crushing processing plant. Royal Engineering is a
[ "crusher", "sand making machine", "powder grinding mill", "mineral processing equipment", "building materials equipment", "mobile aggregate cone crusher", "manufacturer", "quarry", "aggregate", "gold ore crushers", "iron ore crushers", "cone crusher", "jaw crusher", "mobile crushing plant"...
[ "crusher", "sand making machine", "powder grinding mill", "mineral processing equipment", "building materials equipment", "mobile aggregate cone crusher", "manufacturer", "quarry", "aggregate", "gold ore crushers", "iron ore crushers", "cone crusher", "jaw crusher", "mobile crushing plant"...
Puppy Training – How Early Separation Can Lead to Puppy Learning Disorders Training a puppy can be a difficult, yet rewarding task. If done properly, you will be rewarded with a loyal friend for life. If done improperly, it can lead to frustration on both the part of the dog and the owner. One of the leading causes of learning disabilities in puppies is not due to defective genes or breeds, but to early separation from the dog’s mother. Because dogs have a much shorter life span than humans, they mature and learn at a much faster rate. A puppy learns more in the first 6 months of its life than it does in the remaining years. To break it down even further, many of the dog obedience training basics are not taught by the owner or trainer, but by the puppy’s mother. In a natural environment, a puppy learns about social structures such as pack leader, dominance, etc from its mother at a very young age. The puppy learns that there are appropriate places to go to the bathroom, appropriate ways to act around the pack leader, and more importantly, patience. If a puppy is separated from its mother too soon, many of these vital skills are not taught and can make the foundation for training much more difficult to establish. Furthermore, a puppy with separation anxiety, generally brought on by early separation from its mother, will exhibit more aggressive behavior, destructive behavior such as chewing or scratching, or nuisance barking or howling. So how do you know when it is too soon to separate a puppy from its mother? The general rule of thumb is that a puppy should not be separated before eight weeks, but it could be longer if certain signs are prevalent. These signs include, but are not limited to, abnormal dependence on the mother or failure to conform to social norms within the pack. If these signs are evident, the puppy still needs more time with the mother before being made available for adoption. Once a puppy begins to exhibit independent behavior, it is a good indicator that he is ready for adoption and will have better success during the training process. Even once the puppy is separated from its mother, it still needs just as much love and attention as it got when it was inside the family unit. Its mother used to respond to its every whine and whimper, and in order to keep the puppy’s self esteem high, it will require you to do the same until it feels comfortable with you. Once you have created this bond however, the dog will see you as the one in charge and will respond better to your voice commands, function better in your home, and be less likely to develop separation anxiety when you leave the home.
[ "Dog training", "Early separation effects", "Puppy development", "Mother influence on puppies", "Socialization in dogs", "Learning disorders in puppies", "Pack structure", "Separation anxiety", "Destructive behaviors", "Nuisance barking", "Independent behavior indicators", "Eight week separati...
[ "Dog training", "Early separation effects", "Puppy development", "Mother influence on puppies", "Socialization in dogs", "Learning disorders in puppies", "Pack structure", "Separation anxiety", "Destructive behaviors", "Nuisance barking", "Independent behavior indicators", "Eight week separati...
President Dr. Mohamed Waheed Hassan Manik has decided and notified Parliament Speaker Abdulla Shahid that ministers, high ranking government officials and security forces personnel shall not, starting from today, attend summons by the Parliament Committee on Oversight of the Government. The notification by President Waheed follows the publication of some of the information shared by former senior police and military officers with the Parliament committee, which is investigating the report published by the Commission of National Inquiry (CoNI). The commission was constituted to investigate the legitimacy and manner in which the government changed earlier last year. The letter sent by the President to the Speaker of Parliament says that the decision was made because the Speaker is unable to ascertain that the Parliament is functioning according to the constitution and Parliament procedures, and also because the Parliament Speaker is unable to ascertain that the information shared with the Parliament by parties attending Parliament summons is dealt with in a manner consistent with the constitution and Parliament regulations. The President said that the decision will stand until the government is assured that these issues are rectified. The President also noted that since the CoNI report was shared with the Parliament Speaker, in principle the Parliament does have the authority to do such an investigation, but it should be done within the boundaries of the constitution and the rules and regulations of the Parliament. The President said that the Parliament floor had not decided on how to proceed with the report and thus, the responsibility of the committees to which the report was forwarded should be to exercise their prerogatives granted to them in the Parliament regulations, and that they do not have the authority exceed these boundaries. He also had said that the work by the Parliament Committee on Oversight of the Government is undertaken beyond the boundaries stipulated in law, and that the Parliament Counsellor General had advised that the committee work is being conducted outside the boundaries of the law. The President further noted that the Attorney General had also advised the Speaker and expressed concern regarding the issue, and asked him to assure the State that this will not continue in this manner. The President also noted that the Speaker had failed to take any meaningful action to solve the issue regarding the work of the committee, and said that he is saddened to note that the Speaker had not replied to the concerns expressed by the Attorney General. The President said that the information shared by former and current senior officials at a committee meeting held in secret was made public on the Parliament website, and that such actions will cause distress to the existing constitutional framework and is also an infringement of the individual rights of the people who shared the information with the committee. He also said that this is severe enough to cause a threat to national security. He said that divulging information in such a manner is against the constitutional concepts and that it also goes against the regulations of the Parliament. He also expressed grave concern and noted that while the Parliament Counsel General had explicitly said that it is against Parliament regulations, the Speaker had not taken any action to rectify the issue.
[ "Political governance", "Constitutional law", "Parliament oversight", "Government accountability", "National inquiry", "Security forces regulation", "Speaker of parliament", "Executive branch", "Legislative process", "Commission of National Inquiry (CoNI)", "Rule of law", "Official misconduct"...
[ "Political governance", "Constitutional law", "Parliament oversight", "Government accountability", "National inquiry", "Security forces regulation", "Speaker of parliament", "Executive branch", "Legislative process", "Commission of National Inquiry (CoNI)", "Rule of law", "Official misconduct"...
Germany's recycling and reuse rate for small electronic appliances is too low. Too many used cell phones, smartphones and tablets are stuck in drawers or disposed of illegally with the household waste. But these devices should be refurbished and reused or properly recycled to help us conserve valuable resources. We have been offering different ways for people to hand in their devices since 2003. Customers have been able to return their used, high-end cell phones and smartphones to Telekom Shops under a buyback program since 2013. They receive store credit from the Telekom Shop reflecting their old device's current value, which they can use to purchase a new device, or they can choose to have the amount booked to their customer account. Business customers can send in their used cell phones and smartphones through a buyback portal (www.handyankaufsportal.de) for business customers, which we created in 2016. After the device's value has been determined, the amount can be paid out or donated to a charitable organization. Together with company Teqcycle Solutions we also operate the Cell Phone Collection Center online portal. Through this portal, authorities, associations and other organizations have the opportunity to start collection campaigns for donating used cell phones and smartphones. The website provides an overview of these partners and the collection campaigns they conduct. Such campaigns took place in Bavaria and North Rhine-Westphalia during the reporting period. We also welcomed two new cooperation partners in 2017: the Frankfurt Zoological Society and Pro Wildlife e.V. At the end of the year we donated the proceeds from the devices collected through recycling and reuse to environmental organization Deutsche Umwelthilfe e.V. In 2017 we joined together with radio station Antenne Unna to hold a cell phone collection competition between the communities of the region. The station followed the various collection campaigns and crowned one of the communities the victor. The objective of the competition was to increase listeners' awareness of environmentally friendly resource consumption. The proceeds from the sales and recycling activities were donated to the Lichtblicke e.V. charity. In 2017 we collected exactly 148,888 used cell phones and smartphones throughout Germany and either reused them or had them properly recycled. During the cell phone collection campaign we use a data deletion process that is DEKRA certified and complies with strict data protection requirements. Defective cell phones or devices where certified data deletion would be too costly are properly recycled using state-of-the-art, environmentally friendly processes at the Telekom Recycling Center in Goslar. Up to 100 percent of the materials can then be reused – as recycled metals or for energy generation. We depict the relationship between commercially sold and collected mobile phones with our Cell Phone Collection ESG KPI. We map the relationship between mobile devices brought onto the market and taken back with our ESG KPI "Take-back mobile devices". In 2017, approximately 317,000 mobile devices (excluding T-Mobile US, AMC, Maktel, Crnogorski) were taken back throughout the Group. Support of various collection campaigns As in previous years, we supported the Die Handyaktion campaign conducted by different church-affiliated groups in the state of Baden-Württemberg in 2017 as well. This time the partners reinforced the campaign, together with the German Mineral Resources Agency and the Ministry of the Environment of Baden-Württemberg, with various educational measures. For example, they redesigned the "cell phone raw materials kit" for school classes. The kit contains various minerals that are used in cell phones. Using accompanying teaching materials, teachers can explain the significance of the raw materials in smartphones to their students. The Responsibility and Sustainability. Join in! collection campaign in the state of Saarland, which we have been supporting since 2014, was extended until the end of 2018 due to ongoing interest. We are still a cooperation partner to the campaign, which focuses on projects such as providing special course material on the topics of cell phone collection and resource efficiency. Mutual cell phone collection campaigns with Saarland companies and institutions are a further focus.
[ "Recycling programs", "Cell phone recycling", "Electronic waste management", "Resource conservation", "Telekom recycling initiatives", "Environmental sustainability", "Mobile phone take-back programs", "E-waste reduction", "Charitable donations from recycling", "Data security in recycling", "Com...
[ "Recycling programs", "Cell phone recycling", "Electronic waste management", "Resource conservation", "Telekom recycling initiatives", "Environmental sustainability", "Mobile phone take-back programs", "E-waste reduction", "Charitable donations from recycling", "Data security in recycling", "Com...
Sunday, August 23, 2015 BS article attempting to convince us of the wonderfulness of Trimet and that Mcfarlane is a great leader Portland once expanded outward, gobbling up stumpy land turned to farms. Then it filled in side to side, growing sleepy outposts into industrial and technology-making hubs ringed by suburban housing developments. In recent years, many of its new commercial structures have aimed skyward. Few can dispute that the city has become something of a boutique celebrated nationally for avoiding the sprawl of, say, Houston, while creating a textured place with a personality of its own.(Portland has become the hub of white privilege and gentrification) But Portland and its environs, substantially contained by the Urban Growth Boundary, is now a packed, groaning setting in which old streets, highways and bridges jam up with traffic for no apparent reason other than their reached capacity and plain inadequacy. Most every day, thousands of Portlanders -- mainly those in automobiles -- are made unhappy in their efforts to get around. Caught in the squeeze is the agency TriMet, which sends buses and trains throughout the region in an effort to keep people moving. On a good day, it works. Often, though, delays and forced rerouting frustrate riders who are made late for work or derailed from errands. The agency reckons, correctly, that if the region is to expand by 400,000 people and 260,000 jobs in the next 20 years,(that's nothing but a guess and makes a great argument in favor of this tax increase) as the regional government Metro predicts it will, something has to give – and that's to say nothing of people stuck in cars wondering why the Oregon Legislature failed this year to pass a transportation improvement package. Next month, TriMet's board of directors will decide (The Trimet board of directors are nothing but sock puppets that do whatever the general manager tells them to do)whether to charge more money from Portland businesses, already subsidizing about 56 percent of TriMet's half-billion-dollar budget through a regionwide payroll tax, to expand service. While the money ask starts out small, it escalates over 10 years to trigger an increase of $500 over the current $3,619 paid against a payroll of $500,000 -- a solid jump for any small firm working on thin margins. Separately but significantly, TriMet has been busy living itself down. In recent years the agency has suffered in the public's eye for lavish, unsustainable health and retirement benefits to drivers and their families;(Nothing but a lie, the health benefits were above average but the retirement pay is much worse than PERS) a legacy of front-office privilege that included hefty compensation packages for executives;(this is certainly true, and is still true nothing has changed in this regard) pushback from some suburban leaders who argued MAX trains were efficient first for exporting downtown street-style crime to leafy neighborhoods; and the suspicion, as suggested by the charter-amending cities of Tigard and Tualatin, that TriMet is something of a Metro tool waiting to roar through with the next MAX train after winning a mere nod of approval from local elected officials. Accountability would be ensured by the inclusion of a five-year review clause on any new payroll tax hike.(what a freaking joke this is, ridiculous pandering to the citizens when we all know there will be no real'review') A century ago, it was possible to address congestion as a discreet challenge, because there was room to do so. Not now. TriMet's play for more money requires coordination with city, county, state and federal partners who control the narrow roadways and bridges that TriMet uses. So TriMet's ambitious, planned creation of bus rapid transit lines along Southeast Powell Boulevard and Division Street,(really, all they need on this corridor is five minute bus service, no construction needed) for example, will not only cost a lot of money but require a braiding of efforts and money streams from multiple agencies – along with good will from the public and a belief by Portland employers that their needs will be met. Editorial Agenda 2015 The good news is that TriMet has done a solid job of tightening up its operations under its general manager since 2010, Neil McFarlane.(This is the same man who STOLE raises for himself and all his hand picked cronies while cutting services, raising fares, and cutting employees) A near-intractable dispute with the union representing drivers and mechanics found resolution in diminished benefits, most of all for new employees. Result: Agency revenues are more in line with expenses, though long-term commitments remain daunting. Separately, McFarlane has in the last year paid respect not only to fare-paying riders who have opinions about service enhancements but to Portland's businesses by sounding them out on the proposed payroll tax hike. He is credited for heeding a very
[ "Trimet", "Neil McFarlane", "Portland urban growth", "Transportation infrastructure", "Urban planning", "Suburban development", "Traffic congestion", "Public transportation expansion", "Payroll taxes", "Regional economic growth", "Health and retirement benefits", "Executive compensation", "M...
[ "Trimet", "Neil McFarlane", "Portland urban growth", "Transportation infrastructure", "Urban planning", "Suburban development", "Traffic congestion", "Public transportation expansion", "Payroll taxes", "Regional economic growth", "Health and retirement benefits", "Executive compensation", "M...
Scientists have found that certain components present in the Martian soil capable of destroying entire bacterial culture in just a few minutes. Researchers have long wondered over whether microorganisms are able to survive on the surface of the red planet. And the results of recent laboratory tests show that the destiny of any fallen on the surface of Mars green bacteria is unenviable. Apparently, potatoes grow on Mars will be much harder than previously. The Problem is to perchlorates – chlorine-containing chemical compounds, first discovered on Mars in 2008. These substances on Mars in the liquid state, but actually turn it into acid brine. For people perchlorates are toxic, but not necessarily create the same problems for microbes. And since these connections allow water to remain in liquid form, scientists previously thought that their presence on Mars may be useful for life. However, the researchers from Edinburgh University say that exposure to strong UV light these compounds make them a deadly poison for all forms of life. "the Perchlorates are stable at room temperature, but become a powerful oxidizing agent when activated, for example, high temperatures", — the researchers report. One of the ways to turn perchlorate into the acid is exposed to a powerful source of ultraviolet radiation. Since Mars is much less dense compared to earth's atmosphere, its surface is exposed every day to such type of radiation. The Scientists decided to conduct an experiment. They took found on the skins of spacecraft (including ISS) bacteria Bacillus subtilis (Bacillus subtilis) and put it in the terms of artificially recreating the environment on the surface of Mars. The bacteria floated in a solution of magnesium perchlorate of the same concentration that is found on the red planet, and then they were subjected to ultraviolet radiation of the same wavelengths that bombard the Martian surface. The result that no bacteria have survived. The death occurred within 30 seconds. To verify the experiment, the researchers also exposed to UV light for bacteria, is not placed in perchlorate medium. But even in this case, the entire colony was destroyed within only 1 minute. Of Course, the surface of Mars not so wet as the bottom of a Petri dish. Therefore, the researchers decided to conduct a similar experiment by placing the bacteria in dry conditions, silica. This environment is a bit simplified the existence of the bacteria Bacillus subtilis, but in the end most of them still died. From this we can conclude that if Mars and there is life, then most likely she's lurking deep beneath the surface, where the concentration of perchlorate is much lower. "Despite earlier suspicions of the presence of toxic effects, caused by acids present on the Martian surface, our observations show that the environment on the surface of modern Mars even more hostile to the living cells and is an explosive cocktail of acid, iron oxide, perchlorate and ultraviolet radiation", — scientists say. If the salt flows down from the Martian rocks are indeed a concentrated flow of perchlorates, such environment is clearly unsuitable for sustaining life. And since perchlorates are present on almost the entire surface of Martian soil, based on the findings of the research team, we can sadly say that the majority of the planet's surface is uninhabited. But there the share of positive news. If the Martian surface will be able to kill any terrestrial microbes upon contact, then the planet this will be a great defensive tool – less chances that in future missions, we will be able to bring back their terrestrial microbes. Scientists, in turn, plan to continue their research and find out exactly how such a deadly cocktail on the Martian surface kills living cells. Diet on genotype can be a way out for many, but it still has a lot of questions Don't know what to do to lose weight? DNA tests promise to help you with this. They will be able to develop the most individual diet, because for this they will use the m... If aliens exist, why don't we "hear" them? In the 12th episode of Cosmos, which aired on December 14, 1980, co-author and host Carl Sagan introduced viewers to the same equation of astronomer Frank Drake. Using it, he calculated the potential number... The pain caused to humans by the Gimpi-gympie plant can drive him crazy Many people consider Australia a very dangerous place full of poisonous creatures. And this is a perfectly correct idea, because this continent literally wants to kill everyone w... a Method of radar scanning, which is usually used to measure the density of the snow caps at the poles of the Earth, was applied for the analysis of the surface methane seas, the largest satellite of the planet Saturn, Titan. As a... Neuroscientists have recently discovered that the formation of different types of memory though they use the same neurons, but they occur in different processes. The discovery could lead to the development of new and more effectiv... Despite bold predictions from several
[ "Martian soil", "Perchlorates", "UV Radiation", "Mars exploration", "Microbial survival", "Space microbiology", "Exobiology", "Planetary science", "Astrobiology", "Laboratory experiments", "Bacillus subtilis", "Acidic environments", "Iron oxide", "Surface of Mars", "Life on Mars", "Red...
[ "Martian soil", "Perchlorates", "UV Radiation", "Mars exploration", "Microbial survival", "Space microbiology", "Exobiology", "Planetary science", "Astrobiology", "Laboratory experiments", "Bacillus subtilis", "Acidic environments", "Iron oxide", "Surface of Mars", "Life on Mars", "Red...
The supplementary exams of School Leaving Certificate (SLC) has commenced from today all over the nation. The students who have failed maximum of Two subjects are given an opportunity to reaper in such supplementary  exams. This exam is for the students who appeared in the SLC examinations in the academic year 2071, according to the Office of the Controller of Examination, Sanothimi. The exam is scheduled up to August 12, 2014. A total of 234 examination centers and the same number of superintendents have been fixed for the examinations, said Bishnu Bahadur Dware, Examinations Controller at the Office, Sanothimi. A total of 120,600 students are appearing in the SLC supplementary examinations this year, he added. Most students in the supplementary exams will be appearing in exams for Maths, Science and English.As per the Examinations Controller Dware about 68,230 students are appearing the supplementary examinations for the subject of compulsory Maths, while 50,719 are attending for English subject and 33,077 in Science. Similarly 10,639 students are appearing in optional Mathematics, 17,164 in Social Studies and 2,291 in Nepali subject in the Supplementary exams. As many as 54,392 students are sitting for the exams in one subject while 66,235 are appearing in two subjects.
[ "Supplementary exams", "School Leaving Certificate (SLC)", "Education system", "Examination schedule", "Student performance", "Repeater students", "Maths exams", "Science exams", "English exams", "Exam centers", "Superintendent roles", "Nepal education", "Failed subjects", "Academic year 2...
[ "Supplementary exams", "School Leaving Certificate (SLC)", "Education system", "Examination schedule", "Student performance", "Repeater students", "Maths exams", "Science exams", "English exams", "Exam centers", "Superintendent roles", "Nepal education", "Failed subjects", "Academic year 2...
In early 1928 the Galesburg City Council debated the need for viaducts over several railroad crossings. The city fathers were urged by hundreds of local residents to place on a high priority status the construction of either underpasses or bridges on West Main Street, East Main Street and North Seminary Street. It was also suggested that a similiar crossing be considered in the South section of town. During the 1928 rail-crossing discussion Alderman W.H. Maley suggested construction of viaduct over the Santa Fe tracks on North West Street resulting in unreasoable blocking which caused vehicles to wait up to 15 minutes before proceeding. He also complained that that a viaduct should have been built on North Broad Street. Like a multitude of rail-crossing discussions in the past no action occured. In 1912 the CB&Q Railroad assumed responsibility to construct a subway under the Rio tracks on East Losey Street. The project required elevating the height over nearly 8 feet. It should be noted that the Burlington Route also spent $1,000,000 at that time for a new depot and adjacent subway on South Street. In March 1938 officials of the Santa Fe Railway announced that modern flasher signals would be installed a four downtown rail-crossings. Prior to that time only rail-crossings west of Broad Street and the eastern portion of town were protected with safety signals. The rail crossings at Pearl, Lincoln and North streets were of a wig-wag design. The Santa Fe installed flashing signals at Chambers, Kellogg, Prairie and Cherry streets at a cost of $13,000 each. The Santa Fe announced they would maintain a tower-man at the Prairie Street crossing to protect vehicles when trains are being switched off and on from adjacent sidings. The dilemma revolving around railroad crossings within city limits can be traced back to Illinois over 100 years ago. In 1909 Illinois Gov. Deneen announced his goal was to abolish all railroad crossings. He dictated that grade crossings in Illinois “must go” as soon as possible and included Galesburg. Orville Berry, chairman of the Illinois Commission on Railroads, said that edict would be carried out sooner than later. He also acknowledged that the cost would be tremendous. Deneen explained that his desire to eliminate rail grade crossings for those traveling by horse and buggy or motorized vehicles was strictly for safety reasons. Three years following the governor’s proposed plan it became apparent that little progress had occured and would be too costly to implement. Galesburg’s progress in implementing railroad crossing improvements has come a long ways in the past 100-plus years following construction of two new bridges, an underpass and successful rail quiet zones. Currently a near complete re-construction of the Farnham Street bridge is progressing. Tom Wilson is a local historian. Write to him at firstname.lastname@example.org or at The Register-Mail, 140 S. Prairie St., Galesburg, IL 61401.
[ "Railroad history", "City council debates", "Infrastructure development", "Safety measures", "Historical transportation", "Urban planning", "Local government actions", "Public transportation", "Railroad crossings", "Viaduct construction", "Subway projects", "Flasher signals", "Grade separati...
[ "Railroad history", "City council debates", "Infrastructure development", "Safety measures", "Historical transportation", "Urban planning", "Local government actions", "Public transportation", "Railroad crossings", "Viaduct construction", "Subway projects", "Flasher signals", "Grade separati...
Shapes, number recognition, counting, and money. These are just a few preschool math skills early learners will explore this year. Watch your preschoolers' knowledge expand rapidly with adorable and exciting preschool math worksheets. Your child will be ready for Kindergarten before you know it. Preschool math flash cards are a wonderful compliment to worksheets and great for math learning on the go.
[ "preschool math skills", "number recognition", "counting", "money concepts", "early childhood education", "kindergarten readiness", "math worksheets", "flashcards", "education tools", "pre-K curriculum" ]
[ "preschool math skills", "number recognition", "counting", "money concepts", "early childhood education", "kindergarten readiness", "math worksheets", "flashcards", "education tools", "pre-K curriculum", "advanced calculus", "algebraic equations", "trigonometry", "geometry proofs", "diff...
By Cassandra Tribe On May 1st, 2011, President Obama announced that Osama Bin Laden, leader of the al Qaeda had been killed. With this announcement, one of the most painful decades in American history was brought to a close. Since Bin Laden authorized the 9/11 attacks on the U.S., we, as a country — as a people — have suffered from lives defined by fear. Despite the fact that after 9/11, al Qaeda and Bin Laden’s influence waned, they remained important to us as a symbol of terrorism that we sought to bring to justice in an attempt to heal our pain. We — the people — have had to choose whether supporting the war on terror, with its high costs in money and lives, was more important than our own well-being in difficult economic times. We — the people — have suffered form the political and economic strain that the war on terror has placed on our country and relations with other countries, but we have done so with understanding and by choice. This pursuit of Bin Laden has also served to unite us all and give us a common boogeyman, a monster whose horrors were so great they made the ones in our personal lives more bearable. While there is great rejoicing that the leader and symbol of terrorism against the West is no more, we must also be aware that there will be a period of strange grief to follow. Without a larger-than-life boogeyman to overshadow personal suffering, many will feel the true depth of their lives and losses for the first time. It will be harder to stand behind increases in military spending and increased military commitments when the reality that so many in this country are starving and homeless is at the forefront of our thinking. Whether or not you believe that Bin Laden was captured and killed when the government said he was, or if you believe it is a gross manipulation of the voting public, we have to recognize that what has been a common unifying and distracting symbol for all of us has been destroyed. The war against terror is far from over, but we would do well to redefine what the primary terrorist that we pursue is. As a country, we need to focus our efforts to fight the terrorist within. The one whose suicide attacks take the form of homelessness, hunger, and unemployment. The one who rallies their soldiers with messages that promote greed, hate, partisan self-interest and apathy. Care must be taken that we do not race to find a new boogeyman abroad to distract us from this battle at home. We ahve fought and suffered overseas for long enough. While there is still more work to be done to end the reign of terror that al Qaeda began, it is time to bring our energy home and work on the battle within. It is time to come home. it is time to take care of our own. it is time to heal the wounds that began long before that day in September.
[ "Osama Bin Laden", "Al-Qaeda", "War on Terror", "9/11 Attacks", "President Obama", "United States History", "National Security", "Political Impact", "Economic Strain", "Military Spending", "Homelessness", "Unemployment", "Social Issues", "Domestic Policy", "International Relations", "P...
[ "Osama Bin Laden", "Al-Qaeda", "War on Terror", "9/11 Attacks", "President Obama", "United States History", "National Security", "Political Impact", "Economic Strain", "Military Spending", "Homelessness", "Unemployment", "Social Issues", "Domestic Policy", "International Relations", "P...
IT’S REAL! A NEW MATRIX IS COMING! A NEW MATRIX IS COMING! And even better news, they have a less chance of messing it up because one half of the team which gave us the original trilogy, Lana Wachowski, will be writing and directing the film! This contradicts previous reports of Zak Penn writing a script for the new film addition in the universe, but honestly, who cares? Here’s what we know: A script has already been written. Aleksandar Hemon (author of The Lazarus Project) and David Mitchell (author of novel, Cloud Atlas, which was adapted into a film by the Wachowskis in 2012) co-wrote the script. Neo & Trinity are back! Variety reports that not only is Keanu Reeves returning for the next installment, but so is Carrie-Anne Moss! Say what? We all remember how she took her exit in the last installment of the original trilogy, helping Neo make it to the Machine City. As my favorite character, I can neither confirm nor deny that I cried during this sequence. Production is estimated to begin early next year. This means we could see the film as early as the year 2021! What we don’t know: With Reeves and Moss returning, it’s hard to speculate how they plan to reenter this universe. A prequel? An alternate reality where the war against the machines rages on? Tell me NOW! You can’t think of Neo and Trinity without bringing up legendary Morpheus played by the legendary Laurence Fishburne. Dude is like the James Earl Jones of The Lion King. His presence, at least in some capacity is 100% essential. Which also brings to mind, who’s the new villain? and will they measure up to the formidable Agent Smith (Hugo Weaving)? The fight sequences in this film acted almost as another major character in the film itself. They’re distinct, awesome, and courtesy of martial arts choreographer, director, and legend: Yuen Woo-Ping. The themes of the original remain just as powerful and relevant today as they were premiering in March of 1999. With such an incredible cinematic contribution to storytelling, there are countless possibilities. Here’s hoping the newest addition brings forth new and unexpected qualities while honoring the same world we all know and love. Are you excited for a new Matrix?? Let us know! What's Your Reaction? Writer, Actor, Sci-fi & Superhero Blerd trying to escape the Matrix!
[ "Matrix", "Sci-Fi", "Film", "Reboot", "Lana Wachowski", "Keanu Reeves", "Carrie-Anne Moss", "Trinity", "Neo", "Morpheus", "Agent Smith", "Film Script", "Action Sequences", "Cinema", "Science Fiction", "Cyberpunk", "Movie News", "Film Production", "Wachowski Siblings", "Superher...
[ "Matrix", "Sci-Fi", "Film", "Reboot", "Lana Wachowski", "Keanu Reeves", "Carrie-Anne Moss", "Trinity", "Neo", "Morpheus", "Agent Smith", "Film Script", "Action Sequences", "Cinema", "Science Fiction", "Cyberpunk", "Movie News", "Film Production", "Wachowski Siblings", "Superher...
Lafourche Parish officials say a restoration project aimed at rebuilding beach and dunes at West Belle Pass on Fourchon beach is nearly halfway done. Progress has been made despite some damage from Tropical Storm Debby in late June. Lafourche Parish Coastal Zone Administrator Archie Chaisson told The Courier that the restoration project was moving along smoothly with 66 percent of the beach and dune recreation finished. Sand fending to prevent erosion is 44 percent complete. The National Weather Service has discontinued a tropical storm warning for Louisiana after forecast models indicated that the state is under less of a threat from Tropical Storm Debby than initially thought. Parts of Alabama and Florida remain under a tropical storm warning, however. Storm paths are generally hard to predict days in advance, and forecasters say they've been comparing several models to compile the official forecast. As of late Sunday, though, they believe the storm was less likely to make a westward turn toward Louisiana. Forecasters dropped storm warnings for southeastern Louisiana Sunday afternoon and said the threat from Tropical Storm Debby had decreased. National Hurricane Center forecasters backed away from an earlier projection that Debby might strike southeast Louisiana as a Category 1 hurricane. Instead they said they didn't expect it to turn west from its northward path that has it aimed at Florida and Alabama.
[ "Lafourche Parish", "Beach restoration", "West Belle Pass", "Fourchon Beach", "Tropical Storm Debby", "Coastal erosion prevention", "Sand fencing", "Louisiana weather", "National Weather Service", "Hurricane predictions", "Alabama weather", "Florida weather", "Storm forecasts", "Southeaste...
[ "Lafourche Parish", "Beach restoration", "West Belle Pass", "Fourchon Beach", "Tropical Storm Debby", "Coastal erosion prevention", "Sand fencing", "Louisiana weather", "National Weather Service", "Hurricane predictions", "Alabama weather", "Florida weather", "Storm forecasts", "Southeaste...