id
int64
0
190k
prompt
stringlengths
21
13.4M
docstring
stringlengths
1
12k
10,858
from typing import List, Optional, Union import numpy as np from PIL import Image from transformers.image_utils import PILImageResampling from ...feature_extraction_utils import BatchFeature, FeatureExtractionMixin from ...image_utils import ImageFeatureExtractionMixin, is_torch_tensor from ...utils import TensorType, is_pytesseract_available, logging, requires_backends def normalize_box(box, width, height): return [ int(1000 * (box[0] / width)), int(1000 * (box[1] / height)), int(1000 * (box[2] / width)), int(1000 * (box[3] / height)), ] The provided code snippet includes necessary dependencies for implementing the `apply_tesseract` function. Write a Python function `def apply_tesseract(image: Image.Image, lang: Optional[str], tesseract_config: Optional[str])` to solve the following problem: Applies Tesseract OCR on a document image, and returns recognized words + normalized bounding boxes. Here is the function: def apply_tesseract(image: Image.Image, lang: Optional[str], tesseract_config: Optional[str]): """Applies Tesseract OCR on a document image, and returns recognized words + normalized bounding boxes.""" # apply OCR data = pytesseract.image_to_data(image, lang=lang, output_type="dict", config=tesseract_config) words, left, top, width, height = data["text"], data["left"], data["top"], data["width"], data["height"] # filter empty words and corresponding coordinates irrelevant_indices = [idx for idx, word in enumerate(words) if not word.strip()] words = [word for idx, word in enumerate(words) if idx not in irrelevant_indices] left = [coord for idx, coord in enumerate(left) if idx not in irrelevant_indices] top = [coord for idx, coord in enumerate(top) if idx not in irrelevant_indices] width = [coord for idx, coord in enumerate(width) if idx not in irrelevant_indices] height = [coord for idx, coord in enumerate(height) if idx not in irrelevant_indices] # turn coordinates into (left, top, left+width, top+height) format actual_boxes = [] for x, y, w, h in zip(left, top, width, height): actual_box = [x, y, x + w, y + h] actual_boxes.append(actual_box) image_width, image_height = image.size # finally, normalize the bounding boxes normalized_boxes = [] for box in actual_boxes: normalized_boxes.append(normalize_box(box, image_width, image_height)) assert len(words) == len(normalized_boxes), "Not as many words as there are bounding boxes" return words, normalized_boxes
Applies Tesseract OCR on a document image, and returns recognized words + normalized bounding boxes.
10,859
import math import warnings from typing import Optional, Tuple, Union import numpy as np import torch import torch.utils.checkpoint from torch import nn from torch.nn import CrossEntropyLoss from ...activations import ACT2FN from ...deepspeed import is_deepspeed_zero3_enabled from ...modeling_outputs import ( BaseModelOutput, CausalLMOutput, SequenceClassifierOutput, TokenClassifierOutput, Wav2Vec2BaseModelOutput, XVectorOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import torch_int_div from ...utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging from .configuration_data2vec_audio import Data2VecAudioConfig The provided code snippet includes necessary dependencies for implementing the `_compute_mask_indices` function. Write a Python function `def _compute_mask_indices( shape: Tuple[int, int], mask_prob: float, mask_length: int, attention_mask: Optional[torch.LongTensor] = None, min_masks: int = 0, ) -> np.ndarray` to solve the following problem: Computes random mask spans for a given shape. Used to implement [SpecAugment: A Simple Data Augmentation Method for ASR](https://arxiv.org/abs/1904.08779). Note that this method is not optimized to run on TPU and should be run on CPU as part of the preprocessing during training. Args: shape: The shape for which to compute masks. This should be of a tuple of size 2 where the first element is the batch size and the second element is the length of the axis to span. mask_prob: The percentage of the whole axis (between 0 and 1) which will be masked. The number of independently generated mask spans of length `mask_length` is computed by `mask_prob*shape[1]/mask_length`. Note that due to overlaps, `mask_prob` is an upper bound and the actual percentage will be smaller. mask_length: size of the mask min_masks: minimum number of masked spans attention_mask: A (right-padded) attention mask which independently shortens the feature axis of each batch dimension. Here is the function: def _compute_mask_indices( shape: Tuple[int, int], mask_prob: float, mask_length: int, attention_mask: Optional[torch.LongTensor] = None, min_masks: int = 0, ) -> np.ndarray: """ Computes random mask spans for a given shape. Used to implement [SpecAugment: A Simple Data Augmentation Method for ASR](https://arxiv.org/abs/1904.08779). Note that this method is not optimized to run on TPU and should be run on CPU as part of the preprocessing during training. Args: shape: The shape for which to compute masks. This should be of a tuple of size 2 where the first element is the batch size and the second element is the length of the axis to span. mask_prob: The percentage of the whole axis (between 0 and 1) which will be masked. The number of independently generated mask spans of length `mask_length` is computed by `mask_prob*shape[1]/mask_length`. Note that due to overlaps, `mask_prob` is an upper bound and the actual percentage will be smaller. mask_length: size of the mask min_masks: minimum number of masked spans attention_mask: A (right-padded) attention mask which independently shortens the feature axis of each batch dimension. """ batch_size, sequence_length = shape if mask_length < 1: raise ValueError("`mask_length` has to be bigger than 0.") if mask_length > sequence_length: raise ValueError( f"`mask_length` has to be smaller than `sequence_length`, but got `mask_length`: {mask_length}" f" and `sequence_length`: {sequence_length}`" ) # epsilon is used for probabilistic rounding epsilon = np.random.rand(1).item() def compute_num_masked_span(input_length): """Given input length, compute how many spans should be masked""" num_masked_span = int(mask_prob * input_length / mask_length + epsilon) num_masked_span = max(num_masked_span, min_masks) # make sure num masked span <= sequence_length if num_masked_span * mask_length > sequence_length: num_masked_span = sequence_length // mask_length # make sure num_masked span is also <= input_length - (mask_length - 1) if input_length - (mask_length - 1) < num_masked_span: num_masked_span = max(input_length - (mask_length - 1), 0) return num_masked_span # compute number of masked spans in batch input_lengths = ( attention_mask.sum(-1).detach().tolist() if attention_mask is not None else [sequence_length for _ in range(batch_size)] ) # SpecAugment mask to fill spec_aug_mask = np.zeros((batch_size, sequence_length), dtype=bool) spec_aug_mask_idxs = [] max_num_masked_span = compute_num_masked_span(sequence_length) if max_num_masked_span == 0: return spec_aug_mask for input_length in input_lengths: # compute num of masked spans for this input num_masked_span = compute_num_masked_span(input_length) # get random indices to mask spec_aug_mask_idx = np.random.choice( np.arange(input_length - (mask_length - 1)), num_masked_span, replace=False ) # pick first sampled index that will serve as a dummy index to pad vector # to ensure same dimension for all batches due to probabilistic rounding # Picking first sample just pads those vectors twice. if len(spec_aug_mask_idx) == 0: # this case can only happen if `input_length` is strictly smaller then # `sequence_length` in which case the last token has to be a padding # token which we can use as a dummy mask id dummy_mask_idx = sequence_length - 1 else: dummy_mask_idx = spec_aug_mask_idx[0] spec_aug_mask_idx = np.concatenate( [spec_aug_mask_idx, np.ones(max_num_masked_span - num_masked_span, dtype=np.int32) * dummy_mask_idx] ) spec_aug_mask_idxs.append(spec_aug_mask_idx) spec_aug_mask_idxs = np.array(spec_aug_mask_idxs) # expand masked indices to masked spans spec_aug_mask_idxs = np.broadcast_to( spec_aug_mask_idxs[:, :, None], (batch_size, max_num_masked_span, mask_length) ) spec_aug_mask_idxs = spec_aug_mask_idxs.reshape(batch_size, max_num_masked_span * mask_length) # add offset to the starting indexes so that indexes now create a span offsets = np.arange(mask_length)[None, None, :] offsets = np.broadcast_to(offsets, (batch_size, max_num_masked_span, mask_length)).reshape( batch_size, max_num_masked_span * mask_length ) spec_aug_mask_idxs = spec_aug_mask_idxs + offsets # ensure that we cannot have indices larger than sequence_length if spec_aug_mask_idxs.max() > sequence_length - 1: spec_aug_mask_idxs[spec_aug_mask_idxs > sequence_length - 1] = sequence_length - 1 # scatter indices to mask np.put_along_axis(spec_aug_mask, spec_aug_mask_idxs, 1, -1) return spec_aug_mask
Computes random mask spans for a given shape. Used to implement [SpecAugment: A Simple Data Augmentation Method for ASR](https://arxiv.org/abs/1904.08779). Note that this method is not optimized to run on TPU and should be run on CPU as part of the preprocessing during training. Args: shape: The shape for which to compute masks. This should be of a tuple of size 2 where the first element is the batch size and the second element is the length of the axis to span. mask_prob: The percentage of the whole axis (between 0 and 1) which will be masked. The number of independently generated mask spans of length `mask_length` is computed by `mask_prob*shape[1]/mask_length`. Note that due to overlaps, `mask_prob` is an upper bound and the actual percentage will be smaller. mask_length: size of the mask min_masks: minimum number of masked spans attention_mask: A (right-padded) attention mask which independently shortens the feature axis of each batch dimension.
10,860
import math from typing import List, Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...activations import ACT2FN, gelu from ...modeling_outputs import ( BaseModelOutputWithPastAndCrossAttentions, BaseModelOutputWithPoolingAndCrossAttentions, CausalLMOutputWithCrossAttentions, MaskedLMOutput, MultipleChoiceModelOutput, QuestionAnsweringModelOutput, SequenceClassifierOutput, TokenClassifierOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import apply_chunking_to_forward, find_pruneable_heads_and_indices, prune_linear_layer from ...utils import ( add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_data2vec_text import Data2VecTextConfig The provided code snippet includes necessary dependencies for implementing the `create_position_ids_from_input_ids` function. Write a Python function `def create_position_ids_from_input_ids(input_ids, padding_idx, past_key_values_length=0)` to solve the following problem: Replace non-padding symbols with their position numbers. Position numbers begin at padding_idx+1. Padding symbols are ignored. This is modified from fairseq's `utils.make_positions`. Args: x: torch.Tensor x: Returns: torch.Tensor Here is the function: def create_position_ids_from_input_ids(input_ids, padding_idx, past_key_values_length=0): """ Replace non-padding symbols with their position numbers. Position numbers begin at padding_idx+1. Padding symbols are ignored. This is modified from fairseq's `utils.make_positions`. Args: x: torch.Tensor x: Returns: torch.Tensor """ # The series of casts and type-conversions here are carefully balanced to both work with ONNX export and XLA. mask = input_ids.ne(padding_idx).int() incremental_indices = (torch.cumsum(mask, dim=1).type_as(mask) + past_key_values_length) * mask return incremental_indices.long() + padding_idx
Replace non-padding symbols with their position numbers. Position numbers begin at padding_idx+1. Padding symbols are ignored. This is modified from fairseq's `utils.make_positions`. Args: x: torch.Tensor x: Returns: torch.Tensor
10,861
import collections.abc import math from dataclasses import dataclass from typing import List, Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...activations import ACT2FN from ...modeling_outputs import ( BaseModelOutput, BaseModelOutputWithPooling, ImageClassifierOutput, SemanticSegmenterOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import find_pruneable_heads_and_indices, prune_linear_layer from ...utils import ( add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_data2vec_vision import Data2VecVisionConfig The provided code snippet includes necessary dependencies for implementing the `drop_path` function. Write a Python function `def drop_path(input: torch.Tensor, drop_prob: float = 0.0, training: bool = False) -> torch.Tensor` to solve the following problem: Drop paths (Stochastic Depth) per sample (when applied in main path of residual blocks). Comment by Ross Wightman: This is the same as the DropConnect impl I created for EfficientNet, etc networks, however, the original name is misleading as 'Drop Connect' is a different form of dropout in a separate paper... See discussion: https://github.com/tensorflow/tpu/issues/494#issuecomment-532968956 ... I've opted for changing the layer and argument names to 'drop path' rather than mix DropConnect as a layer name and use 'survival rate' as the argument. Here is the function: def drop_path(input: torch.Tensor, drop_prob: float = 0.0, training: bool = False) -> torch.Tensor: """ Drop paths (Stochastic Depth) per sample (when applied in main path of residual blocks). Comment by Ross Wightman: This is the same as the DropConnect impl I created for EfficientNet, etc networks, however, the original name is misleading as 'Drop Connect' is a different form of dropout in a separate paper... See discussion: https://github.com/tensorflow/tpu/issues/494#issuecomment-532968956 ... I've opted for changing the layer and argument names to 'drop path' rather than mix DropConnect as a layer name and use 'survival rate' as the argument. """ if drop_prob == 0.0 or not training: return input keep_prob = 1 - drop_prob shape = (input.shape[0],) + (1,) * (input.ndim - 1) # work with diff dim tensors, not just 2D ConvNets random_tensor = keep_prob + torch.rand(shape, dtype=input.dtype, device=input.device) random_tensor.floor_() # binarize output = input.div(keep_prob) * random_tensor return output
Drop paths (Stochastic Depth) per sample (when applied in main path of residual blocks). Comment by Ross Wightman: This is the same as the DropConnect impl I created for EfficientNet, etc networks, however, the original name is misleading as 'Drop Connect' is a different form of dropout in a separate paper... See discussion: https://github.com/tensorflow/tpu/issues/494#issuecomment-532968956 ... I've opted for changing the layer and argument names to 'drop path' rather than mix DropConnect as a layer name and use 'survival rate' as the argument.
10,862
import argparse import os from functools import reduce import fairseq import torch from datasets import load_dataset from transformers import Wav2Vec2Processor, logging from transformers.models.data2vec.configuration_data2vec_audio import Data2VecAudioConfig from transformers.models.data2vec.data2vec_audio import Data2VecAudioModel as Dummy from transformers.models.data2vec.modeling_data2vec_audio import Data2VecAudioForCTC, Data2VecAudioModel def recursively_load_weights(fairseq_model, hf_model, is_headless): unused_weights = [] fairseq_dict = fairseq_model.state_dict() if not is_headless: feature_extractor = hf_model.data2vec_audio.feature_extractor pos_conv_embedding = hf_model.data2vec_audio.encoder.pos_conv_embed else: feature_extractor = hf_model.feature_extractor pos_conv_embedding = hf_model.encoder.pos_conv_embed for name, value in fairseq_dict.items(): is_used = False if "conv_layers" in name: load_conv_layer( name, value, feature_extractor, unused_weights, ) is_used = True elif "pos_conv" in name: load_pos_conv_layer( name, value, pos_conv_embedding, unused_weights, ) is_used = True else: for key, mapped_key in MAPPING.items(): if not is_headless: mapped_key = "data2vec_audio." + mapped_key if mapped_key not in TOP_LEVEL_KEYS else mapped_key if key in name or key.split("w2v_model.")[-1] == name.split(".")[0]: is_used = True if "*" in mapped_key: layer_index = name.split(key)[0].split(".")[-2] mapped_key = mapped_key.replace("*", layer_index) if "weight_g" in name: weight_type = "weight_g" elif "weight_v" in name: weight_type = "weight_v" elif "bias" in name: weight_type = "bias" elif "weight" in name: # TODO: don't match quantizer.weight_proj weight_type = "weight" else: weight_type = None set_recursively(hf_model, mapped_key, value, name, weight_type) continue if not is_used: unused_weights.append(name) logger.warning(f"Unused weights: {unused_weights}") The provided code snippet includes necessary dependencies for implementing the `convert_wav2vec2_checkpoint` function. Write a Python function `def convert_wav2vec2_checkpoint( checkpoint_path, pytorch_dump_folder_path, config_path=None, dict_path=None, is_finetuned=True )` to solve the following problem: Copy/paste/tweak model's weights to transformers design. Here is the function: def convert_wav2vec2_checkpoint( checkpoint_path, pytorch_dump_folder_path, config_path=None, dict_path=None, is_finetuned=True ): """ Copy/paste/tweak model's weights to transformers design. """ if config_path is not None: config = Data2VecAudioConfig.from_pretrained(config_path) else: config = Data2VecAudioConfig() if not is_finetuned: # Modify final_proj layer name hf_wav2vec = Data2VecAudioModel(config) data2vec_checkpoint_dir = os.path.dirname(checkpoint_path) state_dict = torch.load(checkpoint_path) state_dict["model"]["final_proj.weight"] = state_dict["model"].pop("final_proj.0.weight") state_dict["model"]["final_proj.bias"] = state_dict["model"].pop("final_proj.0.bias") converted_ckpt = os.path.join(data2vec_checkpoint_dir, "converted.pt") torch.save(state_dict, converted_ckpt) else: hf_wav2vec = Data2VecAudioForCTC(config) converted_ckpt = checkpoint_path def load_data2vec(path): model, _, _ = fairseq.checkpoint_utils.load_model_ensemble_and_task([path]) return model[0].eval() model = load_data2vec(converted_ckpt) recursively_load_weights(model, hf_wav2vec, not is_finetuned) processor = Wav2Vec2Processor.from_pretrained("facebook/wav2vec2-large-lv60") ds = load_dataset("patrickvonplaten/librispeech_asr_dummy", "clean", split="validation") input_audio = [x["array"] for x in ds[:4]["audio"]] inputs = processor(input_audio, return_tensors="pt", padding=True) input_values = inputs.input_values attention_mask = inputs.attention_mask # input_values = inputs.input_values[:, :-1] # attention_mask = inputs.attention_mask[:, :-1] hf_wav2vec.eval() model.eval() if is_finetuned: their_output = model(source=input_values, padding_mask=(1 - attention_mask), mask=False, features_only=True)[ "encoder_out" ].transpose(0, 1) our_output = hf_wav2vec(input_values, attention_mask=attention_mask)["logits"] pred_ids = torch.argmax(our_output, dim=-1) output_string = processor.batch_decode(pred_ids) print(f"Expected Output: {ds[:4]['text']}, Pred: {output_string}") else: their_output = model(source=input_values, padding_mask=(1 - attention_mask), mask=False, features_only=True)[ "layer_results" ][-1][0].transpose(0, 1) our_output = hf_wav2vec(input_values, attention_mask=attention_mask)["last_hidden_state"] print(our_output.shape, their_output.shape) max_absolute_diff = torch.max(torch.abs(our_output - their_output)).item() print(f"max_absolute_diff = {max_absolute_diff}") # ~ 1e-7 success = torch.allclose(our_output, their_output, atol=1e-3) print("Do both models output the same tensors?", "🔥" if success else "💩") if not success: raise Exception("Something went wRoNg") hf_wav2vec.save_pretrained(pytorch_dump_folder_path) if is_finetuned: processor.save_pretrained(pytorch_dump_folder_path) else: processor.feature_extractor.save_pretrained(pytorch_dump_folder_path)
Copy/paste/tweak model's weights to transformers design.
10,863
import argparse import os import pathlib import fairseq import torch from fairseq.modules import TransformerSentenceEncoderLayer from packaging import version from transformers import Data2VecTextConfig, Data2VecTextForMaskedLM, Data2VecTextForSequenceClassification from transformers.models.bert.modeling_bert import ( BertIntermediate, BertLayer, BertOutput, BertSelfAttention, BertSelfOutput, ) from transformers.models.data2vec.data2vec_text import Data2VecTextModel from transformers.utils import logging SAMPLE_TEXT = "Hello world! cécé herlolip" The provided code snippet includes necessary dependencies for implementing the `convert_data2vec_checkpoint_to_pytorch` function. Write a Python function `def convert_data2vec_checkpoint_to_pytorch( data2vec_checkpoint_path: str, pytorch_dump_folder_path: str, classification_head: bool )` to solve the following problem: Copy/paste/tweak data2vec's weights to our BERT structure. Here is the function: def convert_data2vec_checkpoint_to_pytorch( data2vec_checkpoint_path: str, pytorch_dump_folder_path: str, classification_head: bool ): """ Copy/paste/tweak data2vec's weights to our BERT structure. """ data2vec_checkpoint_dir, data2vec_checkpoint_file_name = os.path.split(data2vec_checkpoint_path) data2vec = Data2VecTextModel.from_pretrained( data2vec_checkpoint_dir, checkpoint_file=data2vec_checkpoint_file_name ) data2vec.eval() # disable dropout data2vec_model = data2vec.models[0] data2vec_sent_encoder = data2vec_model.encoder.sentence_encoder config = Data2VecTextConfig( vocab_size=data2vec_sent_encoder.embed_tokens.num_embeddings, hidden_size=data2vec_model.args.encoder_embed_dim, num_hidden_layers=data2vec_model.args.encoder_layers, num_attention_heads=data2vec_model.args.encoder_attention_heads, intermediate_size=data2vec_model.args.encoder_ffn_embed_dim, max_position_embeddings=514, type_vocab_size=1, layer_norm_eps=1e-5, # PyTorch default used in fairseq ) if classification_head: config.num_labels = data2vec.model.classification_heads["mnli"].out_proj.weight.shape[0] print("Our BERT config:", config) model = Data2VecTextForSequenceClassification(config) if classification_head else Data2VecTextForMaskedLM(config) model.eval() # Now let's copy all the weights. # Embeddings model.data2vec_text.embeddings.word_embeddings.weight = data2vec_sent_encoder.embed_tokens.weight model.data2vec_text.embeddings.position_embeddings.weight = data2vec_sent_encoder.embed_positions.weight model.data2vec_text.embeddings.token_type_embeddings.weight.data = torch.zeros_like( model.data2vec_text.embeddings.token_type_embeddings.weight ) # just zero them out b/c data2vec doesn't use them. model.data2vec_text.embeddings.LayerNorm.weight = data2vec_sent_encoder.layernorm_embedding.weight model.data2vec_text.embeddings.LayerNorm.bias = data2vec_sent_encoder.layernorm_embedding.bias for i in range(config.num_hidden_layers): # Encoder: start of layer layer: BertLayer = model.data2vec_text.encoder.layer[i] data2vec_layer: TransformerSentenceEncoderLayer = data2vec_sent_encoder.layers[i] # self attention self_attn: BertSelfAttention = layer.attention.self assert data2vec_layer.self_attn.k_proj.weight.data.shape == torch.Size( (config.hidden_size, config.hidden_size) ), ( "Shape for data2vec_layer.self_attn.k_proj.weight.data should be" f" {torch.Size((config.hidden_size, config.hidden_size))}" ) assert data2vec_layer.self_attn.q_proj.weight.data.shape == torch.Size( (config.hidden_size, config.hidden_size) ), ( "Shape for data2vec_layer.self_attn.q_proj.weight.data should be" f" {torch.Size((config.hidden_size, config.hidden_size))}" ) assert data2vec_layer.self_attn.v_proj.weight.data.shape == torch.Size( (config.hidden_size, config.hidden_size) ), ( "Shape for data2vec_layer.self_attn.v_proj.weight.data should be" f" {torch.Size((config.hidden_size, config.hidden_size))}" ) self_attn.query.weight.data = data2vec_layer.self_attn.q_proj.weight self_attn.query.bias.data = data2vec_layer.self_attn.q_proj.bias self_attn.key.weight.data = data2vec_layer.self_attn.k_proj.weight self_attn.key.bias.data = data2vec_layer.self_attn.k_proj.bias self_attn.value.weight.data = data2vec_layer.self_attn.v_proj.weight self_attn.value.bias.data = data2vec_layer.self_attn.v_proj.bias # self-attention output self_output: BertSelfOutput = layer.attention.output assert ( self_output.dense.weight.shape == data2vec_layer.self_attn.out_proj.weight.shape ), f"Shape for self_output.dense.weight should be {data2vec_layer.self_attn.out_proj.weight.shape}" self_output.dense.weight = data2vec_layer.self_attn.out_proj.weight self_output.dense.bias = data2vec_layer.self_attn.out_proj.bias self_output.LayerNorm.weight = data2vec_layer.self_attn_layer_norm.weight self_output.LayerNorm.bias = data2vec_layer.self_attn_layer_norm.bias # intermediate intermediate: BertIntermediate = layer.intermediate assert ( intermediate.dense.weight.shape == data2vec_layer.fc1.weight.shape ), f"Shape for intermediate.dense.weight should be {data2vec_layer.fc1.weight.shape}" intermediate.dense.weight = data2vec_layer.fc1.weight intermediate.dense.bias = data2vec_layer.fc1.bias # output bert_output: BertOutput = layer.output assert ( bert_output.dense.weight.shape == data2vec_layer.fc2.weight.shape ), f"Shape for bert_output.dense.weight should be {data2vec_layer.fc2.weight.shape}" bert_output.dense.weight = data2vec_layer.fc2.weight bert_output.dense.bias = data2vec_layer.fc2.bias bert_output.LayerNorm.weight = data2vec_layer.final_layer_norm.weight bert_output.LayerNorm.bias = data2vec_layer.final_layer_norm.bias # end of layer if classification_head: model.classifier.dense.weight = data2vec.model.classification_heads["mnli"].dense.weight model.classifier.dense.bias = data2vec.model.classification_heads["mnli"].dense.bias model.classifier.out_proj.weight = data2vec.model.classification_heads["mnli"].out_proj.weight model.classifier.out_proj.bias = data2vec.model.classification_heads["mnli"].out_proj.bias else: # LM Head model.lm_head.dense.weight = data2vec_model.encoder.lm_head.dense.weight model.lm_head.dense.bias = data2vec_model.encoder.lm_head.dense.bias model.lm_head.layer_norm.weight = data2vec_model.encoder.lm_head.layer_norm.weight model.lm_head.layer_norm.bias = data2vec_model.encoder.lm_head.layer_norm.bias model.lm_head.decoder.weight = data2vec_model.encoder.lm_head.weight model.lm_head.decoder.bias = data2vec_model.encoder.lm_head.bias # Let's check that we get the same results. input_ids: torch.Tensor = data2vec.encode(SAMPLE_TEXT).unsqueeze(0) # batch of size 1 our_output = model(input_ids)[0] if classification_head: their_output = data2vec.model.classification_heads["mnli"](data2vec.extract_features(input_ids)) else: their_output = data2vec_model(input_ids)[0] print(our_output.shape, their_output.shape) max_absolute_diff = torch.max(torch.abs(our_output - their_output)).item() print(f"max_absolute_diff = {max_absolute_diff}") # ~ 1e-7 success = torch.allclose(our_output, their_output, atol=1e-3) print("Do both models output the same tensors?", "🔥" if success else "💩") if not success: raise Exception("Something went wRoNg") pathlib.Path(pytorch_dump_folder_path).mkdir(parents=True, exist_ok=True) print(f"Saving model to {pytorch_dump_folder_path}") model.save_pretrained(pytorch_dump_folder_path)
Copy/paste/tweak data2vec's weights to our BERT structure.
10,864
import argparse import json import torch from PIL import Image from huggingface_hub import hf_hub_download from timm.models import create_model from transformers import ( BeitFeatureExtractor, Data2VecVisionConfig, Data2VecVisionForImageClassification, Data2VecVisionModel, ) def create_rename_keys(config, has_lm_head=False, is_semantic=False, hf_prefix="data2vec."): prefix = "backbone." if is_semantic else "" rename_keys = [] for i in range(config.num_hidden_layers): # encoder layers: output projection, 2 feedforward neural networks and 2 layernorms rename_keys.append( (f"{prefix}blocks.{i}.norm1.weight", f"{hf_prefix}encoder.layer.{i}.layernorm_before.weight") ) rename_keys.append((f"{prefix}blocks.{i}.norm1.bias", f"{hf_prefix}encoder.layer.{i}.layernorm_before.bias")) rename_keys.append( (f"{prefix}blocks.{i}.attn.proj.weight", f"{hf_prefix}encoder.layer.{i}.attention.output.dense.weight") ) rename_keys.append( (f"{prefix}blocks.{i}.attn.proj.bias", f"{hf_prefix}encoder.layer.{i}.attention.output.dense.bias") ) rename_keys.append( (f"{prefix}blocks.{i}.norm2.weight", f"{hf_prefix}encoder.layer.{i}.layernorm_after.weight") ) rename_keys.append((f"{prefix}blocks.{i}.norm2.bias", f"{hf_prefix}encoder.layer.{i}.layernorm_after.bias")) rename_keys.append( (f"{prefix}blocks.{i}.mlp.fc1.weight", f"{hf_prefix}encoder.layer.{i}.intermediate.dense.weight") ) rename_keys.append( (f"{prefix}blocks.{i}.mlp.fc1.bias", f"{hf_prefix}encoder.layer.{i}.intermediate.dense.bias") ) rename_keys.append((f"{prefix}blocks.{i}.mlp.fc2.weight", f"{hf_prefix}encoder.layer.{i}.output.dense.weight")) rename_keys.append((f"{prefix}blocks.{i}.mlp.fc2.bias", f"{hf_prefix}encoder.layer.{i}.output.dense.bias")) # projection layer + position embeddings rename_keys.extend( [ (f"{prefix}cls_token", f"{hf_prefix}embeddings.cls_token"), (f"{prefix}patch_embed.proj.weight", f"{hf_prefix}embeddings.patch_embeddings.projection.weight"), (f"{prefix}patch_embed.proj.bias", f"{hf_prefix}embeddings.patch_embeddings.projection.bias"), ] ) if has_lm_head: # mask token + shared relative position bias + layernorm rename_keys.extend( [ ("mask_token", f"{hf_prefix}embeddings.mask_token"), ( "rel_pos_bias.relative_position_bias_table", f"{hf_prefix}encoder.relative_position_bias.relative_position_bias_table", ), ( "rel_pos_bias.relative_position_index", f"{hf_prefix}encoder.relative_position_bias.relative_position_index", ), ("norm.weight", "layernorm.weight"), ("norm.bias", "layernorm.bias"), ] ) elif is_semantic: # semantic segmentation classification heads rename_keys.extend( [ ("decode_head.conv_seg.weight", "decode_head.classifier.weight"), ("decode_head.conv_seg.bias", "decode_head.classifier.bias"), ("auxiliary_head.conv_seg.weight", "auxiliary_head.classifier.weight"), ("auxiliary_head.conv_seg.bias", "auxiliary_head.classifier.bias"), ] ) else: # layernorm + classification head rename_keys.extend( [ ("fc_norm.weight", f"{hf_prefix}pooler.layernorm.weight"), ("fc_norm.bias", f"{hf_prefix}pooler.layernorm.bias"), ("head.weight", "classifier.weight"), ("head.bias", "classifier.bias"), ] ) return rename_keys
null
10,865
import argparse import json import torch from PIL import Image from huggingface_hub import hf_hub_download from timm.models import create_model from transformers import ( BeitFeatureExtractor, Data2VecVisionConfig, Data2VecVisionForImageClassification, Data2VecVisionModel, ) def read_in_q_k_v(state_dict, config, has_lm_head=False, is_semantic=False, hf_prefix="data2vec_vision."): for i in range(config.num_hidden_layers): prefix = "backbone." if is_semantic else "" # queries, keys and values in_proj_weight = state_dict.pop(f"{prefix}blocks.{i}.attn.qkv.weight") q_bias = state_dict.pop(f"{prefix}blocks.{i}.attn.q_bias") v_bias = state_dict.pop(f"{prefix}blocks.{i}.attn.v_bias") state_dict[f"{hf_prefix}encoder.layer.{i}.attention.attention.query.weight"] = in_proj_weight[ : config.hidden_size, : ] state_dict[f"{hf_prefix}encoder.layer.{i}.attention.attention.query.bias"] = q_bias state_dict[f"{hf_prefix}encoder.layer.{i}.attention.attention.key.weight"] = in_proj_weight[ config.hidden_size : config.hidden_size * 2, : ] state_dict[f"{hf_prefix}encoder.layer.{i}.attention.attention.value.weight"] = in_proj_weight[ -config.hidden_size :, : ] state_dict[f"{hf_prefix}encoder.layer.{i}.attention.attention.value.bias"] = v_bias # gamma_1 and gamma_2 # we call them lambda because otherwise they are renamed when using .from_pretrained gamma_1 = state_dict.pop(f"{prefix}blocks.{i}.gamma_1") gamma_2 = state_dict.pop(f"{prefix}blocks.{i}.gamma_2") state_dict[f"{hf_prefix}encoder.layer.{i}.lambda_1"] = gamma_1 state_dict[f"{hf_prefix}encoder.layer.{i}.lambda_2"] = gamma_2 # relative_position bias table + index if not has_lm_head: # each layer has its own relative position bias table = state_dict.pop(f"{prefix}blocks.{i}.attn.relative_position_bias_table") index = state_dict.pop(f"{prefix}blocks.{i}.attn.relative_position_index") state_dict[ f"{hf_prefix}encoder.layer.{i}.attention.attention.relative_position_bias.relative_position_bias_table" ] = table state_dict[ f"{hf_prefix}encoder.layer.{i}.attention.attention.relative_position_bias.relative_position_index" ] = index
null
10,866
import argparse import json import torch from PIL import Image from huggingface_hub import hf_hub_download from timm.models import create_model from transformers import ( BeitFeatureExtractor, Data2VecVisionConfig, Data2VecVisionForImageClassification, Data2VecVisionModel, ) def get_args(): parser = argparse.ArgumentParser( "Convert Data2VecVision to HF for image classification and pretraining", add_help=False ) parser.add_argument("--hf_checkpoint_name", type=str) parser.add_argument("--input_size", default=224, type=int, help="images input size") parser.add_argument("--beit_checkpoint", default="", help="beit checkpoint") return parser.parse_args()
null
10,867
import argparse import json import torch from PIL import Image from huggingface_hub import hf_hub_download from timm.models import create_model from transformers import ( BeitFeatureExtractor, Data2VecVisionConfig, Data2VecVisionForImageClassification, Data2VecVisionModel, ) def load_beit_model(args, is_finetuned, is_large): def load_state_dict(model, state_dict, prefix="", ignore_missing="relative_position_index"): missing_keys = [] unexpected_keys = [] error_msgs = [] # copy state_dict so _load_from_state_dict can modify it metadata = getattr(state_dict, "_metadata", None) state_dict = state_dict.copy() if metadata is not None: state_dict._metadata = metadata def load(module, prefix=""): local_metadata = {} if metadata is None else metadata.get(prefix[:-1], {}) module._load_from_state_dict( state_dict, prefix, local_metadata, True, missing_keys, unexpected_keys, error_msgs ) for name, child in module._modules.items(): if child is not None: load(child, prefix + name + ".") load(model, prefix=prefix) warn_missing_keys = [] ignore_missing_keys = [] for key in missing_keys: keep_flag = True for ignore_key in ignore_missing.split("|"): if ignore_key in key: keep_flag = False break if keep_flag: warn_missing_keys.append(key) else: ignore_missing_keys.append(key) missing_keys = warn_missing_keys if len(missing_keys) > 0: print( "Weights of {} not initialized from pretrained model: {}".format( model.__class__.__name__, missing_keys ) ) if len(unexpected_keys) > 0: print("Weights from pretrained model not used in {}: {}".format(model.__class__.__name__, unexpected_keys)) if len(ignore_missing_keys) > 0: print( "Ignored weights of {} not initialized from pretrained model: {}".format( model.__class__.__name__, ignore_missing_keys ) ) if len(error_msgs) > 0: print("\n".join(error_msgs)) model_kwargs = { "pretrained": False, "use_shared_rel_pos_bias": True, "use_abs_pos_emb": False, "init_values": 0.1, } if is_finetuned: model_kwargs.update( { "num_classes": 1000, "use_mean_pooling": True, "init_scale": 0.001, "use_rel_pos_bias": True, } ) model = create_model( "beit_large_patch16_224" if is_large else "beit_base_patch16_224", **model_kwargs, ) patch_size = model.patch_embed.patch_size args.window_size = (args.input_size // patch_size[0], args.input_size // patch_size[1]) checkpoint = torch.load(args.beit_checkpoint, map_location="cpu") print(f"Load ckpt from {args.beit_checkpoint}") checkpoint_model = None for model_key in ("model", "module"): if model_key in checkpoint: checkpoint_model = checkpoint[model_key] print(f"Load state_dict by model_key = {model_key}") break all_keys = list(checkpoint_model.keys()) for key in all_keys: if "relative_position_index" in key: checkpoint_model.pop(key) if "relative_position_bias_table" in key: rel_pos_bias = checkpoint_model[key] src_num_pos, num_attn_heads = rel_pos_bias.size() dst_num_pos, _ = model.state_dict()[key].size() dst_patch_shape = model.patch_embed.patch_shape if dst_patch_shape[0] != dst_patch_shape[1]: raise NotImplementedError() load_state_dict(model, checkpoint_model, prefix="") return model
null
10,868
import math from typing import Dict, Optional, Sequence, Tuple, Union import numpy as np import tensorflow as tf from ...activations_tf import get_tf_activation from ...modeling_tf_outputs import ( TFBaseModelOutput, TFMaskedLMOutput, TFQuestionAnsweringModelOutput, TFSequenceClassifierOutput, TFTokenClassifierOutput, ) from ...modeling_tf_utils import ( TFMaskedLanguageModelingLoss, TFModelInputType, TFPreTrainedModel, TFQuestionAnsweringLoss, TFSequenceClassificationLoss, TFTokenClassificationLoss, get_initializer, unpack_inputs, ) from ...tf_utils import shape_list, stable_softmax from ...utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging from .configuration_deberta import DebertaConfig The provided code snippet includes necessary dependencies for implementing the `build_relative_position` function. Write a Python function `def build_relative_position(query_size, key_size)` to solve the following problem: Build relative position according to the query and key We assume the absolute position of query \\(P_q\\) is range from (0, query_size) and the absolute position of key \\(P_k\\) is range from (0, key_size), The relative positions from query to key is \\(R_{q \\rightarrow k} = P_q - P_k\\) Args: query_size (int): the length of query key_size (int): the length of key Return: `tf.Tensor`: A tensor with shape [1, query_size, key_size] Here is the function: def build_relative_position(query_size, key_size): """ Build relative position according to the query and key We assume the absolute position of query \\(P_q\\) is range from (0, query_size) and the absolute position of key \\(P_k\\) is range from (0, key_size), The relative positions from query to key is \\(R_{q \\rightarrow k} = P_q - P_k\\) Args: query_size (int): the length of query key_size (int): the length of key Return: `tf.Tensor`: A tensor with shape [1, query_size, key_size] """ q_ids = tf.range(query_size, dtype=tf.int32) k_ids = tf.range(key_size, dtype=tf.int32) rel_pos_ids = q_ids[:, None] - tf.tile(tf.reshape(k_ids, [1, -1]), [query_size, 1]) rel_pos_ids = rel_pos_ids[:query_size, :] rel_pos_ids = tf.expand_dims(rel_pos_ids, axis=0) return tf.cast(rel_pos_ids, tf.int64)
Build relative position according to the query and key We assume the absolute position of query \\(P_q\\) is range from (0, query_size) and the absolute position of key \\(P_k\\) is range from (0, key_size), The relative positions from query to key is \\(R_{q \\rightarrow k} = P_q - P_k\\) Args: query_size (int): the length of query key_size (int): the length of key Return: `tf.Tensor`: A tensor with shape [1, query_size, key_size]
10,869
import math from typing import Dict, Optional, Sequence, Tuple, Union import numpy as np import tensorflow as tf from ...activations_tf import get_tf_activation from ...modeling_tf_outputs import ( TFBaseModelOutput, TFMaskedLMOutput, TFQuestionAnsweringModelOutput, TFSequenceClassifierOutput, TFTokenClassifierOutput, ) from ...modeling_tf_utils import ( TFMaskedLanguageModelingLoss, TFModelInputType, TFPreTrainedModel, TFQuestionAnsweringLoss, TFSequenceClassificationLoss, TFTokenClassificationLoss, get_initializer, unpack_inputs, ) from ...tf_utils import shape_list, stable_softmax from ...utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging from .configuration_deberta import DebertaConfig def shape_list(tensor: Union[tf.Tensor, np.ndarray]) -> List[int]: """ Deal with dynamic shape in tensorflow cleanly. Args: tensor (`tf.Tensor` or `np.ndarray`): The tensor we want the shape of. Returns: `List[int]`: The shape of the tensor as a list. """ if isinstance(tensor, np.ndarray): return list(tensor.shape) dynamic = tf.shape(tensor) if tensor.shape == tf.TensorShape(None): return dynamic static = tensor.shape.as_list() return [dynamic[i] if s is None else s for i, s in enumerate(static)] def c2p_dynamic_expand(c2p_pos, query_layer, relative_pos): shapes = [ shape_list(query_layer)[0], shape_list(query_layer)[1], shape_list(query_layer)[2], shape_list(relative_pos)[-1], ] return tf.broadcast_to(c2p_pos, shapes)
null
10,870
import math from typing import Dict, Optional, Sequence, Tuple, Union import numpy as np import tensorflow as tf from ...activations_tf import get_tf_activation from ...modeling_tf_outputs import ( TFBaseModelOutput, TFMaskedLMOutput, TFQuestionAnsweringModelOutput, TFSequenceClassifierOutput, TFTokenClassifierOutput, ) from ...modeling_tf_utils import ( TFMaskedLanguageModelingLoss, TFModelInputType, TFPreTrainedModel, TFQuestionAnsweringLoss, TFSequenceClassificationLoss, TFTokenClassificationLoss, get_initializer, unpack_inputs, ) from ...tf_utils import shape_list, stable_softmax from ...utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging from .configuration_deberta import DebertaConfig def shape_list(tensor: Union[tf.Tensor, np.ndarray]) -> List[int]: """ Deal with dynamic shape in tensorflow cleanly. Args: tensor (`tf.Tensor` or `np.ndarray`): The tensor we want the shape of. Returns: `List[int]`: The shape of the tensor as a list. """ if isinstance(tensor, np.ndarray): return list(tensor.shape) dynamic = tf.shape(tensor) if tensor.shape == tf.TensorShape(None): return dynamic static = tensor.shape.as_list() return [dynamic[i] if s is None else s for i, s in enumerate(static)] def p2c_dynamic_expand(c2p_pos, query_layer, key_layer): shapes = [ shape_list(query_layer)[0], shape_list(query_layer)[1], shape_list(key_layer)[-2], shape_list(key_layer)[-2], ] return tf.broadcast_to(c2p_pos, shapes)
null
10,871
import math from typing import Dict, Optional, Sequence, Tuple, Union import numpy as np import tensorflow as tf from ...activations_tf import get_tf_activation from ...modeling_tf_outputs import ( TFBaseModelOutput, TFMaskedLMOutput, TFQuestionAnsweringModelOutput, TFSequenceClassifierOutput, TFTokenClassifierOutput, ) from ...modeling_tf_utils import ( TFMaskedLanguageModelingLoss, TFModelInputType, TFPreTrainedModel, TFQuestionAnsweringLoss, TFSequenceClassificationLoss, TFTokenClassificationLoss, get_initializer, unpack_inputs, ) from ...tf_utils import shape_list, stable_softmax from ...utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging from .configuration_deberta import DebertaConfig def shape_list(tensor: Union[tf.Tensor, np.ndarray]) -> List[int]: """ Deal with dynamic shape in tensorflow cleanly. Args: tensor (`tf.Tensor` or `np.ndarray`): The tensor we want the shape of. Returns: `List[int]`: The shape of the tensor as a list. """ if isinstance(tensor, np.ndarray): return list(tensor.shape) dynamic = tf.shape(tensor) if tensor.shape == tf.TensorShape(None): return dynamic static = tensor.shape.as_list() return [dynamic[i] if s is None else s for i, s in enumerate(static)] def pos_dynamic_expand(pos_index, p2c_att, key_layer): shapes = shape_list(p2c_att)[:2] + [shape_list(pos_index)[-2], shape_list(key_layer)[-2]] return tf.broadcast_to(pos_index, shapes)
null
10,872
import math from typing import Dict, Optional, Sequence, Tuple, Union import numpy as np import tensorflow as tf from ...activations_tf import get_tf_activation from ...modeling_tf_outputs import ( TFBaseModelOutput, TFMaskedLMOutput, TFQuestionAnsweringModelOutput, TFSequenceClassifierOutput, TFTokenClassifierOutput, ) from ...modeling_tf_utils import ( TFMaskedLanguageModelingLoss, TFModelInputType, TFPreTrainedModel, TFQuestionAnsweringLoss, TFSequenceClassificationLoss, TFTokenClassificationLoss, get_initializer, unpack_inputs, ) from ...tf_utils import shape_list, stable_softmax from ...utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging from .configuration_deberta import DebertaConfig def torch_gather(x, indices, gather_axis): if gather_axis < 0: gather_axis = tf.rank(x) + gather_axis if gather_axis != tf.rank(x) - 1: pre_roll = tf.rank(x) - 1 - gather_axis permutation = tf.roll(tf.range(tf.rank(x)), pre_roll, axis=0) x = tf.transpose(x, perm=permutation) indices = tf.transpose(indices, perm=permutation) else: pre_roll = 0 flat_x = tf.reshape(x, (-1, tf.shape(x)[-1])) flat_indices = tf.reshape(indices, (-1, tf.shape(indices)[-1])) gathered = tf.gather(flat_x, flat_indices, batch_dims=1) gathered = tf.reshape(gathered, tf.shape(indices)) if pre_roll != 0: permutation = tf.roll(tf.range(tf.rank(x)), -pre_roll, axis=0) gathered = tf.transpose(gathered, perm=permutation) return gathered
null
10,873
import json import os from typing import TYPE_CHECKING, List, Optional, Tuple import regex as re from ...tokenization_utils import AddedToken, PreTrainedTokenizer from ...utils import logging The provided code snippet includes necessary dependencies for implementing the `bytes_to_unicode` function. Write a Python function `def bytes_to_unicode()` to solve the following problem: Returns list of utf-8 byte and a mapping to unicode strings. We specifically avoids mapping to whitespace/control characters the bpe code barfs on. The reversible bpe codes work on unicode strings. This means you need a large # of unicode characters in your vocab if you want to avoid UNKs. When you're at something like a 10B token dataset you end up needing around 5K for decent coverage. This is a significant percentage of your normal, say, 32K bpe vocab. To avoid that, we want lookup tables between utf-8 bytes and unicode strings. Here is the function: def bytes_to_unicode(): """ Returns list of utf-8 byte and a mapping to unicode strings. We specifically avoids mapping to whitespace/control characters the bpe code barfs on. The reversible bpe codes work on unicode strings. This means you need a large # of unicode characters in your vocab if you want to avoid UNKs. When you're at something like a 10B token dataset you end up needing around 5K for decent coverage. This is a significant percentage of your normal, say, 32K bpe vocab. To avoid that, we want lookup tables between utf-8 bytes and unicode strings. """ bs = ( list(range(ord("!"), ord("~") + 1)) + list(range(ord("¡"), ord("¬") + 1)) + list(range(ord("®"), ord("ÿ") + 1)) ) cs = bs[:] n = 0 for b in range(2**8): if b not in bs: bs.append(b) cs.append(2**8 + n) n += 1 cs = [chr(n) for n in cs] return dict(zip(bs, cs))
Returns list of utf-8 byte and a mapping to unicode strings. We specifically avoids mapping to whitespace/control characters the bpe code barfs on. The reversible bpe codes work on unicode strings. This means you need a large # of unicode characters in your vocab if you want to avoid UNKs. When you're at something like a 10B token dataset you end up needing around 5K for decent coverage. This is a significant percentage of your normal, say, 32K bpe vocab. To avoid that, we want lookup tables between utf-8 bytes and unicode strings.
10,874
import json import os from typing import TYPE_CHECKING, List, Optional, Tuple import regex as re from ...tokenization_utils import AddedToken, PreTrainedTokenizer from ...utils import logging The provided code snippet includes necessary dependencies for implementing the `get_pairs` function. Write a Python function `def get_pairs(word)` to solve the following problem: Return set of symbol pairs in a word. Word is represented as tuple of symbols (symbols being variable-length strings). Here is the function: def get_pairs(word): """ Return set of symbol pairs in a word. Word is represented as tuple of symbols (symbols being variable-length strings). """ pairs = set() prev_char = word[0] for char in word[1:]: pairs.add((prev_char, char)) prev_char = char return pairs
Return set of symbol pairs in a word. Word is represented as tuple of symbols (symbols being variable-length strings).
10,875
from collections.abc import Sequence from typing import Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...activations import ACT2FN from ...modeling_outputs import ( BaseModelOutput, MaskedLMOutput, QuestionAnsweringModelOutput, SequenceClassifierOutput, TokenClassifierOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import softmax_backward_data from ...utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging from .configuration_deberta import DebertaConfig class DropoutContext(object): def __init__(self): def get_mask(input, local_context): if not isinstance(local_context, DropoutContext): dropout = local_context mask = None else: dropout = local_context.dropout dropout *= local_context.scale mask = local_context.mask if local_context.reuse_mask else None if dropout > 0 and mask is None: mask = (1 - torch.empty_like(input).bernoulli_(1 - dropout)).to(torch.bool) if isinstance(local_context, DropoutContext): if local_context.mask is None: local_context.mask = mask return mask, dropout
null
10,876
from collections.abc import Sequence from typing import Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...activations import ACT2FN from ...modeling_outputs import ( BaseModelOutput, MaskedLMOutput, QuestionAnsweringModelOutput, SequenceClassifierOutput, TokenClassifierOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import softmax_backward_data from ...utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging from .configuration_deberta import DebertaConfig The provided code snippet includes necessary dependencies for implementing the `build_relative_position` function. Write a Python function `def build_relative_position(query_size, key_size, device)` to solve the following problem: Build relative position according to the query and key We assume the absolute position of query \\(P_q\\) is range from (0, query_size) and the absolute position of key \\(P_k\\) is range from (0, key_size), The relative positions from query to key is \\(R_{q \\rightarrow k} = P_q - P_k\\) Args: query_size (int): the length of query key_size (int): the length of key Return: `torch.LongTensor`: A tensor with shape [1, query_size, key_size] Here is the function: def build_relative_position(query_size, key_size, device): """ Build relative position according to the query and key We assume the absolute position of query \\(P_q\\) is range from (0, query_size) and the absolute position of key \\(P_k\\) is range from (0, key_size), The relative positions from query to key is \\(R_{q \\rightarrow k} = P_q - P_k\\) Args: query_size (int): the length of query key_size (int): the length of key Return: `torch.LongTensor`: A tensor with shape [1, query_size, key_size] """ q_ids = torch.arange(query_size, dtype=torch.long, device=device) k_ids = torch.arange(key_size, dtype=torch.long, device=device) rel_pos_ids = q_ids[:, None] - k_ids.view(1, -1).repeat(query_size, 1) rel_pos_ids = rel_pos_ids[:query_size, :] rel_pos_ids = rel_pos_ids.unsqueeze(0) return rel_pos_ids
Build relative position according to the query and key We assume the absolute position of query \\(P_q\\) is range from (0, query_size) and the absolute position of key \\(P_k\\) is range from (0, key_size), The relative positions from query to key is \\(R_{q \\rightarrow k} = P_q - P_k\\) Args: query_size (int): the length of query key_size (int): the length of key Return: `torch.LongTensor`: A tensor with shape [1, query_size, key_size]
10,877
from collections.abc import Sequence from typing import Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...activations import ACT2FN from ...modeling_outputs import ( BaseModelOutput, MaskedLMOutput, QuestionAnsweringModelOutput, SequenceClassifierOutput, TokenClassifierOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import softmax_backward_data from ...utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging from .configuration_deberta import DebertaConfig def c2p_dynamic_expand(c2p_pos, query_layer, relative_pos): return c2p_pos.expand([query_layer.size(0), query_layer.size(1), query_layer.size(2), relative_pos.size(-1)])
null
10,878
from collections.abc import Sequence from typing import Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...activations import ACT2FN from ...modeling_outputs import ( BaseModelOutput, MaskedLMOutput, QuestionAnsweringModelOutput, SequenceClassifierOutput, TokenClassifierOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import softmax_backward_data from ...utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging from .configuration_deberta import DebertaConfig def p2c_dynamic_expand(c2p_pos, query_layer, key_layer): return c2p_pos.expand([query_layer.size(0), query_layer.size(1), key_layer.size(-2), key_layer.size(-2)])
null
10,879
from collections.abc import Sequence from typing import Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...activations import ACT2FN from ...modeling_outputs import ( BaseModelOutput, MaskedLMOutput, QuestionAnsweringModelOutput, SequenceClassifierOutput, TokenClassifierOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import softmax_backward_data from ...utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging from .configuration_deberta import DebertaConfig def pos_dynamic_expand(pos_index, p2c_att, key_layer): return pos_index.expand(p2c_att.size()[:2] + (pos_index.size(-2), key_layer.size(-2)))
null
10,880
import math from typing import Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import CrossEntropyLoss from ...activations import ACT2FN from ...modeling_outputs import BaseModelOutputWithPastAndCrossAttentions, CausalLMOutputWithCrossAttentions from ...modeling_utils import PreTrainedModel from ...pytorch_utils import apply_chunking_to_forward, find_pruneable_heads_and_indices, prune_linear_layer from ...utils import ( add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_bert_generation import BertGenerationConfig logger = logging.get_logger(__name__) def load_tf_weights_in_bert_generation( model, tf_hub_path, model_class, is_encoder_named_decoder=False, is_encoder=False ): try: import numpy as np import tensorflow.compat.v1 as tf import tensorflow_hub as hub import tensorflow_text # noqa: F401 tf.disable_eager_execution() except ImportError: logger.error( "Loading a TensorFlow model in PyTorch, requires TensorFlow to be installed. Please see " "https://www.tensorflow.org/install/ for installation instructions." ) raise tf_model = hub.Module(tf_hub_path) init = tf.global_variables_initializer() with tf.Session() as sess: init.run() all_variables = tf_model.variable_map keep_track_variables = all_variables.copy() for key in list(all_variables.keys()): if "global" in key: logger.info(f"Skipping {key}...") continue if not is_encoder: model_pointer = getattr(model, model_class) else: model_pointer = model is_embedding = False logger.info(f"Trying to match {key}...") # remove start_string = "module/bert/" sub_layers = key.split("/")[2:] if is_encoder_named_decoder and sub_layers[0] == "encoder": logger.info(f"Skipping encoder layer {key} for decoder") continue if is_encoder and sub_layers[0] == "decoder": logger.info(f"Skipping decoder layer {key} for encoder") continue for i, sub_layer in enumerate(sub_layers): if sub_layer == "embeddings": is_embedding = True elif sub_layer == "LayerNorm": is_embedding = False if "layer" in sub_layer: model_pointer = model_pointer.layer[int(sub_layer.split("_")[-1])] elif sub_layer in ["kernel", "gamma"]: model_pointer = model_pointer.weight elif sub_layer == "beta": model_pointer = model_pointer.bias elif sub_layer == "encdec": model_pointer = model_pointer.crossattention.self elif sub_layer == "encdec_output": model_pointer = model_pointer.crossattention.output elif is_encoder_named_decoder and sub_layer == "decoder": model_pointer = model_pointer.encoder else: if sub_layer == "attention" and "encdec" in sub_layers[i + 1]: continue try: model_pointer = getattr(model_pointer, sub_layer) except AttributeError: logger.info(f"Skipping to initialize {key} at {sub_layer}...") raise AttributeError array = np.asarray(sess.run(all_variables[key])) if not is_embedding: logger.info(f"Transposing numpy weight of shape {array.shape} for {key}") array = np.transpose(array) else: model_pointer = model_pointer.weight if model_pointer.shape != array.shape: raise ValueError(f"Pointer shape {model_pointer.shape} and array shape {array.shape} mismatched") logger.info(f"Initialize PyTorch weight {key}") model_pointer.data = torch.from_numpy(array.astype(np.float32)) keep_track_variables.pop(key, None) logger.info(f"Weights not copied to PyTorch model: {', '.join(keep_track_variables.keys())}") return model
null
10,881
from dataclasses import dataclass from typing import Any, Dict, Optional, Tuple, Union import numpy as np import torch import torch.utils.checkpoint from torch import nn from ...activations import ACT2FN from ...modeling_outputs import BaseModelOutput, BaseModelOutputWithPooling from ...modeling_utils import PreTrainedModel from ...utils import ( ModelOutput, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_owlvit import OwlViTConfig, OwlViTTextConfig, OwlViTVisionConfig The provided code snippet includes necessary dependencies for implementing the `_expand_mask` function. Write a Python function `def _expand_mask(mask: torch.Tensor, dtype: torch.dtype, tgt_len: Optional[int] = None)` to solve the following problem: Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`. Here is the function: def _expand_mask(mask: torch.Tensor, dtype: torch.dtype, tgt_len: Optional[int] = None): """ Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`. """ bsz, src_len = mask.size() tgt_len = tgt_len if tgt_len is not None else src_len expanded_mask = mask[:, None, None, :].expand(bsz, 1, tgt_len, src_len).to(dtype) inverted_mask = 1.0 - expanded_mask return inverted_mask.masked_fill(inverted_mask.to(torch.bool), torch.finfo(dtype).min)
Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`.
10,882
from dataclasses import dataclass from typing import Any, Dict, Optional, Tuple, Union import numpy as np import torch import torch.utils.checkpoint from torch import nn from ...activations import ACT2FN from ...modeling_outputs import BaseModelOutput, BaseModelOutputWithPooling from ...modeling_utils import PreTrainedModel from ...utils import ( ModelOutput, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_owlvit import OwlViTConfig, OwlViTTextConfig, OwlViTVisionConfig def contrastive_loss(logits: torch.Tensor) -> torch.Tensor: return nn.functional.cross_entropy(logits, torch.arange(len(logits), device=logits.device)) def owlvit_loss(similarity: torch.Tensor) -> torch.Tensor: caption_loss = contrastive_loss(similarity) image_loss = contrastive_loss(similarity.t()) return (caption_loss + image_loss) / 2.0
null
10,883
from typing import List, Optional, Union import numpy as np from PIL import Image from transformers.image_utils import PILImageResampling from ...feature_extraction_utils import BatchFeature, FeatureExtractionMixin from ...image_utils import ImageFeatureExtractionMixin, is_torch_tensor from ...utils import TensorType, is_torch_available, logging The provided code snippet includes necessary dependencies for implementing the `center_to_corners_format` function. Write a Python function `def center_to_corners_format(x)` to solve the following problem: Converts a PyTorch tensor of bounding boxes of center format (center_x, center_y, width, height) to corners format (left, top, right, bottom). Here is the function: def center_to_corners_format(x): """ Converts a PyTorch tensor of bounding boxes of center format (center_x, center_y, width, height) to corners format (left, top, right, bottom). """ x_center, y_center, width, height = x.unbind(-1) boxes = [(x_center - 0.5 * width), (y_center - 0.5 * height), (x_center + 0.5 * width), (y_center + 0.5 * height)] return torch.stack(boxes, dim=-1)
Converts a PyTorch tensor of bounding boxes of center format (center_x, center_y, width, height) to corners format (left, top, right, bottom).
10,884
import argparse import collections import torch import torch.nn as nn import jax import jax.numpy as jnp from clip.model import CLIP from flax.training import checkpoints from huggingface_hub import Repository from transformers import ( CLIPTokenizer, OwlViTConfig, OwlViTFeatureExtractor, OwlViTForObjectDetection, OwlViTModel, OwlViTProcessor, ) def to_f32(params): return jax.tree_util.tree_map(lambda x: x.astype(jnp.float32) if x.dtype == jnp.bfloat16 else x, params)
null
10,885
import argparse import collections import torch import torch.nn as nn import jax import jax.numpy as jnp from clip.model import CLIP from flax.training import checkpoints from huggingface_hub import Repository from transformers import ( CLIPTokenizer, OwlViTConfig, OwlViTFeatureExtractor, OwlViTForObjectDetection, OwlViTModel, OwlViTProcessor, ) def flatten_nested_dict(params, parent_key="", sep="/"): items = [] for k, v in params.items(): new_key = parent_key + sep + k if parent_key else k if isinstance(v, collections.MutableMapping): items.extend(flatten_nested_dict(v, new_key, sep=sep).items()) else: items.append((new_key, v)) return dict(items) def _convert_attn_layers(params): new_params = {} processed_attn_layers = [] for k, v in params.items(): if "attn." in k: base = k[: k.rindex("attn.") + 5] if base in processed_attn_layers: continue processed_attn_layers.append(base) dim = params[base + "out.weight"].shape[-1] new_params[base + "out_proj.weight"] = params[base + "out.weight"].reshape(dim, dim).T new_params[base + "out_proj.bias"] = params[base + "out.bias"] else: new_params[k] = v return new_params def convert_clip_backbone(flax_params, torch_config): torch_model = CLIP(**torch_config) torch_model.eval() torch_clip_params = torch_model.state_dict() flax_clip_params = flatten_nested_dict(flax_params["backbone"]["clip"]) new_torch_params = {} for flax_key, v in flax_clip_params.items(): torch_key = flax_key.replace("/", ".") torch_key = torch_key.replace("text.token_embedding.embedding", "token_embedding.kernel") if ( torch_key.startswith("text.transformer") or torch_key.startswith("text.text_projection") or torch_key.startswith("text.ln_final") or torch_key.startswith("text.positional_embedding") ): torch_key = torch_key[5:] torch_key = torch_key.replace("text_projection.kernel", "text_projection") torch_key = torch_key.replace("visual.proj.kernel", "visual.proj") torch_key = torch_key.replace(".scale", ".weight") torch_key = torch_key.replace(".kernel", ".weight") if "conv" in torch_key or "downsample.0.weight" in torch_key: v = v.transpose(3, 2, 0, 1) elif "weight" in torch_key and v.ndim == 2 and "embedding" not in torch_key: # Fully connected layers are transposed, embeddings are not v = v.T new_torch_params[torch_key] = v attn_params = _convert_attn_layers(new_torch_params) new_torch_params.update(attn_params) attn_params = {} # Copy flax CLIP backbone params to PyTorch params for name, param in new_torch_params.items(): if name in torch_clip_params.keys(): new_param = torch.from_numpy(new_torch_params[name]) torch_clip_params[name].copy_(new_param) else: attn_params[name] = param return torch_clip_params, torch_model, attn_params
null
10,886
import argparse import collections import torch import torch.nn as nn import jax import jax.numpy as jnp from clip.model import CLIP from flax.training import checkpoints from huggingface_hub import Repository from transformers import ( CLIPTokenizer, OwlViTConfig, OwlViTFeatureExtractor, OwlViTForObjectDetection, OwlViTModel, OwlViTProcessor, ) def copy_text_model_and_projection(hf_model, pt_model): # copy projection hf_model.text_projection.weight.data = pt_model.text_projection.data.T # copy text encoder copy_encoder(hf_model.text_model, pt_model) def copy_vision_model_and_projection(hf_model, pt_model): # copy projection hf_model.visual_projection.weight.data = pt_model.visual.proj.data.T # copy layer norms copy_linear(hf_model.vision_model.pre_layernorm, pt_model.visual.ln_pre) copy_linear(hf_model.vision_model.post_layernorm, pt_model.visual.ln_post) # copy embeds hf_model.vision_model.embeddings.patch_embedding.weight.data = pt_model.visual.conv1.weight.data hf_model.vision_model.embeddings.class_embedding = pt_model.visual.class_embedding hf_model.vision_model.embeddings.position_embedding.weight.data = pt_model.visual.positional_embedding.data # copy encoder copy_layers(hf_model.vision_model.encoder.layers, pt_model.visual.transformer.resblocks) def copy_class_merge_token(hf_model, flax_params): flax_class_token_params = flatten_nested_dict(flax_params["backbone"]["merged_class_token"]) weight = torch.from_numpy(flax_class_token_params["scale"]) bias = torch.from_numpy(flax_class_token_params["bias"]) hf_model.layer_norm.weight = nn.Parameter(weight) hf_model.layer_norm.bias = nn.Parameter(bias) def copy_class_box_heads(hf_model, flax_params): pt_params = hf_model.state_dict() new_params = {} # Rename class prediction head flax params to pytorch HF flax_class_params = flatten_nested_dict(flax_params["class_head"]) for flax_key, v in flax_class_params.items(): torch_key = flax_key.replace("/", ".") torch_key = torch_key.replace(".kernel", ".weight") torch_key = torch_key.replace("Dense_0", "dense0") torch_key = "class_head." + torch_key if "weight" in torch_key and v.ndim == 2: v = v.T new_params[torch_key] = nn.Parameter(torch.from_numpy(v)) # Rename box prediction box flax params to pytorch HF flax_box_params = flatten_nested_dict(flax_params["obj_box_head"]) for flax_key, v in flax_box_params.items(): torch_key = flax_key.replace("/", ".") torch_key = torch_key.replace(".kernel", ".weight") torch_key = torch_key.replace("_", "").lower() torch_key = "box_head." + torch_key if "weight" in torch_key and v.ndim == 2: v = v.T new_params[torch_key] = nn.Parameter(torch.from_numpy(v)) # Copy flax params to PyTorch params for name, param in new_params.items(): if name in pt_params.keys(): pt_params[name].copy_(param) def copy_flax_attn_params(hf_backbone, flax_attn_params): for k, v in flax_attn_params.items(): if k.startswith("transformer"): torch_key = k.replace("transformer.resblocks", "text_model.encoder.layers") else: torch_key = k.replace("visual.transformer.resblocks", "vision_model.encoder.layers") torch_key = torch_key.replace("attn", "self_attn") torch_key = torch_key.replace("key", "k_proj") torch_key = torch_key.replace("value", "v_proj") torch_key = torch_key.replace("query", "q_proj") torch_key = torch_key.replace("out", "out_proj") if "bias" in torch_key and v.ndim == 2: shape = v.shape[0] * v.shape[1] v = v.reshape(shape) if "weight" in torch_key and "out" in torch_key: shape = (v.shape[0] * v.shape[1], v.shape[2]) v = v.reshape(shape).T if "weight" in torch_key and "out" not in torch_key: shape = (v.shape[0], v.shape[1] * v.shape[2]) v = v.reshape(shape).T # Copy flax CLIP attn params to HF PyTorch params v = torch.from_numpy(v) hf_backbone.state_dict()[torch_key].copy_(v) The provided code snippet includes necessary dependencies for implementing the `convert_owlvit_checkpoint` function. Write a Python function `def convert_owlvit_checkpoint(pt_backbone, flax_params, attn_params, pytorch_dump_folder_path, config_path=None)` to solve the following problem: Copy/paste/tweak model's weights to transformers design. Here is the function: def convert_owlvit_checkpoint(pt_backbone, flax_params, attn_params, pytorch_dump_folder_path, config_path=None): """ Copy/paste/tweak model's weights to transformers design. """ repo = Repository(pytorch_dump_folder_path, clone_from=f"google/{pytorch_dump_folder_path}") repo.git_pull() if config_path is not None: config = OwlViTConfig.from_pretrained(config_path) else: config = OwlViTConfig() hf_backbone = OwlViTModel(config).eval() hf_model = OwlViTForObjectDetection(config).eval() copy_text_model_and_projection(hf_backbone, pt_backbone) copy_vision_model_and_projection(hf_backbone, pt_backbone) hf_backbone.logit_scale = pt_backbone.logit_scale copy_flax_attn_params(hf_backbone, attn_params) hf_model.owlvit = hf_backbone copy_class_merge_token(hf_model, flax_params) copy_class_box_heads(hf_model, flax_params) # Save HF model hf_model.save_pretrained(repo.local_dir) # Initialize feature extractor feature_extractor = OwlViTFeatureExtractor( size=config.vision_config.image_size, crop_size=config.vision_config.image_size ) # Initialize tokenizer tokenizer = CLIPTokenizer.from_pretrained("openai/clip-vit-base-patch32", pad_token="!", model_max_length=16) # Initialize processor processor = OwlViTProcessor(feature_extractor=feature_extractor, tokenizer=tokenizer) feature_extractor.save_pretrained(repo.local_dir) processor.save_pretrained(repo.local_dir) repo.git_add() repo.git_commit("Upload model and processor") repo.git_push()
Copy/paste/tweak model's weights to transformers design.
10,887
import argparse import json from pathlib import Path import torch from PIL import Image import requests import timm from huggingface_hub import hf_hub_download from transformers import DeiTConfig, DeiTFeatureExtractor, DeiTForImageClassificationWithTeacher from transformers.utils import logging def create_rename_keys(config, base_model=False): rename_keys = [] for i in range(config.num_hidden_layers): # encoder layers: output projection, 2 feedforward neural networks and 2 layernorms rename_keys.append((f"blocks.{i}.norm1.weight", f"deit.encoder.layer.{i}.layernorm_before.weight")) rename_keys.append((f"blocks.{i}.norm1.bias", f"deit.encoder.layer.{i}.layernorm_before.bias")) rename_keys.append((f"blocks.{i}.attn.proj.weight", f"deit.encoder.layer.{i}.attention.output.dense.weight")) rename_keys.append((f"blocks.{i}.attn.proj.bias", f"deit.encoder.layer.{i}.attention.output.dense.bias")) rename_keys.append((f"blocks.{i}.norm2.weight", f"deit.encoder.layer.{i}.layernorm_after.weight")) rename_keys.append((f"blocks.{i}.norm2.bias", f"deit.encoder.layer.{i}.layernorm_after.bias")) rename_keys.append((f"blocks.{i}.mlp.fc1.weight", f"deit.encoder.layer.{i}.intermediate.dense.weight")) rename_keys.append((f"blocks.{i}.mlp.fc1.bias", f"deit.encoder.layer.{i}.intermediate.dense.bias")) rename_keys.append((f"blocks.{i}.mlp.fc2.weight", f"deit.encoder.layer.{i}.output.dense.weight")) rename_keys.append((f"blocks.{i}.mlp.fc2.bias", f"deit.encoder.layer.{i}.output.dense.bias")) # projection layer + position embeddings rename_keys.extend( [ ("cls_token", "deit.embeddings.cls_token"), ("dist_token", "deit.embeddings.distillation_token"), ("patch_embed.proj.weight", "deit.embeddings.patch_embeddings.projection.weight"), ("patch_embed.proj.bias", "deit.embeddings.patch_embeddings.projection.bias"), ("pos_embed", "deit.embeddings.position_embeddings"), ] ) if base_model: # layernorm + pooler rename_keys.extend( [ ("norm.weight", "layernorm.weight"), ("norm.bias", "layernorm.bias"), ("pre_logits.fc.weight", "pooler.dense.weight"), ("pre_logits.fc.bias", "pooler.dense.bias"), ] ) # if just the base model, we should remove "deit" from all keys that start with "deit" rename_keys = [(pair[0], pair[1][4:]) if pair[1].startswith("deit") else pair for pair in rename_keys] else: # layernorm + classification heads rename_keys.extend( [ ("norm.weight", "deit.layernorm.weight"), ("norm.bias", "deit.layernorm.bias"), ("head.weight", "cls_classifier.weight"), ("head.bias", "cls_classifier.bias"), ("head_dist.weight", "distillation_classifier.weight"), ("head_dist.bias", "distillation_classifier.bias"), ] ) return rename_keys def read_in_q_k_v(state_dict, config, base_model=False): for i in range(config.num_hidden_layers): if base_model: prefix = "" else: prefix = "deit." # read in weights + bias of input projection layer (in timm, this is a single matrix + bias) in_proj_weight = state_dict.pop(f"blocks.{i}.attn.qkv.weight") in_proj_bias = state_dict.pop(f"blocks.{i}.attn.qkv.bias") # next, add query, keys and values (in that order) to the state dict state_dict[f"{prefix}encoder.layer.{i}.attention.attention.query.weight"] = in_proj_weight[ : config.hidden_size, : ] state_dict[f"{prefix}encoder.layer.{i}.attention.attention.query.bias"] = in_proj_bias[: config.hidden_size] state_dict[f"{prefix}encoder.layer.{i}.attention.attention.key.weight"] = in_proj_weight[ config.hidden_size : config.hidden_size * 2, : ] state_dict[f"{prefix}encoder.layer.{i}.attention.attention.key.bias"] = in_proj_bias[ config.hidden_size : config.hidden_size * 2 ] state_dict[f"{prefix}encoder.layer.{i}.attention.attention.value.weight"] = in_proj_weight[ -config.hidden_size :, : ] state_dict[f"{prefix}encoder.layer.{i}.attention.attention.value.bias"] = in_proj_bias[-config.hidden_size :] def rename_key(dct, old, new): val = dct.pop(old) dct[new] = val def prepare_img(): url = "http://images.cocodataset.org/val2017/000000039769.jpg" im = Image.open(requests.get(url, stream=True).raw) return im The provided code snippet includes necessary dependencies for implementing the `convert_deit_checkpoint` function. Write a Python function `def convert_deit_checkpoint(deit_name, pytorch_dump_folder_path)` to solve the following problem: Copy/paste/tweak model's weights to our DeiT structure. Here is the function: def convert_deit_checkpoint(deit_name, pytorch_dump_folder_path): """ Copy/paste/tweak model's weights to our DeiT structure. """ # define default DeiT configuration config = DeiTConfig() # all deit models have fine-tuned heads base_model = False # dataset (fine-tuned on ImageNet 2012), patch_size and image_size config.num_labels = 1000 repo_id = "huggingface/label-files" filename = "imagenet-1k-id2label.json" id2label = json.load(open(hf_hub_download(repo_id, filename, repo_type="dataset"), "r")) id2label = {int(k): v for k, v in id2label.items()} config.id2label = id2label config.label2id = {v: k for k, v in id2label.items()} config.patch_size = int(deit_name[-6:-4]) config.image_size = int(deit_name[-3:]) # size of the architecture if deit_name[9:].startswith("tiny"): config.hidden_size = 192 config.intermediate_size = 768 config.num_hidden_layers = 12 config.num_attention_heads = 3 elif deit_name[9:].startswith("small"): config.hidden_size = 384 config.intermediate_size = 1536 config.num_hidden_layers = 12 config.num_attention_heads = 6 if deit_name[9:].startswith("base"): pass elif deit_name[4:].startswith("large"): config.hidden_size = 1024 config.intermediate_size = 4096 config.num_hidden_layers = 24 config.num_attention_heads = 16 # load original model from timm timm_model = timm.create_model(deit_name, pretrained=True) timm_model.eval() # load state_dict of original model, remove and rename some keys state_dict = timm_model.state_dict() rename_keys = create_rename_keys(config, base_model) for src, dest in rename_keys: rename_key(state_dict, src, dest) read_in_q_k_v(state_dict, config, base_model) # load HuggingFace model model = DeiTForImageClassificationWithTeacher(config).eval() model.load_state_dict(state_dict) # Check outputs on an image, prepared by DeiTFeatureExtractor size = int( (256 / 224) * config.image_size ) # to maintain same ratio w.r.t. 224 images, see https://github.com/facebookresearch/deit/blob/ab5715372db8c6cad5740714b2216d55aeae052e/datasets.py#L103 feature_extractor = DeiTFeatureExtractor(size=size, crop_size=config.image_size) encoding = feature_extractor(images=prepare_img(), return_tensors="pt") pixel_values = encoding["pixel_values"] outputs = model(pixel_values) timm_logits = timm_model(pixel_values) assert timm_logits.shape == outputs.logits.shape assert torch.allclose(timm_logits, outputs.logits, atol=1e-3) Path(pytorch_dump_folder_path).mkdir(exist_ok=True) print(f"Saving model {deit_name} to {pytorch_dump_folder_path}") model.save_pretrained(pytorch_dump_folder_path) print(f"Saving feature extractor to {pytorch_dump_folder_path}") feature_extractor.save_pretrained(pytorch_dump_folder_path)
Copy/paste/tweak model's weights to our DeiT structure.
10,888
import argparse import json from pathlib import Path import torch from PIL import Image import requests import timm from huggingface_hub import hf_hub_download from transformers import DeiTFeatureExtractor, ViTConfig, ViTFeatureExtractor, ViTForImageClassification, ViTModel from transformers.utils import logging def create_rename_keys(config, base_model=False): rename_keys = [] for i in range(config.num_hidden_layers): # encoder layers: output projection, 2 feedforward neural networks and 2 layernorms rename_keys.append((f"blocks.{i}.norm1.weight", f"vit.encoder.layer.{i}.layernorm_before.weight")) rename_keys.append((f"blocks.{i}.norm1.bias", f"vit.encoder.layer.{i}.layernorm_before.bias")) rename_keys.append((f"blocks.{i}.attn.proj.weight", f"vit.encoder.layer.{i}.attention.output.dense.weight")) rename_keys.append((f"blocks.{i}.attn.proj.bias", f"vit.encoder.layer.{i}.attention.output.dense.bias")) rename_keys.append((f"blocks.{i}.norm2.weight", f"vit.encoder.layer.{i}.layernorm_after.weight")) rename_keys.append((f"blocks.{i}.norm2.bias", f"vit.encoder.layer.{i}.layernorm_after.bias")) rename_keys.append((f"blocks.{i}.mlp.fc1.weight", f"vit.encoder.layer.{i}.intermediate.dense.weight")) rename_keys.append((f"blocks.{i}.mlp.fc1.bias", f"vit.encoder.layer.{i}.intermediate.dense.bias")) rename_keys.append((f"blocks.{i}.mlp.fc2.weight", f"vit.encoder.layer.{i}.output.dense.weight")) rename_keys.append((f"blocks.{i}.mlp.fc2.bias", f"vit.encoder.layer.{i}.output.dense.bias")) # projection layer + position embeddings rename_keys.extend( [ ("cls_token", "vit.embeddings.cls_token"), ("patch_embed.proj.weight", "vit.embeddings.patch_embeddings.projection.weight"), ("patch_embed.proj.bias", "vit.embeddings.patch_embeddings.projection.bias"), ("pos_embed", "vit.embeddings.position_embeddings"), ] ) if base_model: # layernorm + pooler rename_keys.extend( [ ("norm.weight", "layernorm.weight"), ("norm.bias", "layernorm.bias"), ("pre_logits.fc.weight", "pooler.dense.weight"), ("pre_logits.fc.bias", "pooler.dense.bias"), ] ) # if just the base model, we should remove "vit" from all keys that start with "vit" rename_keys = [(pair[0], pair[1][4:]) if pair[1].startswith("vit") else pair for pair in rename_keys] else: # layernorm + classification head rename_keys.extend( [ ("norm.weight", "vit.layernorm.weight"), ("norm.bias", "vit.layernorm.bias"), ("head.weight", "classifier.weight"), ("head.bias", "classifier.bias"), ] ) return rename_keys def read_in_q_k_v(state_dict, config, base_model=False): for i in range(config.num_hidden_layers): if base_model: prefix = "" else: prefix = "vit." # read in weights + bias of input projection layer (in timm, this is a single matrix + bias) in_proj_weight = state_dict.pop(f"blocks.{i}.attn.qkv.weight") in_proj_bias = state_dict.pop(f"blocks.{i}.attn.qkv.bias") # next, add query, keys and values (in that order) to the state dict state_dict[f"{prefix}encoder.layer.{i}.attention.attention.query.weight"] = in_proj_weight[ : config.hidden_size, : ] state_dict[f"{prefix}encoder.layer.{i}.attention.attention.query.bias"] = in_proj_bias[: config.hidden_size] state_dict[f"{prefix}encoder.layer.{i}.attention.attention.key.weight"] = in_proj_weight[ config.hidden_size : config.hidden_size * 2, : ] state_dict[f"{prefix}encoder.layer.{i}.attention.attention.key.bias"] = in_proj_bias[ config.hidden_size : config.hidden_size * 2 ] state_dict[f"{prefix}encoder.layer.{i}.attention.attention.value.weight"] = in_proj_weight[ -config.hidden_size :, : ] state_dict[f"{prefix}encoder.layer.{i}.attention.attention.value.bias"] = in_proj_bias[-config.hidden_size :] def remove_classification_head_(state_dict): ignore_keys = ["head.weight", "head.bias"] for k in ignore_keys: state_dict.pop(k, None) def rename_key(dct, old, new): val = dct.pop(old) dct[new] = val def prepare_img(): url = "http://images.cocodataset.org/val2017/000000039769.jpg" im = Image.open(requests.get(url, stream=True).raw) return im The provided code snippet includes necessary dependencies for implementing the `convert_vit_checkpoint` function. Write a Python function `def convert_vit_checkpoint(vit_name, pytorch_dump_folder_path)` to solve the following problem: Copy/paste/tweak model's weights to our ViT structure. Here is the function: def convert_vit_checkpoint(vit_name, pytorch_dump_folder_path): """ Copy/paste/tweak model's weights to our ViT structure. """ # define default ViT configuration config = ViTConfig() base_model = False # dataset (ImageNet-21k only or also fine-tuned on ImageNet 2012), patch_size and image_size if vit_name[-5:] == "in21k": base_model = True config.patch_size = int(vit_name[-12:-10]) config.image_size = int(vit_name[-9:-6]) else: config.num_labels = 1000 repo_id = "huggingface/label-files" filename = "imagenet-1k-id2label.json" id2label = json.load(open(hf_hub_download(repo_id, filename, repo_type="dataset"), "r")) id2label = {int(k): v for k, v in id2label.items()} config.id2label = id2label config.label2id = {v: k for k, v in id2label.items()} config.patch_size = int(vit_name[-6:-4]) config.image_size = int(vit_name[-3:]) # size of the architecture if "deit" in vit_name: if vit_name[9:].startswith("tiny"): config.hidden_size = 192 config.intermediate_size = 768 config.num_hidden_layers = 12 config.num_attention_heads = 3 elif vit_name[9:].startswith("small"): config.hidden_size = 384 config.intermediate_size = 1536 config.num_hidden_layers = 12 config.num_attention_heads = 6 else: pass else: if vit_name[4:].startswith("small"): config.hidden_size = 768 config.intermediate_size = 2304 config.num_hidden_layers = 8 config.num_attention_heads = 8 elif vit_name[4:].startswith("base"): pass elif vit_name[4:].startswith("large"): config.hidden_size = 1024 config.intermediate_size = 4096 config.num_hidden_layers = 24 config.num_attention_heads = 16 elif vit_name[4:].startswith("huge"): config.hidden_size = 1280 config.intermediate_size = 5120 config.num_hidden_layers = 32 config.num_attention_heads = 16 # load original model from timm timm_model = timm.create_model(vit_name, pretrained=True) timm_model.eval() # load state_dict of original model, remove and rename some keys state_dict = timm_model.state_dict() if base_model: remove_classification_head_(state_dict) rename_keys = create_rename_keys(config, base_model) for src, dest in rename_keys: rename_key(state_dict, src, dest) read_in_q_k_v(state_dict, config, base_model) # load HuggingFace model if vit_name[-5:] == "in21k": model = ViTModel(config).eval() else: model = ViTForImageClassification(config).eval() model.load_state_dict(state_dict) # Check outputs on an image, prepared by ViTFeatureExtractor/DeiTFeatureExtractor if "deit" in vit_name: feature_extractor = DeiTFeatureExtractor(size=config.image_size) else: feature_extractor = ViTFeatureExtractor(size=config.image_size) encoding = feature_extractor(images=prepare_img(), return_tensors="pt") pixel_values = encoding["pixel_values"] outputs = model(pixel_values) if base_model: timm_pooled_output = timm_model.forward_features(pixel_values) assert timm_pooled_output.shape == outputs.pooler_output.shape assert torch.allclose(timm_pooled_output, outputs.pooler_output, atol=1e-3) else: timm_logits = timm_model(pixel_values) assert timm_logits.shape == outputs.logits.shape assert torch.allclose(timm_logits, outputs.logits, atol=1e-3) Path(pytorch_dump_folder_path).mkdir(exist_ok=True) print(f"Saving model {vit_name} to {pytorch_dump_folder_path}") model.save_pretrained(pytorch_dump_folder_path) print(f"Saving feature extractor to {pytorch_dump_folder_path}") feature_extractor.save_pretrained(pytorch_dump_folder_path)
Copy/paste/tweak model's weights to our ViT structure.
10,889
import argparse import json from pathlib import Path import torch from PIL import Image import requests from huggingface_hub import hf_hub_download from transformers import ViTConfig, ViTFeatureExtractor, ViTForImageClassification, ViTModel from transformers.utils import logging def create_rename_keys(config, base_model=False): rename_keys = [] for i in range(config.num_hidden_layers): # encoder layers: output projection, 2 feedforward neural networks and 2 layernorms rename_keys.append((f"blocks.{i}.norm1.weight", f"vit.encoder.layer.{i}.layernorm_before.weight")) rename_keys.append((f"blocks.{i}.norm1.bias", f"vit.encoder.layer.{i}.layernorm_before.bias")) rename_keys.append((f"blocks.{i}.attn.proj.weight", f"vit.encoder.layer.{i}.attention.output.dense.weight")) rename_keys.append((f"blocks.{i}.attn.proj.bias", f"vit.encoder.layer.{i}.attention.output.dense.bias")) rename_keys.append((f"blocks.{i}.norm2.weight", f"vit.encoder.layer.{i}.layernorm_after.weight")) rename_keys.append((f"blocks.{i}.norm2.bias", f"vit.encoder.layer.{i}.layernorm_after.bias")) rename_keys.append((f"blocks.{i}.mlp.fc1.weight", f"vit.encoder.layer.{i}.intermediate.dense.weight")) rename_keys.append((f"blocks.{i}.mlp.fc1.bias", f"vit.encoder.layer.{i}.intermediate.dense.bias")) rename_keys.append((f"blocks.{i}.mlp.fc2.weight", f"vit.encoder.layer.{i}.output.dense.weight")) rename_keys.append((f"blocks.{i}.mlp.fc2.bias", f"vit.encoder.layer.{i}.output.dense.bias")) # projection layer + position embeddings rename_keys.extend( [ ("cls_token", "vit.embeddings.cls_token"), ("patch_embed.proj.weight", "vit.embeddings.patch_embeddings.projection.weight"), ("patch_embed.proj.bias", "vit.embeddings.patch_embeddings.projection.bias"), ("pos_embed", "vit.embeddings.position_embeddings"), ] ) if base_model: # layernorm + pooler rename_keys.extend( [ ("norm.weight", "layernorm.weight"), ("norm.bias", "layernorm.bias"), ] ) # if just the base model, we should remove "vit" from all keys that start with "vit" rename_keys = [(pair[0], pair[1][4:]) if pair[1].startswith("vit") else pair for pair in rename_keys] else: # layernorm + classification head rename_keys.extend( [ ("norm.weight", "vit.layernorm.weight"), ("norm.bias", "vit.layernorm.bias"), ("head.weight", "classifier.weight"), ("head.bias", "classifier.bias"), ] ) return rename_keys def read_in_q_k_v(state_dict, config, base_model=False): for i in range(config.num_hidden_layers): if base_model: prefix = "" else: prefix = "vit." # read in weights + bias of input projection layer (in timm, this is a single matrix + bias) in_proj_weight = state_dict.pop(f"blocks.{i}.attn.qkv.weight") in_proj_bias = state_dict.pop(f"blocks.{i}.attn.qkv.bias") # next, add query, keys and values (in that order) to the state dict state_dict[f"{prefix}encoder.layer.{i}.attention.attention.query.weight"] = in_proj_weight[ : config.hidden_size, : ] state_dict[f"{prefix}encoder.layer.{i}.attention.attention.query.bias"] = in_proj_bias[: config.hidden_size] state_dict[f"{prefix}encoder.layer.{i}.attention.attention.key.weight"] = in_proj_weight[ config.hidden_size : config.hidden_size * 2, : ] state_dict[f"{prefix}encoder.layer.{i}.attention.attention.key.bias"] = in_proj_bias[ config.hidden_size : config.hidden_size * 2 ] state_dict[f"{prefix}encoder.layer.{i}.attention.attention.value.weight"] = in_proj_weight[ -config.hidden_size :, : ] state_dict[f"{prefix}encoder.layer.{i}.attention.attention.value.bias"] = in_proj_bias[-config.hidden_size :] def remove_classification_head_(state_dict): ignore_keys = ["head.weight", "head.bias"] for k in ignore_keys: state_dict.pop(k, None) def rename_key(dct, old, new): val = dct.pop(old) dct[new] = val def prepare_img(): url = "http://images.cocodataset.org/val2017/000000039769.jpg" im = Image.open(requests.get(url, stream=True).raw) return im The provided code snippet includes necessary dependencies for implementing the `convert_vit_checkpoint` function. Write a Python function `def convert_vit_checkpoint(model_name, pytorch_dump_folder_path, base_model=True)` to solve the following problem: Copy/paste/tweak model's weights to our ViT structure. Here is the function: def convert_vit_checkpoint(model_name, pytorch_dump_folder_path, base_model=True): """ Copy/paste/tweak model's weights to our ViT structure. """ # define default ViT configuration config = ViTConfig() # patch_size if model_name[-1] == "8": config.patch_size = 8 # set labels if required if not base_model: config.num_labels = 1000 repo_id = "huggingface/label-files" filename = "imagenet-1k-id2label.json" id2label = json.load(open(hf_hub_download(repo_id, filename, repo_type="dataset"), "r")) id2label = {int(k): v for k, v in id2label.items()} config.id2label = id2label config.label2id = {v: k for k, v in id2label.items()} # size of the architecture if model_name in ["dino_vits8", "dino_vits16"]: config.hidden_size = 384 config.intermediate_size = 1536 config.num_hidden_layers = 12 config.num_attention_heads = 6 # load original model from torch hub original_model = torch.hub.load("facebookresearch/dino:main", model_name) original_model.eval() # load state_dict of original model, remove and rename some keys state_dict = original_model.state_dict() if base_model: remove_classification_head_(state_dict) rename_keys = create_rename_keys(config, base_model=base_model) for src, dest in rename_keys: rename_key(state_dict, src, dest) read_in_q_k_v(state_dict, config, base_model) # load HuggingFace model if base_model: model = ViTModel(config, add_pooling_layer=False).eval() else: model = ViTForImageClassification(config).eval() model.load_state_dict(state_dict) # Check outputs on an image, prepared by ViTFeatureExtractor feature_extractor = ViTFeatureExtractor() encoding = feature_extractor(images=prepare_img(), return_tensors="pt") pixel_values = encoding["pixel_values"] outputs = model(pixel_values) if base_model: final_hidden_state_cls_token = original_model(pixel_values) assert torch.allclose(final_hidden_state_cls_token, outputs.last_hidden_state[:, 0, :], atol=1e-1) else: logits = original_model(pixel_values) assert logits.shape == outputs.logits.shape assert torch.allclose(logits, outputs.logits, atol=1e-3) Path(pytorch_dump_folder_path).mkdir(exist_ok=True) print(f"Saving model {model_name} to {pytorch_dump_folder_path}") model.save_pretrained(pytorch_dump_folder_path) print(f"Saving feature extractor to {pytorch_dump_folder_path}") feature_extractor.save_pretrained(pytorch_dump_folder_path)
Copy/paste/tweak model's weights to our ViT structure.
10,890
import copy from typing import Any, Callable, List, Optional, Tuple import numpy as np import flax.linen as nn import jax import jax.numpy as jnp from flax.core.frozen_dict import FrozenDict, freeze, unfreeze from flax.linen import combine_masks, make_causal_mask from flax.linen import partitioning as nn_partitioning from flax.linen.attention import dot_product_attention_weights from flax.traverse_util import flatten_dict, unflatten_dict from jax.random import PRNGKey from ...modeling_flax_outputs import ( FlaxBaseModelOutput, FlaxBaseModelOutputWithPastAndCrossAttentions, FlaxCausalLMOutputWithCrossAttentions, FlaxSeq2SeqLMOutput, FlaxSeq2SeqModelOutput, ) from ...modeling_flax_utils import ( ACT2FN, FlaxPreTrainedModel, append_call_sample_docstring, append_replace_return_docstrings, overwrite_call_docstring, ) from ...utils import add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings from .configuration_longt5 import LongT5Config The provided code snippet includes necessary dependencies for implementing the `shift_tokens_right` function. Write a Python function `def shift_tokens_right(input_ids: np.array, pad_token_id: int, decoder_start_token_id: int) -> np.ndarray` to solve the following problem: Shift input ids one token to the right. Here is the function: def shift_tokens_right(input_ids: np.array, pad_token_id: int, decoder_start_token_id: int) -> np.ndarray: """ Shift input ids one token to the right. """ shifted_input_ids = np.zeros_like(input_ids) shifted_input_ids[:, 1:] = input_ids[:, :-1] shifted_input_ids[:, 0] = decoder_start_token_id shifted_input_ids = np.where(shifted_input_ids == -100, pad_token_id, shifted_input_ids) return shifted_input_ids
Shift input ids one token to the right.
10,891
import copy from typing import Any, Callable, List, Optional, Tuple import numpy as np import flax.linen as nn import jax import jax.numpy as jnp from flax.core.frozen_dict import FrozenDict, freeze, unfreeze from flax.linen import combine_masks, make_causal_mask from flax.linen import partitioning as nn_partitioning from flax.linen.attention import dot_product_attention_weights from flax.traverse_util import flatten_dict, unflatten_dict from jax.random import PRNGKey from ...modeling_flax_outputs import ( FlaxBaseModelOutput, FlaxBaseModelOutputWithPastAndCrossAttentions, FlaxCausalLMOutputWithCrossAttentions, FlaxSeq2SeqLMOutput, FlaxSeq2SeqModelOutput, ) from ...modeling_flax_utils import ( ACT2FN, FlaxPreTrainedModel, append_call_sample_docstring, append_replace_return_docstrings, overwrite_call_docstring, ) from ...utils import add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings from .configuration_longt5 import LongT5Config def _split_into_blocks(x: jnp.ndarray, block_len: int, axis: int) -> jnp.ndarray: """Split an input array into blocks of a given `block_len` along the given `axis`. If the dimension length is not a multiple of `block_len`, it will be padded first with selected `pad_value`. """ # pad tensor to multiple of block_len if x.shape[axis] % block_len != 0: x = _pad_to_multiple(x, block_len, axis, pad_value=0) num_blocks = x.shape[axis] // block_len output_shape = x.shape[:axis] + (num_blocks, block_len) + x.shape[(axis + 1) :] return x.reshape(output_shape) def _concatenate_3_blocks(x: jnp.ndarray, block_axis: int, sequence_axis: int, pad_value: int = 0) -> jnp.ndarray: """Concatenate three consecutive blocks for each input block for local attentiont. For more information, see: https://arxiv.org/pdf/2112.07916.pdf. """ num_blocks = x.shape[block_axis] pad = [(0, 0)] * x.ndim pad[block_axis] = (1, 1) # [batch_size, num_blocks, block_len] -> [batch_size, num_blocks + 2, block_len] x = jnp.pad(x, pad_width=pad, mode="constant", constant_values=pad_value) blocks_list: List[np.array] = [] for i in range(3): # We use indexing approach here: # https://numpy.org/doc/stable/user/basics.indexing.html#dealing-with-variable-numbers-of-indices-within-programs indices = [slice(0, None)] * x.ndim indices[block_axis] = slice(i, i + num_blocks) indices = tuple(indices) blocks_list.append(x[indices]) return jnp.concatenate(blocks_list, axis=sequence_axis) # [batch_size, num_blocks, 3 * block_len, ...] def _mask_local_attention_mask(local_attention_mask: np.ndarray, block_len: int) -> jnp.ndarray: """Mask local attention mask to enforce that tokens are not allowed to attend tokens farther than ``local_radius.""" relative_position_ids = _make_3block_relative_position_ids(block_len) locality_mask = jnp.abs(relative_position_ids) < block_len locality_mask = locality_mask[None, None, :, :] return jnp.logical_and(local_attention_mask, locality_mask) The provided code snippet includes necessary dependencies for implementing the `_get_local_attention_mask` function. Write a Python function `def _get_local_attention_mask(attention_mask: np.ndarray, block_len: int) -> jnp.ndarray` to solve the following problem: Prepare attention mask to be applied for a local attention. Here is the function: def _get_local_attention_mask(attention_mask: np.ndarray, block_len: int) -> jnp.ndarray: """Prepare attention mask to be applied for a local attention.""" # [batch_size, num_blocks, block_len] _blocked_attention_mask = _split_into_blocks(attention_mask, block_len, axis=1) # [batch_size, num_block, 3 * block_len] _3blocked_attention_mask = _concatenate_3_blocks(_blocked_attention_mask, block_axis=1, sequence_axis=2) _blocked_attention_mask = _blocked_attention_mask[..., None] _3blocked_attention_mask = _3blocked_attention_mask[..., None, :] # [batch_size, num_block, block_len, 3 * block_len] local_attention_mask = jnp.logical_and(_blocked_attention_mask, _3blocked_attention_mask) local_attention_mask = _mask_local_attention_mask(local_attention_mask, block_len) # [batch_size, 1, num_block, block_len, 3 * block_len] return local_attention_mask[:, None, ...]
Prepare attention mask to be applied for a local attention.
10,892
import copy from typing import Any, Callable, List, Optional, Tuple import numpy as np import flax.linen as nn import jax import jax.numpy as jnp from flax.core.frozen_dict import FrozenDict, freeze, unfreeze from flax.linen import combine_masks, make_causal_mask from flax.linen import partitioning as nn_partitioning from flax.linen.attention import dot_product_attention_weights from flax.traverse_util import flatten_dict, unflatten_dict from jax.random import PRNGKey from ...modeling_flax_outputs import ( FlaxBaseModelOutput, FlaxBaseModelOutputWithPastAndCrossAttentions, FlaxCausalLMOutputWithCrossAttentions, FlaxSeq2SeqLMOutput, FlaxSeq2SeqModelOutput, ) from ...modeling_flax_utils import ( ACT2FN, FlaxPreTrainedModel, append_call_sample_docstring, append_replace_return_docstrings, overwrite_call_docstring, ) from ...utils import add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings from .configuration_longt5 import LongT5Config def _make_global_fixed_block_ids(attention_mask: np.ndarray, global_block_size: int) -> Tuple[jnp.ndarray, np.ndarray]: """Obtain the "fixed block" global id corresponding to each input token. This implementation is a simlified version of the original Flaxformr implementation adopted from: https://github.com/google/flaxformer/blob/main/flaxformer/architectures/longt5/long_attention.py. In our scenario, as we use this strategy only for a decoder, orphan tokens, i.e. those tokens which do not make for the whole fixed block, are assigned to the preceding block. Padding tokens from the original sequence are represented by -1. """ batch_size, seq_len = attention_mask.shape[:2] def handle_orphan_tokens(block_ids: np.ndarray) -> jnp.ndarray: block_ends = (jnp.arange(seq_len) % global_block_size) == global_block_size - 1 true_block_ends = jnp.logical_and(block_ends, block_ids >= 0) full_blocks = true_block_ends.sum(-1)[..., None] block_ids = jnp.minimum(block_ids, full_blocks - 1) return block_ids fixed_block_mask = jnp.ones_like(attention_mask) / global_block_size fixed_block_mask = jnp.cumsum(fixed_block_mask, axis=1) - fixed_block_mask mask = jnp.where(attention_mask != 0.0, 1.0, -1000.0) global_block_ids = jnp.maximum( jnp.floor(mask + fixed_block_mask - 1.0), jnp.array(-1.0, dtype=attention_mask.dtype) ) # set padding tokens to -1 global_block_ids = (global_block_ids * attention_mask) + (attention_mask - 1) # [batch_size, seq_len] global_block_ids = handle_orphan_tokens(global_block_ids) num_globals = seq_len // global_block_size # [batch_size, seq_len // global_block_size] if num_globals > 0: _sequence_block_ids_max = jnp.repeat(global_block_ids.max(axis=-1)[:, None], repeats=num_globals, axis=1) else: _sequence_block_ids_max = jnp.zeros((batch_size, 0), dtype=global_block_ids.dtype) global_segment_ids = jnp.cumsum(jnp.ones((batch_size, num_globals)), axis=-1) - 1 global_segment_ids = jnp.where(global_segment_ids <= _sequence_block_ids_max, 1, 0) return global_block_ids, global_segment_ids The provided code snippet includes necessary dependencies for implementing the `_make_side_relative_position_ids` function. Write a Python function `def _make_side_relative_position_ids(attention_mask: np.ndarray, global_block_size: int) -> np.ndarray` to solve the following problem: Create the relative position tensor for local -> global attention. Here is the function: def _make_side_relative_position_ids(attention_mask: np.ndarray, global_block_size: int) -> np.ndarray: """Create the relative position tensor for local -> global attention.""" block_ids, global_segment_ids = _make_global_fixed_block_ids(attention_mask, global_block_size) global_seq_len = global_segment_ids.shape[-1] global_positions = jnp.arange(global_seq_len) side_relative_position = global_positions - block_ids[..., None] return side_relative_position
Create the relative position tensor for local -> global attention.
10,893
import copy from typing import Any, Callable, List, Optional, Tuple import numpy as np import flax.linen as nn import jax import jax.numpy as jnp from flax.core.frozen_dict import FrozenDict, freeze, unfreeze from flax.linen import combine_masks, make_causal_mask from flax.linen import partitioning as nn_partitioning from flax.linen.attention import dot_product_attention_weights from flax.traverse_util import flatten_dict, unflatten_dict from jax.random import PRNGKey from ...modeling_flax_outputs import ( FlaxBaseModelOutput, FlaxBaseModelOutputWithPastAndCrossAttentions, FlaxCausalLMOutputWithCrossAttentions, FlaxSeq2SeqLMOutput, FlaxSeq2SeqModelOutput, ) from ...modeling_flax_utils import ( ACT2FN, FlaxPreTrainedModel, append_call_sample_docstring, append_replace_return_docstrings, overwrite_call_docstring, ) from ...utils import add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings from .configuration_longt5 import LongT5Config The provided code snippet includes necessary dependencies for implementing the `_create_global_aggregates` function. Write a Python function `def _create_global_aggregates(hidden_states: np.ndarray, block_ids: np.ndarray, global_seq_len: int) -> np.ndarray` to solve the following problem: Compute individual block aggregates by summing over individual blocks. Here is the function: def _create_global_aggregates(hidden_states: np.ndarray, block_ids: np.ndarray, global_seq_len: int) -> np.ndarray: """Compute individual block aggregates by summing over individual blocks.""" # (batch..., seq_len, global_seq_len)) one_hot_block_ids = jax.nn.one_hot(block_ids, global_seq_len) return jnp.einsum("...nd,...ng->...gd", hidden_states, one_hot_block_ids)
Compute individual block aggregates by summing over individual blocks.
10,894
import argparse from t5x import checkpoints from transformers import AutoConfig, FlaxAutoModelForSeq2SeqLM def convert_t5x_checkpoint_to_flax(t5x_checkpoint_path, config_name, flax_dump_folder_path): config = AutoConfig.from_pretrained(config_name) flax_model = FlaxAutoModelForSeq2SeqLM.from_config(config=config) t5x_model = checkpoints.load_t5x_checkpoint(t5x_checkpoint_path) split_mlp_wi = "wi_0" in t5x_model["target"]["encoder"]["layers_0"]["mlp"] if config.model_type == "t5": encoder_attn_name = "SelfAttention" if config.model_type == "longt5" and config.encoder_attention_type == "local": encoder_attn_name = "LocalSelfAttention" elif config.model_type == "longt5" and config.encoder_attention_type == "transient-global": encoder_attn_name = "TransientGlobalSelfAttention" else: raise ValueError( "Given config is expected to have `model_type='t5'`, or `model_type='longt5` with `encoder_attention_type`" " attribute with a value from ['local', 'transient-global]." ) # Encoder for layer_index in range(config.num_layers): layer_name = f"layers_{str(layer_index)}" # Self-Attention t5x_attention_key = t5x_model["target"]["encoder"][layer_name]["attention"]["key"]["kernel"] t5x_attention_out = t5x_model["target"]["encoder"][layer_name]["attention"]["out"]["kernel"] t5x_attention_query = t5x_model["target"]["encoder"][layer_name]["attention"]["query"]["kernel"] t5x_attention_value = t5x_model["target"]["encoder"][layer_name]["attention"]["value"]["kernel"] # Global input layer norm if config.model_type == "longt5" and config.encoder_attention_type == "transient-global": t5x_global_layer_norm = t5x_model["target"]["encoder"][layer_name]["attention"]["T5LayerNorm_0"]["scale"] # Layer Normalization t5x_attention_layer_norm = t5x_model["target"]["encoder"][layer_name]["pre_attention_layer_norm"]["scale"] if split_mlp_wi: t5x_mlp_wi_0 = t5x_model["target"]["encoder"][layer_name]["mlp"]["wi_0"]["kernel"] t5x_mlp_wi_1 = t5x_model["target"]["encoder"][layer_name]["mlp"]["wi_1"]["kernel"] else: t5x_mlp_wi = t5x_model["target"]["encoder"][layer_name]["mlp"]["wi"]["kernel"] t5x_mlp_wo = t5x_model["target"]["encoder"][layer_name]["mlp"]["wo"]["kernel"] # Layer Normalization t5x_mlp_layer_norm = t5x_model["target"]["encoder"][layer_name]["pre_mlp_layer_norm"]["scale"] # Assigning flax_model_encoder_layer_block = flax_model.params["encoder"]["block"][str(layer_index)]["layer"] flax_model_encoder_layer_block["0"][encoder_attn_name]["k"]["kernel"] = t5x_attention_key flax_model_encoder_layer_block["0"][encoder_attn_name]["o"]["kernel"] = t5x_attention_out flax_model_encoder_layer_block["0"][encoder_attn_name]["q"]["kernel"] = t5x_attention_query flax_model_encoder_layer_block["0"][encoder_attn_name]["v"]["kernel"] = t5x_attention_value flax_model_encoder_layer_block["0"]["layer_norm"]["weight"] = t5x_attention_layer_norm # Global input layer norm if config.model_type == "longt5" and config.encoder_attention_type == "transient-global": flax_model_encoder_layer_block["0"][encoder_attn_name]["global_input_layer_norm"][ "weight" ] = t5x_global_layer_norm if split_mlp_wi: flax_model_encoder_layer_block["1"]["DenseReluDense"]["wi_0"]["kernel"] = t5x_mlp_wi_0 flax_model_encoder_layer_block["1"]["DenseReluDense"]["wi_1"]["kernel"] = t5x_mlp_wi_1 else: flax_model_encoder_layer_block["1"]["DenseReluDense"]["wi"]["kernel"] = t5x_mlp_wi flax_model_encoder_layer_block["1"]["DenseReluDense"]["wo"]["kernel"] = t5x_mlp_wo flax_model_encoder_layer_block["1"]["layer_norm"]["weight"] = t5x_mlp_layer_norm flax_model.params["encoder"]["block"][str(layer_index)]["layer"] = flax_model_encoder_layer_block # Only for layer 0: t5x_encoder_rel_embedding = t5x_model["target"]["encoder"]["relpos_bias"]["rel_embedding"].T flax_model.params["encoder"]["block"]["0"]["layer"]["0"][encoder_attn_name]["relative_attention_bias"][ "embedding" ] = t5x_encoder_rel_embedding # Side/global relative position_bias + layer norm if config.model_type == "longt5" and config.encoder_attention_type == "transient-global": t5x_encoder_global_rel_embedding = t5x_model["target"]["encoder"]["side_relpos_bias"]["rel_embedding"].T flax_model.params["encoder"]["block"]["0"]["layer"]["0"][encoder_attn_name]["global_relative_attention_bias"][ "embedding" ] = t5x_encoder_global_rel_embedding # Assigning t5x_encoder_norm = t5x_model["target"]["encoder"]["encoder_norm"]["scale"] flax_model.params["encoder"]["final_layer_norm"]["weight"] = t5x_encoder_norm # Decoder for layer_index in range(config.num_layers): layer_name = f"layers_{str(layer_index)}" # Self-Attention t5x_attention_key = t5x_model["target"]["decoder"][layer_name]["self_attention"]["key"]["kernel"] t5x_attention_out = t5x_model["target"]["decoder"][layer_name]["self_attention"]["out"]["kernel"] t5x_attention_query = t5x_model["target"]["decoder"][layer_name]["self_attention"]["query"]["kernel"] t5x_attention_value = t5x_model["target"]["decoder"][layer_name]["self_attention"]["value"]["kernel"] # Layer Normalization t5x_pre_attention_layer_norm = t5x_model["target"]["decoder"][layer_name]["pre_self_attention_layer_norm"][ "scale" ] # Encoder-Decoder-Attention t5x_enc_dec_attention_module = t5x_model["target"]["decoder"][layer_name]["encoder_decoder_attention"] t5x_enc_dec_attention_key = t5x_enc_dec_attention_module["key"]["kernel"] t5x_enc_dec_attention_out = t5x_enc_dec_attention_module["out"]["kernel"] t5x_enc_dec_attention_query = t5x_enc_dec_attention_module["query"]["kernel"] t5x_enc_dec_attention_value = t5x_enc_dec_attention_module["value"]["kernel"] # Layer Normalization t5x_cross_layer_norm = t5x_model["target"]["decoder"][layer_name]["pre_cross_attention_layer_norm"]["scale"] # MLP if split_mlp_wi: t5x_mlp_wi_0 = t5x_model["target"]["decoder"][layer_name]["mlp"]["wi_0"]["kernel"] t5x_mlp_wi_1 = t5x_model["target"]["decoder"][layer_name]["mlp"]["wi_1"]["kernel"] else: t5x_mlp_wi = t5x_model["target"]["decoder"][layer_name]["mlp"]["wi"]["kernel"] t5x_mlp_wo = t5x_model["target"]["decoder"][layer_name]["mlp"]["wo"]["kernel"] # Layer Normalization tx5_mlp_layer_norm = t5x_model["target"]["decoder"][layer_name]["pre_mlp_layer_norm"]["scale"] # Assigning flax_model_decoder_layer_block = flax_model.params["decoder"]["block"][str(layer_index)]["layer"] flax_model_decoder_layer_block["0"]["SelfAttention"]["k"]["kernel"] = t5x_attention_key flax_model_decoder_layer_block["0"]["SelfAttention"]["o"]["kernel"] = t5x_attention_out flax_model_decoder_layer_block["0"]["SelfAttention"]["q"]["kernel"] = t5x_attention_query flax_model_decoder_layer_block["0"]["SelfAttention"]["v"]["kernel"] = t5x_attention_value flax_model_decoder_layer_block["0"]["layer_norm"]["weight"] = t5x_pre_attention_layer_norm flax_model_decoder_layer_block["1"]["EncDecAttention"]["k"]["kernel"] = t5x_enc_dec_attention_key flax_model_decoder_layer_block["1"]["EncDecAttention"]["o"]["kernel"] = t5x_enc_dec_attention_out flax_model_decoder_layer_block["1"]["EncDecAttention"]["q"]["kernel"] = t5x_enc_dec_attention_query flax_model_decoder_layer_block["1"]["EncDecAttention"]["v"]["kernel"] = t5x_enc_dec_attention_value flax_model_decoder_layer_block["1"]["layer_norm"]["weight"] = t5x_cross_layer_norm if split_mlp_wi: flax_model_decoder_layer_block["2"]["DenseReluDense"]["wi_0"]["kernel"] = t5x_mlp_wi_0 flax_model_decoder_layer_block["2"]["DenseReluDense"]["wi_1"]["kernel"] = t5x_mlp_wi_1 else: flax_model_decoder_layer_block["2"]["DenseReluDense"]["wi"]["kernel"] = t5x_mlp_wi flax_model_decoder_layer_block["2"]["DenseReluDense"]["wo"]["kernel"] = t5x_mlp_wo flax_model_decoder_layer_block["2"]["layer_norm"]["weight"] = tx5_mlp_layer_norm flax_model.params["decoder"]["block"][str(layer_index)]["layer"] = flax_model_decoder_layer_block # Decoder Normalization tx5_decoder_norm = t5x_model["target"]["decoder"]["decoder_norm"]["scale"] flax_model.params["decoder"]["final_layer_norm"]["weight"] = tx5_decoder_norm # Only for layer 0: t5x_decoder_rel_embedding = t5x_model["target"]["decoder"]["relpos_bias"]["rel_embedding"].T flax_model.params["decoder"]["block"]["0"]["layer"]["0"]["SelfAttention"]["relative_attention_bias"][ "embedding" ] = t5x_decoder_rel_embedding # Token Embeddings tx5_token_embeddings = t5x_model["target"]["token_embedder"]["embedding"] flax_model.params["shared"]["embedding"] = tx5_token_embeddings # LM Head (only in v1.1 and LongT5 checkpoints) if "logits_dense" in t5x_model["target"]["decoder"]: flax_model.params["lm_head"]["kernel"] = t5x_model["target"]["decoder"]["logits_dense"]["kernel"] flax_model.save_pretrained(flax_dump_folder_path) print("T5X Model was sucessfully converted!")
null
10,895
import copy import math import warnings from typing import Any, List, Optional, Tuple, Union import torch from torch import nn from torch.nn import CrossEntropyLoss from torch.utils.checkpoint import checkpoint from ...activations import ACT2FN from ...modeling_outputs import ( BaseModelOutput, BaseModelOutputWithPastAndCrossAttentions, Seq2SeqLMOutput, Seq2SeqModelOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import ALL_LAYERNORM_LAYERS, find_pruneable_heads_and_indices, prune_linear_layer from ...utils import ( DUMMY_INPUTS, DUMMY_MASK, add_start_docstrings, add_start_docstrings_to_model_forward, is_torch_fx_proxy, logging, replace_return_docstrings, ) from .configuration_longt5 import LongT5Config def _split_into_blocks(x: torch.Tensor, block_len: int, dim: int) -> torch.Tensor: """Split an input tensor into blocks of a given `block_len` along the given `dim`. If the dimension length is not a multiple of `block_len`, it will be padded first with selected `pad_value`. """ # pad tensor to multiple of block_len if x.shape[dim] % block_len != 0: x = _pad_to_multiple(x, block_len, dim, pad_value=0) num_blocks = x.shape[dim] // block_len output_shape = x.shape[:dim] + (num_blocks, block_len) + x.shape[(dim + 1) :] # If 0 is in output_shape, we cannot apply reshape because of incompatibility with ONNX conversion if 0 in output_shape: return torch.empty(output_shape, dtype=x.dtype, device=x.device) return x.reshape(output_shape) def _concatenate_3_blocks(x: torch.Tensor, block_dim: int, sequence_dim: int, pad_value: int = 0) -> torch.Tensor: """Concatenate three consecutive blocks for each input block for local attentiont. For more information, see: https://arxiv.org/pdf/2112.07916.pdf. """ num_blocks = x.shape[block_dim] pad = [(0, 0)] * x.ndim pad[block_dim] = (1, 1) pad = sum(pad[::-1], ()) # [batch_size, num_blocks, block_len] -> [batch_size, num_blocks + 2, block_len] x = nn.functional.pad(x, pad=pad, mode="constant", value=pad_value) blocks_list: List[torch.Tensor] = [] for i in range(3): # We use indexing approach here: # https://numpy.org/doc/stable/user/basics.indexing.html#dealing-with-variable-numbers-of-indices-within-programs indices = [slice(0, None)] * x.ndim indices[block_dim] = slice(i, i + num_blocks) indices = tuple(indices) blocks_list.append(x[indices]) # [batch_size, num_blocks, 3 * block_len, ...] return torch.cat(blocks_list, dim=sequence_dim) def _mask_local_attention_mask(local_attention_mask: torch.Tensor, block_len: int) -> torch.Tensor: """Mask local attention mask to enforce that tokens are not allowed to attend tokens farther than ``local_radius.""" relative_position_ids = _make_3block_relative_position_ids(block_len) locality_mask = torch.abs(relative_position_ids) < block_len locality_mask = locality_mask[None, None, :, :] locality_mask = locality_mask.to(local_attention_mask.device) return torch.logical_and(local_attention_mask, locality_mask) The provided code snippet includes necessary dependencies for implementing the `_get_local_attention_mask` function. Write a Python function `def _get_local_attention_mask(attention_mask: torch.Tensor, block_len: int, device: torch.device) -> torch.Tensor` to solve the following problem: Prepare attention mask to be applied for a local attention. Here is the function: def _get_local_attention_mask(attention_mask: torch.Tensor, block_len: int, device: torch.device) -> torch.Tensor: """Prepare attention mask to be applied for a local attention.""" # [batch_size, num_blocks, block_len] _blocked_attention_mask = _split_into_blocks(attention_mask, block_len, dim=1) # [batch_size, num_block, 3 * block_len] _3blocked_attention_mask = _concatenate_3_blocks(_blocked_attention_mask, block_dim=1, sequence_dim=2) _blocked_attention_mask = _blocked_attention_mask.unsqueeze(-1) _3blocked_attention_mask = _3blocked_attention_mask.unsqueeze(-2) # [batch_size, num_block, block_len, 3 * block_len] local_attention_mask = torch.logical_and(_blocked_attention_mask, _3blocked_attention_mask) local_attention_mask = _mask_local_attention_mask(local_attention_mask, block_len) # [batch_size, 1, num_block, block_len, 3 * block_len] return local_attention_mask.unsqueeze(1).to(device)
Prepare attention mask to be applied for a local attention.
10,896
import copy import math import warnings from typing import Any, List, Optional, Tuple, Union import torch from torch import nn from torch.nn import CrossEntropyLoss from torch.utils.checkpoint import checkpoint from ...activations import ACT2FN from ...modeling_outputs import ( BaseModelOutput, BaseModelOutputWithPastAndCrossAttentions, Seq2SeqLMOutput, Seq2SeqModelOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import ALL_LAYERNORM_LAYERS, find_pruneable_heads_and_indices, prune_linear_layer from ...utils import ( DUMMY_INPUTS, DUMMY_MASK, add_start_docstrings, add_start_docstrings_to_model_forward, is_torch_fx_proxy, logging, replace_return_docstrings, ) from .configuration_longt5 import LongT5Config def _make_global_fixed_block_ids( attention_mask: torch.Tensor, global_block_size: int ) -> Tuple[torch.Tensor, torch.Tensor]: """Obtain the "fixed block" global id corresponding to each input token. This implementation is a simlified version of the original Flaxformr implementation adopted from: https://github.com/google/flaxformer/blob/main/flaxformer/architectures/longt5/long_attention.py. In our scenario, as we use this strategy only for a decoder, orphan tokens, i.e. those tokens which do not make for the whole fixed block, are assigned to the preceding block. Padding tokens from the original sequence are represented by -1. """ batch_size, seq_len = attention_mask.shape[:2] def handle_orphan_tokens(block_ids: torch.Tensor) -> torch.Tensor: block_ends = (torch.arange(seq_len) % global_block_size) == global_block_size - 1 block_ends = block_ends.to(block_ids.device) true_block_ends = torch.logical_and(block_ends, block_ids >= 0) full_blocks = true_block_ends.sum(-1).unsqueeze(-1).type(block_ids.dtype) - 1 block_ids = torch.where(block_ids < full_blocks, block_ids, full_blocks) return block_ids fixed_block_mask = torch.ones_like(attention_mask, device=attention_mask.device) / global_block_size fixed_block_mask = torch.cumsum(fixed_block_mask, axis=1) - fixed_block_mask mask = torch.where(attention_mask != 0.0, 1.0, -1000.0).type(attention_mask.dtype) global_block_ids = torch.floor(mask + fixed_block_mask - 1.0).type(attention_mask.dtype) _global_block_ids_lower_bound = torch.tensor(-1, dtype=global_block_ids.dtype, device=global_block_ids.device) global_block_ids = torch.where( global_block_ids > _global_block_ids_lower_bound, global_block_ids, _global_block_ids_lower_bound ) # set padding tokens to -1 global_block_ids = (global_block_ids * attention_mask) + (attention_mask - 1) # [batch_size, seq_len] global_block_ids = handle_orphan_tokens(global_block_ids) num_globals = seq_len // global_block_size # [batch_size, seq_len // global_block_size] if num_globals > 0: _sequence_block_ids_max = torch.max(global_block_ids, dim=-1).values.repeat(num_globals, 1).transpose(0, 1) else: _sequence_block_ids_max = torch.zeros( batch_size, 0, dtype=global_block_ids.dtype, device=global_block_ids.device ) global_segment_ids = torch.cumsum(torch.ones(batch_size, num_globals), dim=-1) - 1 global_segment_ids = global_segment_ids.to(attention_mask.device) global_segment_ids = torch.where(global_segment_ids <= _sequence_block_ids_max, 1, 0) return global_block_ids.type(torch.int), global_segment_ids.type(torch.int) The provided code snippet includes necessary dependencies for implementing the `_make_side_relative_position_ids` function. Write a Python function `def _make_side_relative_position_ids(attention_mask: torch.Tensor, global_block_size: int) -> torch.Tensor` to solve the following problem: Create the relative position tensor for local -> global attention. Here is the function: def _make_side_relative_position_ids(attention_mask: torch.Tensor, global_block_size: int) -> torch.Tensor: """Create the relative position tensor for local -> global attention.""" block_ids, global_segment_ids = _make_global_fixed_block_ids(attention_mask, global_block_size) global_seq_len = global_segment_ids.shape[-1] global_positions = torch.arange(global_seq_len, device=block_ids.device) side_relative_position = global_positions - block_ids[..., None] return side_relative_position.type(torch.int64)
Create the relative position tensor for local -> global attention.
10,897
import copy import math import warnings from typing import Any, List, Optional, Tuple, Union import torch from torch import nn from torch.nn import CrossEntropyLoss from torch.utils.checkpoint import checkpoint from ...activations import ACT2FN from ...modeling_outputs import ( BaseModelOutput, BaseModelOutputWithPastAndCrossAttentions, Seq2SeqLMOutput, Seq2SeqModelOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import ALL_LAYERNORM_LAYERS, find_pruneable_heads_and_indices, prune_linear_layer from ...utils import ( DUMMY_INPUTS, DUMMY_MASK, add_start_docstrings, add_start_docstrings_to_model_forward, is_torch_fx_proxy, logging, replace_return_docstrings, ) from .configuration_longt5 import LongT5Config The provided code snippet includes necessary dependencies for implementing the `_create_global_aggregates` function. Write a Python function `def _create_global_aggregates( hidden_states: torch.Tensor, block_ids: torch.Tensor, global_seq_len: int ) -> torch.Tensor` to solve the following problem: Compute individual block aggregates by summing over individual blocks. Here is the function: def _create_global_aggregates( hidden_states: torch.Tensor, block_ids: torch.Tensor, global_seq_len: int ) -> torch.Tensor: """Compute individual block aggregates by summing over individual blocks.""" # (batch..., seq_len, global_seq_len)) block_ids = block_ids.where( block_ids >= 0, torch.tensor(global_seq_len, dtype=block_ids.dtype, device=block_ids.device) ) one_hot_block_ids = nn.functional.one_hot(block_ids.type(torch.int64), global_seq_len + 1)[:, :, :-1] return torch.einsum("...nd,...ng->...gd", hidden_states, one_hot_block_ids.type(hidden_states.dtype))
Compute individual block aggregates by summing over individual blocks.
10,898
import math import random from functools import partial from typing import Callable, Optional, Tuple import numpy as np import flax.linen as nn import jax import jax.numpy as jnp from flax.core.frozen_dict import FrozenDict, freeze, unfreeze from flax.linen import combine_masks, make_causal_mask from flax.linen.attention import dot_product_attention_weights from flax.traverse_util import flatten_dict, unflatten_dict from jax import lax from jax.random import PRNGKey from ...modeling_flax_outputs import ( FlaxBaseModelOutput, FlaxBaseModelOutputWithPastAndCrossAttentions, FlaxCausalLMOutputWithCrossAttentions, FlaxSeq2SeqLMOutput, FlaxSeq2SeqModelOutput, FlaxSeq2SeqQuestionAnsweringModelOutput, FlaxSeq2SeqSequenceClassifierOutput, ) from ...modeling_flax_utils import ( ACT2FN, FlaxPreTrainedModel, append_call_sample_docstring, append_replace_return_docstrings, overwrite_call_docstring, ) from ...utils import add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings from .configuration_mbart import MBartConfig The provided code snippet includes necessary dependencies for implementing the `shift_tokens_right` function. Write a Python function `def shift_tokens_right(input_ids: jnp.ndarray, pad_token_id: int) -> jnp.ndarray` to solve the following problem: Shift input ids one token to the right, and wrap the last non pad token (the <LID> token) Note that MBart does not have a single `decoder_start_token_id` in contrast to other Bart-like models. Here is the function: def shift_tokens_right(input_ids: jnp.ndarray, pad_token_id: int) -> jnp.ndarray: """ Shift input ids one token to the right, and wrap the last non pad token (the <LID> token) Note that MBart does not have a single `decoder_start_token_id` in contrast to other Bart-like models. """ prev_output_tokens = np.array(input_ids).copy() if pad_token_id is None: raise ValueError("self.model.config.pad_token_id has to be defined.") # replace possible -100 values in labels by `pad_token_id` prev_output_tokens = np.where(prev_output_tokens == -100, pad_token_id, input_ids) index_of_eos = (np.where(prev_output_tokens != pad_token_id, 1, 0).sum(axis=-1) - 1).reshape(-1, 1) decoder_start_tokens = np.array( [prev_output_tokens[i, eos_idx] for i, eos_idx in enumerate(index_of_eos)], dtype=np.int32 ).squeeze() prev_output_tokens[:, 1:] = prev_output_tokens[:, :-1].copy() prev_output_tokens[:, 0] = decoder_start_tokens return prev_output_tokens
Shift input ids one token to the right, and wrap the last non pad token (the <LID> token) Note that MBart does not have a single `decoder_start_token_id` in contrast to other Bart-like models.
10,899
import random from typing import Optional, Tuple, Union import tensorflow as tf from ...activations_tf import get_tf_activation from ...modeling_tf_outputs import ( TFBaseModelOutput, TFBaseModelOutputWithPastAndCrossAttentions, TFSeq2SeqLMOutput, TFSeq2SeqModelOutput, ) from ...modeling_tf_utils import ( DUMMY_INPUTS, TFCausalLanguageModelingLoss, TFModelInputType, TFPreTrainedModel, keras_serializable, unpack_inputs, ) from ...tf_utils import shape_list, stable_softmax from ...utils import ( ContextManagers, add_code_sample_docstrings, add_end_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_mbart import MBartConfig def shape_list(tensor: Union[tf.Tensor, np.ndarray]) -> List[int]: """ Deal with dynamic shape in tensorflow cleanly. Args: tensor (`tf.Tensor` or `np.ndarray`): The tensor we want the shape of. Returns: `List[int]`: The shape of the tensor as a list. """ if isinstance(tensor, np.ndarray): return list(tensor.shape) dynamic = tf.shape(tensor) if tensor.shape == tf.TensorShape(None): return dynamic static = tensor.shape.as_list() return [dynamic[i] if s is None else s for i, s in enumerate(static)] The provided code snippet includes necessary dependencies for implementing the `shift_tokens_right` function. Write a Python function `def shift_tokens_right(input_ids: tf.Tensor, pad_token_id: int)` to solve the following problem: Shift input ids one token to the right, and wrap the last non pad token (the <LID> token) Note that MBart does not have a single `decoder_start_token_id` in contrast to other Bart-like models. Here is the function: def shift_tokens_right(input_ids: tf.Tensor, pad_token_id: int): """ Shift input ids one token to the right, and wrap the last non pad token (the <LID> token) Note that MBart does not have a single `decoder_start_token_id` in contrast to other Bart-like models. """ if pad_token_id is None: raise ValueError("self.model.config.pad_token_id has to be defined.") # replace possible -100 values in labels by `pad_token_id` input_ids = tf.where( input_ids == -100, tf.fill(shape_list(input_ids), tf.cast(pad_token_id, input_ids.dtype)), input_ids ) language_id_index = ( tf.reduce_sum(tf.cast(tf.math.not_equal(input_ids, pad_token_id), dtype=input_ids.dtype), axis=-1) - 1 ) language_id_index = tf.stack( [tf.range(shape_list(input_ids)[0], dtype=input_ids.dtype), language_id_index], axis=-1 ) languages_ids = tf.gather_nd(input_ids, language_id_index) shifted_input_ids = tf.concat([tf.expand_dims(languages_ids, axis=-1), input_ids[:, :-1]], axis=-1) return shifted_input_ids
Shift input ids one token to the right, and wrap the last non pad token (the <LID> token) Note that MBart does not have a single `decoder_start_token_id` in contrast to other Bart-like models.
10,900
import random from typing import Optional, Tuple, Union import tensorflow as tf from ...activations_tf import get_tf_activation from ...modeling_tf_outputs import ( TFBaseModelOutput, TFBaseModelOutputWithPastAndCrossAttentions, TFSeq2SeqLMOutput, TFSeq2SeqModelOutput, ) from ...modeling_tf_utils import ( DUMMY_INPUTS, TFCausalLanguageModelingLoss, TFModelInputType, TFPreTrainedModel, keras_serializable, unpack_inputs, ) from ...tf_utils import shape_list, stable_softmax from ...utils import ( ContextManagers, add_code_sample_docstrings, add_end_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_mbart import MBartConfig LARGE_NEGATIVE = -1e8 def shape_list(tensor: Union[tf.Tensor, np.ndarray]) -> List[int]: """ Deal with dynamic shape in tensorflow cleanly. Args: tensor (`tf.Tensor` or `np.ndarray`): The tensor we want the shape of. Returns: `List[int]`: The shape of the tensor as a list. """ if isinstance(tensor, np.ndarray): return list(tensor.shape) dynamic = tf.shape(tensor) if tensor.shape == tf.TensorShape(None): return dynamic static = tensor.shape.as_list() return [dynamic[i] if s is None else s for i, s in enumerate(static)] The provided code snippet includes necessary dependencies for implementing the `_make_causal_mask` function. Write a Python function `def _make_causal_mask(input_ids_shape: tf.TensorShape, past_key_values_length: int = 0)` to solve the following problem: Make causal mask used for bi-directional self-attention. Here is the function: def _make_causal_mask(input_ids_shape: tf.TensorShape, past_key_values_length: int = 0): """ Make causal mask used for bi-directional self-attention. """ bsz = input_ids_shape[0] tgt_len = input_ids_shape[1] mask = tf.ones((tgt_len, tgt_len)) * LARGE_NEGATIVE mask_cond = tf.range(shape_list(mask)[-1]) mask = tf.where(mask_cond < tf.reshape(mask_cond + 1, (shape_list(mask)[-1], 1)), 0.0, mask) if past_key_values_length > 0: mask = tf.concat([tf.zeros((tgt_len, past_key_values_length)), mask], axis=-1) return tf.tile(mask[None, None, :, :], (bsz, 1, 1, 1))
Make causal mask used for bi-directional self-attention.
10,901
import random from typing import Optional, Tuple, Union import tensorflow as tf from ...activations_tf import get_tf_activation from ...modeling_tf_outputs import ( TFBaseModelOutput, TFBaseModelOutputWithPastAndCrossAttentions, TFSeq2SeqLMOutput, TFSeq2SeqModelOutput, ) from ...modeling_tf_utils import ( DUMMY_INPUTS, TFCausalLanguageModelingLoss, TFModelInputType, TFPreTrainedModel, keras_serializable, unpack_inputs, ) from ...tf_utils import shape_list, stable_softmax from ...utils import ( ContextManagers, add_code_sample_docstrings, add_end_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_mbart import MBartConfig LARGE_NEGATIVE = -1e8 def shape_list(tensor: Union[tf.Tensor, np.ndarray]) -> List[int]: """ Deal with dynamic shape in tensorflow cleanly. Args: tensor (`tf.Tensor` or `np.ndarray`): The tensor we want the shape of. Returns: `List[int]`: The shape of the tensor as a list. """ if isinstance(tensor, np.ndarray): return list(tensor.shape) dynamic = tf.shape(tensor) if tensor.shape == tf.TensorShape(None): return dynamic static = tensor.shape.as_list() return [dynamic[i] if s is None else s for i, s in enumerate(static)] The provided code snippet includes necessary dependencies for implementing the `_expand_mask` function. Write a Python function `def _expand_mask(mask: tf.Tensor, tgt_len: Optional[int] = None)` to solve the following problem: Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`. Here is the function: def _expand_mask(mask: tf.Tensor, tgt_len: Optional[int] = None): """ Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`. """ src_len = shape_list(mask)[1] tgt_len = tgt_len if tgt_len is not None else src_len one_cst = tf.constant(1.0) mask = tf.cast(mask, dtype=one_cst.dtype) expanded_mask = tf.tile(mask[:, None, None, :], (1, 1, tgt_len, 1)) return (one_cst - expanded_mask) * LARGE_NEGATIVE
Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`.
10,902
import copy import math import random from typing import List, Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...activations import ACT2FN from ...modeling_outputs import ( BaseModelOutput, BaseModelOutputWithPastAndCrossAttentions, CausalLMOutputWithCrossAttentions, Seq2SeqLMOutput, Seq2SeqModelOutput, Seq2SeqQuestionAnsweringModelOutput, Seq2SeqSequenceClassifierOutput, ) from ...modeling_utils import PreTrainedModel from ...utils import ( add_code_sample_docstrings, add_end_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_mbart import MBartConfig The provided code snippet includes necessary dependencies for implementing the `shift_tokens_right` function. Write a Python function `def shift_tokens_right(input_ids: torch.Tensor, pad_token_id: int)` to solve the following problem: Shift input ids one token to the right, and wrap the last non pad token (the <LID> token) Note that MBart does not have a single `decoder_start_token_id` in contrast to other Bart-like models. Here is the function: def shift_tokens_right(input_ids: torch.Tensor, pad_token_id: int): """ Shift input ids one token to the right, and wrap the last non pad token (the <LID> token) Note that MBart does not have a single `decoder_start_token_id` in contrast to other Bart-like models. """ prev_output_tokens = input_ids.clone() if pad_token_id is None: raise ValueError("self.model.config.pad_token_id has to be defined.") # replace possible -100 values in labels by `pad_token_id` prev_output_tokens.masked_fill_(prev_output_tokens == -100, pad_token_id) index_of_eos = (prev_output_tokens.ne(pad_token_id).sum(dim=1) - 1).unsqueeze(-1) decoder_start_tokens = prev_output_tokens.gather(1, index_of_eos).squeeze() prev_output_tokens[:, 1:] = prev_output_tokens[:, :-1].clone() prev_output_tokens[:, 0] = decoder_start_tokens return prev_output_tokens
Shift input ids one token to the right, and wrap the last non pad token (the <LID> token) Note that MBart does not have a single `decoder_start_token_id` in contrast to other Bart-like models.
10,903
import copy import math import random from typing import List, Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...activations import ACT2FN from ...modeling_outputs import ( BaseModelOutput, BaseModelOutputWithPastAndCrossAttentions, CausalLMOutputWithCrossAttentions, Seq2SeqLMOutput, Seq2SeqModelOutput, Seq2SeqQuestionAnsweringModelOutput, Seq2SeqSequenceClassifierOutput, ) from ...modeling_utils import PreTrainedModel from ...utils import ( add_code_sample_docstrings, add_end_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_mbart import MBartConfig The provided code snippet includes necessary dependencies for implementing the `_make_causal_mask` function. Write a Python function `def _make_causal_mask(input_ids_shape: torch.Size, dtype: torch.dtype, past_key_values_length: int = 0)` to solve the following problem: Make causal mask used for bi-directional self-attention. Here is the function: def _make_causal_mask(input_ids_shape: torch.Size, dtype: torch.dtype, past_key_values_length: int = 0): """ Make causal mask used for bi-directional self-attention. """ bsz, tgt_len = input_ids_shape mask = torch.full((tgt_len, tgt_len), torch.tensor(torch.finfo(dtype).min)) mask_cond = torch.arange(mask.size(-1)) mask.masked_fill_(mask_cond < (mask_cond + 1).view(mask.size(-1), 1), 0) mask = mask.to(dtype) if past_key_values_length > 0: mask = torch.cat([torch.zeros(tgt_len, past_key_values_length, dtype=dtype), mask], dim=-1) return mask[None, None, :, :].expand(bsz, 1, tgt_len, tgt_len + past_key_values_length)
Make causal mask used for bi-directional self-attention.
10,904
import copy import math import random from typing import List, Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...activations import ACT2FN from ...modeling_outputs import ( BaseModelOutput, BaseModelOutputWithPastAndCrossAttentions, CausalLMOutputWithCrossAttentions, Seq2SeqLMOutput, Seq2SeqModelOutput, Seq2SeqQuestionAnsweringModelOutput, Seq2SeqSequenceClassifierOutput, ) from ...modeling_utils import PreTrainedModel from ...utils import ( add_code_sample_docstrings, add_end_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_mbart import MBartConfig The provided code snippet includes necessary dependencies for implementing the `_expand_mask` function. Write a Python function `def _expand_mask(mask: torch.Tensor, dtype: torch.dtype, tgt_len: Optional[int] = None)` to solve the following problem: Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`. Here is the function: def _expand_mask(mask: torch.Tensor, dtype: torch.dtype, tgt_len: Optional[int] = None): """ Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`. """ bsz, src_len = mask.size() tgt_len = tgt_len if tgt_len is not None else src_len expanded_mask = mask[:, None, None, :].expand(bsz, 1, tgt_len, src_len).to(dtype) inverted_mask = 1.0 - expanded_mask return inverted_mask.masked_fill(inverted_mask.to(torch.bool), torch.finfo(dtype).min)
Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`.
10,905
import argparse import torch from torch import nn from transformers import MBartConfig, MBartForConditionalGeneration def remove_ignore_keys_(state_dict): ignore_keys = [ "encoder.version", "decoder.version", "model.encoder.version", "model.decoder.version", "_float_tensor", "decoder.output_projection.weight", ] for k in ignore_keys: state_dict.pop(k, None) def make_linear_from_emb(emb): vocab_size, emb_size = emb.weight.shape lin_layer = nn.Linear(vocab_size, emb_size, bias=False) lin_layer.weight.data = emb.weight.data return lin_layer def convert_fairseq_mbart_checkpoint_from_disk( checkpoint_path, hf_config_path="facebook/mbart-large-en-ro", finetuned=False, mbart_50=False ): state_dict = torch.load(checkpoint_path, map_location="cpu")["model"] remove_ignore_keys_(state_dict) vocab_size = state_dict["encoder.embed_tokens.weight"].shape[0] mbart_config = MBartConfig.from_pretrained(hf_config_path, vocab_size=vocab_size) if mbart_50 and finetuned: mbart_config.activation_function = "relu" state_dict["shared.weight"] = state_dict["decoder.embed_tokens.weight"] model = MBartForConditionalGeneration(mbart_config) model.model.load_state_dict(state_dict) if finetuned: model.lm_head = make_linear_from_emb(model.model.shared) return model
null
10,906
import warnings from dataclasses import dataclass from typing import List, Optional, Tuple, Union import torch from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...activations import ACT2FN from ...modeling_utils import PoolerAnswerClass, PoolerEndLogits, PoolerStartLogits, PreTrainedModel, SequenceSummary from ...pytorch_utils import apply_chunking_to_forward from ...utils import ( ModelOutput, add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_xlnet import XLNetConfig logger = logging.get_logger(__name__) def build_tf_xlnet_to_pytorch_map(model, config, tf_weights=None): """ A map of modules from TF to PyTorch. I use a map to keep the PyTorch model as identical to the original PyTorch model as possible. """ tf_to_pt_map = {} if hasattr(model, "transformer"): if hasattr(model, "lm_loss"): # We will load also the output bias tf_to_pt_map["model/lm_loss/bias"] = model.lm_loss.bias if hasattr(model, "sequence_summary") and "model/sequnece_summary/summary/kernel" in tf_weights: # We will load also the sequence summary tf_to_pt_map["model/sequnece_summary/summary/kernel"] = model.sequence_summary.summary.weight tf_to_pt_map["model/sequnece_summary/summary/bias"] = model.sequence_summary.summary.bias if ( hasattr(model, "logits_proj") and config.finetuning_task is not None and f"model/regression_{config.finetuning_task}/logit/kernel" in tf_weights ): tf_to_pt_map[f"model/regression_{config.finetuning_task}/logit/kernel"] = model.logits_proj.weight tf_to_pt_map[f"model/regression_{config.finetuning_task}/logit/bias"] = model.logits_proj.bias # Now load the rest of the transformer model = model.transformer # Embeddings and output tf_to_pt_map.update( { "model/transformer/word_embedding/lookup_table": model.word_embedding.weight, "model/transformer/mask_emb/mask_emb": model.mask_emb, } ) # Transformer blocks for i, b in enumerate(model.layer): layer_str = f"model/transformer/layer_{i}/" tf_to_pt_map.update( { layer_str + "rel_attn/LayerNorm/gamma": b.rel_attn.layer_norm.weight, layer_str + "rel_attn/LayerNorm/beta": b.rel_attn.layer_norm.bias, layer_str + "rel_attn/o/kernel": b.rel_attn.o, layer_str + "rel_attn/q/kernel": b.rel_attn.q, layer_str + "rel_attn/k/kernel": b.rel_attn.k, layer_str + "rel_attn/r/kernel": b.rel_attn.r, layer_str + "rel_attn/v/kernel": b.rel_attn.v, layer_str + "ff/LayerNorm/gamma": b.ff.layer_norm.weight, layer_str + "ff/LayerNorm/beta": b.ff.layer_norm.bias, layer_str + "ff/layer_1/kernel": b.ff.layer_1.weight, layer_str + "ff/layer_1/bias": b.ff.layer_1.bias, layer_str + "ff/layer_2/kernel": b.ff.layer_2.weight, layer_str + "ff/layer_2/bias": b.ff.layer_2.bias, } ) # Relative positioning biases if config.untie_r: r_r_list = [] r_w_list = [] r_s_list = [] seg_embed_list = [] for b in model.layer: r_r_list.append(b.rel_attn.r_r_bias) r_w_list.append(b.rel_attn.r_w_bias) r_s_list.append(b.rel_attn.r_s_bias) seg_embed_list.append(b.rel_attn.seg_embed) else: r_r_list = [model.r_r_bias] r_w_list = [model.r_w_bias] r_s_list = [model.r_s_bias] seg_embed_list = [model.seg_embed] tf_to_pt_map.update( { "model/transformer/r_r_bias": r_r_list, "model/transformer/r_w_bias": r_w_list, "model/transformer/r_s_bias": r_s_list, "model/transformer/seg_embed": seg_embed_list, } ) return tf_to_pt_map The provided code snippet includes necessary dependencies for implementing the `load_tf_weights_in_xlnet` function. Write a Python function `def load_tf_weights_in_xlnet(model, config, tf_path)` to solve the following problem: Load tf checkpoints in a pytorch model Here is the function: def load_tf_weights_in_xlnet(model, config, tf_path): """Load tf checkpoints in a pytorch model""" try: import numpy as np import tensorflow as tf except ImportError: logger.error( "Loading a TensorFlow models in PyTorch, requires TensorFlow to be installed. Please see " "https://www.tensorflow.org/install/ for installation instructions." ) raise # Load weights from TF model init_vars = tf.train.list_variables(tf_path) tf_weights = {} for name, shape in init_vars: logger.info(f"Loading TF weight {name} with shape {shape}") array = tf.train.load_variable(tf_path, name) tf_weights[name] = array # Build TF to PyTorch weights loading map tf_to_pt_map = build_tf_xlnet_to_pytorch_map(model, config, tf_weights) for name, pointer in tf_to_pt_map.items(): logger.info(f"Importing {name}") if name not in tf_weights: logger.info(f"{name} not in tf pre-trained weights, skipping") continue array = tf_weights[name] # adam_v and adam_m are variables used in AdamWeightDecayOptimizer to calculated m and v # which are not required for using pretrained model if "kernel" in name and ("ff" in name or "summary" in name or "logit" in name): logger.info("Transposing") array = np.transpose(array) if isinstance(pointer, list): # Here we will split the TF weights assert ( len(pointer) == array.shape[0] ), f"Pointer length {len(pointer)} and array length {array.shape[0]} mismatched" for i, p_i in enumerate(pointer): arr_i = array[i, ...] try: assert ( p_i.shape == arr_i.shape ), f"Pointer shape {p_i.shape} and array shape {arr_i.shape} mismatched" except AssertionError as e: e.args += (p_i.shape, arr_i.shape) raise logger.info(f"Initialize PyTorch weight {name} for layer {i}") p_i.data = torch.from_numpy(arr_i) else: try: assert ( pointer.shape == array.shape ), f"Pointer shape {pointer.shape} and array shape {array.shape} mismatched" except AssertionError as e: e.args += (pointer.shape, array.shape) raise logger.info(f"Initialize PyTorch weight {name}") pointer.data = torch.from_numpy(array) tf_weights.pop(name, None) tf_weights.pop(name + "/Adam", None) tf_weights.pop(name + "/Adam_1", None) logger.info(f"Weights not copied to PyTorch model: {', '.join(tf_weights.keys())}") return model
Load tf checkpoints in a pytorch model
10,907
import argparse import os import torch from transformers import ( XLNetConfig, XLNetForQuestionAnswering, XLNetForSequenceClassification, XLNetLMHeadModel, load_tf_weights_in_xlnet, ) from transformers.utils import CONFIG_NAME, WEIGHTS_NAME, logging GLUE_TASKS_NUM_LABELS = { "cola": 2, "mnli": 3, "mrpc": 2, "sst-2": 2, "sts-b": 1, "qqp": 2, "qnli": 2, "rte": 2, "wnli": 2, } def convert_xlnet_checkpoint_to_pytorch( tf_checkpoint_path, bert_config_file, pytorch_dump_folder_path, finetuning_task=None ): # Initialise PyTorch model config = XLNetConfig.from_json_file(bert_config_file) finetuning_task = finetuning_task.lower() if finetuning_task is not None else "" if finetuning_task in GLUE_TASKS_NUM_LABELS: print(f"Building PyTorch XLNetForSequenceClassification model from configuration: {config}") config.finetuning_task = finetuning_task config.num_labels = GLUE_TASKS_NUM_LABELS[finetuning_task] model = XLNetForSequenceClassification(config) elif "squad" in finetuning_task: config.finetuning_task = finetuning_task model = XLNetForQuestionAnswering(config) else: model = XLNetLMHeadModel(config) # Load weights from tf checkpoint load_tf_weights_in_xlnet(model, config, tf_checkpoint_path) # Save pytorch-model pytorch_weights_dump_path = os.path.join(pytorch_dump_folder_path, WEIGHTS_NAME) pytorch_config_dump_path = os.path.join(pytorch_dump_folder_path, CONFIG_NAME) print(f"Save PyTorch model to {os.path.abspath(pytorch_weights_dump_path)}") torch.save(model.state_dict(), pytorch_weights_dump_path) print(f"Save configuration file to {os.path.abspath(pytorch_config_dump_path)}") with open(pytorch_config_dump_path, "w", encoding="utf-8") as f: f.write(config.to_json_string())
null
10,908
import argparse import torch from transformers import YosoConfig, YosoForMaskedLM def convert_checkpoint_helper(max_position_embeddings, orig_state_dict): for key in orig_state_dict.copy().keys(): val = orig_state_dict.pop(key) if ("pooler" in key) or ("sen_class" in key): continue else: orig_state_dict[rename_key(key)] = val orig_state_dict["cls.predictions.bias"] = orig_state_dict["cls.predictions.decoder.bias"] orig_state_dict["yoso.embeddings.position_ids"] = torch.arange(max_position_embeddings).expand((1, -1)) + 2 return orig_state_dict def convert_yoso_checkpoint(checkpoint_path, yoso_config_file, pytorch_dump_path): orig_state_dict = torch.load(checkpoint_path, map_location="cpu")["model_state_dict"] config = YosoConfig.from_json_file(yoso_config_file) model = YosoForMaskedLM(config) new_state_dict = convert_checkpoint_helper(config.max_position_embeddings, orig_state_dict) print(model.load_state_dict(new_state_dict)) model.eval() model.save_pretrained(pytorch_dump_path) print(f"Checkpoint successfuly converted. Model saved at {pytorch_dump_path}")
null
10,909
import math import os from typing import Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...activations import ACT2FN from ...modeling_outputs import ( BaseModelOutputWithCrossAttentions, MaskedLMOutput, MultipleChoiceModelOutput, QuestionAnsweringModelOutput, SequenceClassifierOutput, TokenClassifierOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import apply_chunking_to_forward, find_pruneable_heads_and_indices, prune_linear_layer from ...utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging from .configuration_yoso import YosoConfig def load_cuda_kernels(): global lsh_cumulation try: from torch.utils.cpp_extension import load def append_root(files): src_folder = os.path.dirname(os.path.realpath(__file__)) return [os.path.join(src_folder, file) for file in files] src_files = append_root( ["fast_lsh_cumulation_torch.cpp", "fast_lsh_cumulation.cu", "fast_lsh_cumulation_cuda.cu"] ) load("fast_lsh_cumulation", src_files, verbose=True) import fast_lsh_cumulation as lsh_cumulation return True except Exception: lsh_cumulation = None return False
null
10,910
import math import os from typing import Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...activations import ACT2FN from ...modeling_outputs import ( BaseModelOutputWithCrossAttentions, MaskedLMOutput, MultipleChoiceModelOutput, QuestionAnsweringModelOutput, SequenceClassifierOutput, TokenClassifierOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import apply_chunking_to_forward, find_pruneable_heads_and_indices, prune_linear_layer from ...utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging from .configuration_yoso import YosoConfig def to_contiguous(input_tensors): if isinstance(input_tensors, list): out = [] for tensor in input_tensors: if not tensor.is_contiguous(): tensor = tensor.contiguous() out.append(tensor) return out else: if not input_tensors.is_contiguous(): input_tensors = input_tensors.contiguous() return input_tensors
null
10,911
import math import os from typing import Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...activations import ACT2FN from ...modeling_outputs import ( BaseModelOutputWithCrossAttentions, MaskedLMOutput, MultipleChoiceModelOutput, QuestionAnsweringModelOutput, SequenceClassifierOutput, TokenClassifierOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import apply_chunking_to_forward, find_pruneable_heads_and_indices, prune_linear_layer from ...utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging from .configuration_yoso import YosoConfig def normalize(input_tensors): if type(input_tensors) is list: out = [] for tensor in input_tensors: out.append(nn.functional.normalize(tensor, p=2, dim=-1)) return out else: return nn.functional.normalize(input_tensors, p=2, dim=-1)
null
10,912
import math import os from typing import Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...activations import ACT2FN from ...modeling_outputs import ( BaseModelOutputWithCrossAttentions, MaskedLMOutput, MultipleChoiceModelOutput, QuestionAnsweringModelOutput, SequenceClassifierOutput, TokenClassifierOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import apply_chunking_to_forward, find_pruneable_heads_and_indices, prune_linear_layer from ...utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging from .configuration_yoso import YosoConfig def hashing(query, key, num_hash, hash_len): if len(query.size()) != 3: raise ValueError("Query has incorrect size.") if len(key.size()) != 3: raise ValueError("Key has incorrect size.") rmat = torch.randn(query.size(0), query.size(2), num_hash * hash_len, device=query.device) raise_pow = 2 ** torch.arange(hash_len, device=query.device) query_projection = torch.matmul(query, rmat).reshape(query.size(0), query.size(1), num_hash, hash_len) key_projection = torch.matmul(key, rmat).reshape(key.size(0), key.size(1), num_hash, hash_len) query_binary = (query_projection > 0).int() key_binary = (key_projection > 0).int() query_hash = torch.sum(query_binary * raise_pow, dim=-1) query_hash = torch.sum(key_binary * raise_pow, dim=-1) return query_hash.int(), query_hash.int()
null
10,913
from typing import List, Optional, Union import numpy as np from PIL import Image from transformers.image_utils import PILImageResampling from ...feature_extraction_utils import BatchFeature, FeatureExtractionMixin from ...image_utils import IMAGENET_STANDARD_MEAN, IMAGENET_STANDARD_STD, ImageFeatureExtractionMixin, is_torch_tensor from ...utils import TensorType, is_pytesseract_available, logging, requires_backends def normalize_box(box, width, height): return [ int(1000 * (box[0] / width)), int(1000 * (box[1] / height)), int(1000 * (box[2] / width)), int(1000 * (box[3] / height)), ] The provided code snippet includes necessary dependencies for implementing the `apply_tesseract` function. Write a Python function `def apply_tesseract(image: Image.Image, lang: Optional[str], tesseract_config: Optional[str])` to solve the following problem: Applies Tesseract OCR on a document image, and returns recognized words + normalized bounding boxes. Here is the function: def apply_tesseract(image: Image.Image, lang: Optional[str], tesseract_config: Optional[str]): """Applies Tesseract OCR on a document image, and returns recognized words + normalized bounding boxes.""" # apply OCR data = pytesseract.image_to_data(image, lang=lang, output_type="dict", config=tesseract_config) words, left, top, width, height = data["text"], data["left"], data["top"], data["width"], data["height"] # filter empty words and corresponding coordinates irrelevant_indices = [idx for idx, word in enumerate(words) if not word.strip()] words = [word for idx, word in enumerate(words) if idx not in irrelevant_indices] left = [coord for idx, coord in enumerate(left) if idx not in irrelevant_indices] top = [coord for idx, coord in enumerate(top) if idx not in irrelevant_indices] width = [coord for idx, coord in enumerate(width) if idx not in irrelevant_indices] height = [coord for idx, coord in enumerate(height) if idx not in irrelevant_indices] # turn coordinates into (left, top, left+width, top+height) format actual_boxes = [] for x, y, w, h in zip(left, top, width, height): actual_box = [x, y, x + w, y + h] actual_boxes.append(actual_box) image_width, image_height = image.size # finally, normalize the bounding boxes normalized_boxes = [] for box in actual_boxes: normalized_boxes.append(normalize_box(box, image_width, image_height)) assert len(words) == len(normalized_boxes), "Not as many words as there are bounding boxes" return words, normalized_boxes
Applies Tesseract OCR on a document image, and returns recognized words + normalized bounding boxes.
10,914
import json import os from functools import lru_cache from typing import Dict, List, Optional, Tuple, Union import regex as re from ...tokenization_utils import AddedToken, PreTrainedTokenizer from ...tokenization_utils_base import ( BatchEncoding, EncodedInput, PreTokenizedInput, TextInput, TextInputPair, TruncationStrategy, ) from ...utils import PaddingStrategy, TensorType, add_end_docstrings, logging The provided code snippet includes necessary dependencies for implementing the `bytes_to_unicode` function. Write a Python function `def bytes_to_unicode()` to solve the following problem: Returns list of utf-8 byte and a mapping to unicode strings. We specifically avoids mapping to whitespace/control characters the bpe code barfs on. The reversible bpe codes work on unicode strings. This means you need a large # of unicode characters in your vocab if you want to avoid UNKs. When you're at something like a 10B token dataset you end up needing around 5K for decent coverage. This is a significant percentage of your normal, say, 32K bpe vocab. To avoid that, we want lookup tables between utf-8 bytes and unicode strings. Here is the function: def bytes_to_unicode(): """ Returns list of utf-8 byte and a mapping to unicode strings. We specifically avoids mapping to whitespace/control characters the bpe code barfs on. The reversible bpe codes work on unicode strings. This means you need a large # of unicode characters in your vocab if you want to avoid UNKs. When you're at something like a 10B token dataset you end up needing around 5K for decent coverage. This is a significant percentage of your normal, say, 32K bpe vocab. To avoid that, we want lookup tables between utf-8 bytes and unicode strings. """ bs = ( list(range(ord("!"), ord("~") + 1)) + list(range(ord("¡"), ord("¬") + 1)) + list(range(ord("®"), ord("ÿ") + 1)) ) cs = bs[:] n = 0 for b in range(2**8): if b not in bs: bs.append(b) cs.append(2**8 + n) n += 1 cs = [chr(n) for n in cs] return dict(zip(bs, cs))
Returns list of utf-8 byte and a mapping to unicode strings. We specifically avoids mapping to whitespace/control characters the bpe code barfs on. The reversible bpe codes work on unicode strings. This means you need a large # of unicode characters in your vocab if you want to avoid UNKs. When you're at something like a 10B token dataset you end up needing around 5K for decent coverage. This is a significant percentage of your normal, say, 32K bpe vocab. To avoid that, we want lookup tables between utf-8 bytes and unicode strings.
10,915
import json import os from functools import lru_cache from typing import Dict, List, Optional, Tuple, Union import regex as re from ...tokenization_utils import AddedToken, PreTrainedTokenizer from ...tokenization_utils_base import ( BatchEncoding, EncodedInput, PreTokenizedInput, TextInput, TextInputPair, TruncationStrategy, ) from ...utils import PaddingStrategy, TensorType, add_end_docstrings, logging The provided code snippet includes necessary dependencies for implementing the `get_pairs` function. Write a Python function `def get_pairs(word)` to solve the following problem: Return set of symbol pairs in a word. Word is represented as tuple of symbols (symbols being variable-length strings). Here is the function: def get_pairs(word): """ Return set of symbol pairs in a word. Word is represented as tuple of symbols (symbols being variable-length strings). """ pairs = set() prev_char = word[0] for char in word[1:]: pairs.add((prev_char, char)) prev_char = char return pairs
Return set of symbol pairs in a word. Word is represented as tuple of symbols (symbols being variable-length strings).
10,916
import argparse import numpy as np import torch import gdown from huggingface_hub import hf_hub_download from transformers import ( CLIPTokenizer, CLIPTokenizerFast, VideoMAEFeatureExtractor, XCLIPConfig, XCLIPModel, XCLIPProcessor, XCLIPTextConfig, XCLIPVisionConfig, ) def get_xclip_config(model_name, num_frames): def convert_state_dict(orig_state_dict, config): def prepare_video(num_frames): def convert_xclip_checkpoint(model_name, pytorch_dump_folder_path=None, push_to_hub=False): model_to_url = { # fully supervised kinetics-400 checkpoints "xclip-base-patch32": "https://github.com/nbl97/X-CLIP_Model_Zoo/releases/download/v1.0/k400_32_8.pth", "xclip-base-patch32-16-frames": ( "https://github.com/nbl97/X-CLIP_Model_Zoo/releases/download/v1.0/k400_32_16.pth" ), "xclip-base-patch16": "https://github.com/nbl97/X-CLIP_Model_Zoo/releases/download/v1.0/k400_16_8.pth", "xclip-base-patch16-16-frames": ( "https://github.com/nbl97/X-CLIP_Model_Zoo/releases/download/v1.0/k400_16_16.pth" ), "xclip-large-patch14": "https://drive.google.com/u/0/uc?id=1NUOImq0o5DlQTST17iIP3vG7DgmHQuCx&amp;export=download&amp;confirm=t&amp;uuid=b26caedc-88e2-473e-830a-9d158b653cdb", "xclip-large-patch14-16-frames": "https://drive.google.com/u/0/uc?id=1FOYgnJc097OJ4lGwtRCCydQyVPJEOH7d&amp;export=download&amp;confirm=t&amp;uuid=538fa810-e671-4050-b385-9a623f89804f", # fully supervised kinetics-600 checkpoints "xclip-base-patch16-kinetics-600": ( "https://github.com/nbl97/X-CLIP_Model_Zoo/releases/download/v1.0/k600_16_8.pth" ), "xclip-base-patch16-kinetics-600-16-frames": ( "https://github.com/nbl97/X-CLIP_Model_Zoo/releases/download/v1.0/k600_16_16.pth" ), "xclip-large-patch14-kinetics-600": "https://drive.google.com/u/0/uc?id=1FV8C1INuM91sLAN4ImjzePLIlpMSihwV&amp;export=download&amp;confirm=t&amp;uuid=141d4977-4a65-44ae-864f-4b0c19f838be", # few shot "xclip-base-patch16-hmdb-2-shot": ( "https://github.com/nbl97/X-CLIP_Model_Zoo/releases/download/v1.0/few_hmdb_2.pth" ), "xclip-base-patch16-hmdb-4-shot": ( "https://github.com/nbl97/X-CLIP_Model_Zoo/releases/download/v1.0/few_hmdb_4.pth" ), "xclip-base-patch16-hmdb-8-shot": ( "https://github.com/nbl97/X-CLIP_Model_Zoo/releases/download/v1.0/few_hmdb_8.pth" ), "xclip-base-patch16-hmdb-16-shot": ( "https://github.com/nbl97/X-CLIP_Model_Zoo/releases/download/v1.0/few_hmdb_16.pth" ), "xclip-base-patch16-ucf-2-shot": ( "https://github.com/nbl97/X-CLIP_Model_Zoo/releases/download/v1.0/few_ucf_2.pth" ), "xclip-base-patch16-ucf-4-shot": ( "https://github.com/nbl97/X-CLIP_Model_Zoo/releases/download/v1.0/few_ucf_4.pth" ), "xclip-base-patch16-ucf-8-shot": ( "https://github.com/nbl97/X-CLIP_Model_Zoo/releases/download/v1.0/few_ucf_8.pth" ), "xclip-base-patch16-ucf-16-shot": ( "https://github.com/nbl97/X-CLIP_Model_Zoo/releases/download/v1.0/few_ucf_16.pth" ), # zero shot "xclip-base-patch16-zero-shot": "https://github.com/nbl97/X-CLIP_Model_Zoo/releases/download/v1.0/zero.pth", } checkpoint_url = model_to_url[model_name] num_frames = 8 if "16-frames" in model_name: num_frames = 16 elif "shot" in model_name: num_frames = 32 config = get_xclip_config(model_name, num_frames) model = XCLIPModel(config) model.eval() if "drive" in checkpoint_url: output = "pytorch_model.bin" gdown.cached_download(checkpoint_url, output, quiet=False) state_dict = torch.load(output, map_location="cpu")["model"] else: state_dict = torch.hub.load_state_dict_from_url(checkpoint_url)["model"] state_dict = convert_state_dict(state_dict, config) model = XCLIPModel(config) missing_keys, unexpected_keys = model.load_state_dict(state_dict, strict=False) assert missing_keys == ["text_model.embeddings.position_ids", "vision_model.embeddings.position_ids"] model.eval() size = 336 if model_name == "xclip-large-patch14-16-frames" else 224 feature_extractor = VideoMAEFeatureExtractor(size=size) slow_tokenizer = CLIPTokenizer.from_pretrained("openai/clip-vit-base-patch32") fast_tokenizer = CLIPTokenizerFast.from_pretrained("openai/clip-vit-base-patch32") processor = XCLIPProcessor(feature_extractor=feature_extractor, tokenizer=fast_tokenizer) video = prepare_video(num_frames) inputs = processor( text=["playing sports", "eating spaghetti", "go shopping"], videos=video, return_tensors="pt", padding=True ) print("Shape of pixel values:", inputs.pixel_values.shape) with torch.no_grad(): outputs = model(**inputs) # Verify outputs logits_per_video = outputs.logits_per_video probs = logits_per_video.softmax(dim=1) print("Probs:", probs) # kinetics-400 if model_name == "xclip-base-patch32": expected_probs = torch.tensor([[0.0019, 0.9951, 0.0030]]) elif model_name == "xclip-base-patch32-16-frames": expected_probs = torch.tensor([[7.0999e-04, 9.9883e-01, 4.5580e-04]]) elif model_name == "xclip-base-patch16": expected_probs = torch.tensor([[0.0083, 0.9681, 0.0236]]) elif model_name == "xclip-base-patch16-16-frames": expected_probs = torch.tensor([[7.6937e-04, 9.9728e-01, 1.9473e-03]]) elif model_name == "xclip-large-patch14": expected_probs = torch.tensor([[0.0062, 0.9864, 0.0075]]) elif model_name == "xclip-large-patch14-16-frames": expected_probs = torch.tensor([[3.3877e-04, 9.9937e-01, 2.8888e-04]]) # kinetics-600 elif model_name == "xclip-base-patch16-kinetics-600": expected_probs = torch.tensor([[0.0555, 0.8914, 0.0531]]) elif model_name == "xclip-base-patch16-kinetics-600-16-frames": expected_probs = torch.tensor([[3.8554e-04, 9.9929e-01, 3.2754e-04]]) elif model_name == "xclip-large-patch14-kinetics-600": expected_probs = torch.tensor([[0.0036, 0.9920, 0.0045]]) # few shot elif model_name == "xclip-base-patch16-hmdb-2-shot": expected_probs = torch.tensor([[7.1890e-06, 9.9994e-01, 5.6559e-05]]) elif model_name == "xclip-base-patch16-hmdb-4-shot": expected_probs = torch.tensor([[1.0320e-05, 9.9993e-01, 6.2435e-05]]) elif model_name == "xclip-base-patch16-hmdb-8-shot": expected_probs = torch.tensor([[4.1377e-06, 9.9990e-01, 9.8386e-05]]) elif model_name == "xclip-base-patch16-hmdb-16-shot": expected_probs = torch.tensor([[4.1347e-05, 9.9962e-01, 3.3411e-04]]) elif model_name == "xclip-base-patch16-ucf-2-shot": expected_probs = torch.tensor([[8.5857e-05, 9.9928e-01, 6.3291e-04]]) elif model_name == "xclip-base-patch16-ucf-4-shot": expected_probs = torch.tensor([[8.5857e-05, 9.9928e-01, 6.3291e-04]]) elif model_name == "xclip-base-patch16-ucf-8-shot": expected_probs = torch.tensor([[0.0027, 0.9904, 0.0070]]) elif model_name == "xclip-base-patch16-ucf-16-shot": expected_probs = torch.tensor([[9.8219e-04, 9.9593e-01, 3.0863e-03]]) # zero shot elif model_name == "xclip-base-patch16-zero-shot": expected_probs = torch.tensor([[3.5082e-04, 9.9785e-01, 1.7966e-03]]) else: raise ValueError(f"Model name {model_name} not supported") assert torch.allclose(probs, expected_probs, atol=1e-3) print("Looks ok!") if pytorch_dump_folder_path is not None: print(f"Saving model {model_name} to {pytorch_dump_folder_path}") model.save_pretrained(pytorch_dump_folder_path) if push_to_hub: print("Pushing model, processor and slow tokenizer files to the hub...") model.push_to_hub(model_name, organization="nielsr") processor.push_to_hub(model_name, organization="nielsr") slow_tokenizer.push_to_hub(model_name, organization="nielsr")
null
10,917
from copy import copy from dataclasses import dataclass from typing import Any, Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from ...activations import ACT2FN from ...modeling_outputs import BaseModelOutput, BaseModelOutputWithPooling from ...modeling_utils import PreTrainedModel from ...utils import ( ModelOutput, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_x_clip import XCLIPConfig, XCLIPTextConfig, XCLIPVisionConfig The provided code snippet includes necessary dependencies for implementing the `_expand_mask` function. Write a Python function `def _expand_mask(mask: torch.Tensor, dtype: torch.dtype, tgt_len: Optional[int] = None)` to solve the following problem: Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`. Here is the function: def _expand_mask(mask: torch.Tensor, dtype: torch.dtype, tgt_len: Optional[int] = None): """ Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`. """ bsz, src_len = mask.size() tgt_len = tgt_len if tgt_len is not None else src_len expanded_mask = mask[:, None, None, :].expand(bsz, 1, tgt_len, src_len).to(dtype) inverted_mask = 1.0 - expanded_mask return inverted_mask.masked_fill(inverted_mask.to(torch.bool), torch.finfo(dtype).min)
Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`.
10,918
from copy import copy from dataclasses import dataclass from typing import Any, Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from ...activations import ACT2FN from ...modeling_outputs import BaseModelOutput, BaseModelOutputWithPooling from ...modeling_utils import PreTrainedModel from ...utils import ( ModelOutput, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_x_clip import XCLIPConfig, XCLIPTextConfig, XCLIPVisionConfig def contrastive_loss(logits: torch.Tensor) -> torch.Tensor: def x_clip_loss(similarity: torch.Tensor) -> torch.Tensor: caption_loss = contrastive_loss(similarity) image_loss = contrastive_loss(similarity.t()) return (caption_loss + image_loss) / 2.0
null
10,919
from copy import copy from dataclasses import dataclass from typing import Any, Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from ...activations import ACT2FN from ...modeling_outputs import BaseModelOutput, BaseModelOutputWithPooling from ...modeling_utils import PreTrainedModel from ...utils import ( ModelOutput, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_x_clip import XCLIPConfig, XCLIPTextConfig, XCLIPVisionConfig The provided code snippet includes necessary dependencies for implementing the `drop_path` function. Write a Python function `def drop_path(input, drop_prob: float = 0.0, training: bool = False)` to solve the following problem: Drop paths (Stochastic Depth) per sample (when applied in main path of residual blocks). Comment by Ross Wightman: This is the same as the DropConnect impl I created for EfficientNet, etc networks, however, the original name is misleading as 'Drop Connect' is a different form of dropout in a separate paper... See discussion: https://github.com/tensorflow/tpu/issues/494#issuecomment-532968956 ... I've opted for changing the layer and argument names to 'drop path' rather than mix DropConnect as a layer name and use 'survival rate' as the argument. Here is the function: def drop_path(input, drop_prob: float = 0.0, training: bool = False): """ Drop paths (Stochastic Depth) per sample (when applied in main path of residual blocks). Comment by Ross Wightman: This is the same as the DropConnect impl I created for EfficientNet, etc networks, however, the original name is misleading as 'Drop Connect' is a different form of dropout in a separate paper... See discussion: https://github.com/tensorflow/tpu/issues/494#issuecomment-532968956 ... I've opted for changing the layer and argument names to 'drop path' rather than mix DropConnect as a layer name and use 'survival rate' as the argument. """ if drop_prob == 0.0 or not training: return input keep_prob = 1 - drop_prob shape = (input.shape[0],) + (1,) * (input.ndim - 1) # work with diff dim tensors, not just 2D ConvNets random_tensor = keep_prob + torch.rand(shape, dtype=input.dtype, device=input.device) random_tensor.floor_() # binarize output = input.div(keep_prob) * random_tensor return output
Drop paths (Stochastic Depth) per sample (when applied in main path of residual blocks). Comment by Ross Wightman: This is the same as the DropConnect impl I created for EfficientNet, etc networks, however, the original name is misleading as 'Drop Connect' is a different form of dropout in a separate paper... See discussion: https://github.com/tensorflow/tpu/issues/494#issuecomment-532968956 ... I've opted for changing the layer and argument names to 'drop path' rather than mix DropConnect as a layer name and use 'survival rate' as the argument.
10,920
import math import os from dataclasses import dataclass from typing import Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.cuda.amp import autocast from ...activations import ACT2FN from ...modeling_outputs import BaseModelOutputWithPastAndCrossAttentions from ...modeling_utils import PreTrainedModel from ...pytorch_utils import Conv1D, find_pruneable_heads_and_indices, prune_conv1d_layer from ...utils import ( ModelOutput, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_decision_transformer import DecisionTransformerConfig logger = logging.get_logger(__name__) The provided code snippet includes necessary dependencies for implementing the `load_tf_weights_in_gpt2` function. Write a Python function `def load_tf_weights_in_gpt2(model, config, gpt2_checkpoint_path)` to solve the following problem: Load tf checkpoints in a pytorch model Here is the function: def load_tf_weights_in_gpt2(model, config, gpt2_checkpoint_path): """Load tf checkpoints in a pytorch model""" try: import re import tensorflow as tf except ImportError: logger.error( "Loading a TensorFlow model in PyTorch, requires TensorFlow to be installed. Please see " "https://www.tensorflow.org/install/ for installation instructions." ) raise tf_path = os.path.abspath(gpt2_checkpoint_path) logger.info(f"Converting TensorFlow checkpoint from {tf_path}") # Load weights from TF model init_vars = tf.train.list_variables(tf_path) names = [] arrays = [] for name, shape in init_vars: logger.info(f"Loading TF weight {name} with shape {shape}") array = tf.train.load_variable(tf_path, name) names.append(name) arrays.append(array.squeeze()) for name, array in zip(names, arrays): name = name[6:] # skip "model/" name = name.split("/") pointer = model for m_name in name: if re.fullmatch(r"[A-Za-z]+\d+", m_name): scope_names = re.split(r"(\d+)", m_name) else: scope_names = [m_name] if scope_names[0] == "w" or scope_names[0] == "g": pointer = getattr(pointer, "weight") elif scope_names[0] == "b": pointer = getattr(pointer, "bias") elif scope_names[0] == "wpe" or scope_names[0] == "wte": pointer = getattr(pointer, scope_names[0]) pointer = getattr(pointer, "weight") else: pointer = getattr(pointer, scope_names[0]) if len(scope_names) >= 2: num = int(scope_names[1]) pointer = pointer[num] try: assert ( pointer.shape == array.shape ), f"Pointer shape {pointer.shape} and array shape {array.shape} mismatched" except AssertionError as e: e.args += (pointer.shape, array.shape) raise logger.info(f"Initialize PyTorch weight {name}") pointer.data = torch.from_numpy(array) return model
Load tf checkpoints in a pytorch model
10,921
import argparse import collections from pathlib import Path import torch from torch.serialization import default_restore_location from .transformers import BertConfig, DPRConfig, DPRContextEncoder, DPRQuestionEncoder, DPRReader CheckpointState = collections.namedtuple( "CheckpointState", ["model_dict", "optimizer_dict", "scheduler_dict", "offset", "epoch", "encoder_params"] ) def load_states_from_checkpoint(model_file: str) -> CheckpointState: print(f"Reading saved model from {model_file}") state_dict = torch.load(model_file, map_location=lambda s, l: default_restore_location(s, "cpu")) return CheckpointState(**state_dict)
null
10,922
import argparse import collections from pathlib import Path import torch from torch.serialization import default_restore_location from .transformers import BertConfig, DPRConfig, DPRContextEncoder, DPRQuestionEncoder, DPRReader class DPRState: def __init__(self, src_file: Path): self.src_file = src_file def load_dpr_model(self): raise NotImplementedError def from_type(comp_type: str, *args, **kwargs) -> "DPRState": if comp_type.startswith("c"): return DPRContextEncoderState(*args, **kwargs) if comp_type.startswith("q"): return DPRQuestionEncoderState(*args, **kwargs) if comp_type.startswith("r"): return DPRReaderState(*args, **kwargs) else: raise ValueError("Component type must be either 'ctx_encoder', 'question_encoder' or 'reader'.") def convert(comp_type: str, src_file: Path, dest_dir: Path): dest_dir = Path(dest_dir) dest_dir.mkdir(exist_ok=True) dpr_state = DPRState.from_type(comp_type, src_file=src_file) model = dpr_state.load_dpr_model() model.save_pretrained(dest_dir) model.from_pretrained(dest_dir) # sanity check
null
10,923
import argparse import fairseq import torch from torch import nn from transformers import ( MBart50Tokenizer, MBartConfig, MBartForCausalLM, SpeechEncoderDecoderConfig, SpeechEncoderDecoderModel, Wav2Vec2Config, Wav2Vec2FeatureExtractor, Wav2Vec2Model, logging, ) def make_linear_from_emb(emb): vocab_size, emb_size = emb.weight.shape lin_layer = nn.Linear(vocab_size, emb_size, bias=False) lin_layer.weight.data = emb.weight.data return lin_layer
null
10,924
import argparse import fairseq import torch from torch import nn from transformers import ( MBart50Tokenizer, MBartConfig, MBartForCausalLM, SpeechEncoderDecoderConfig, SpeechEncoderDecoderModel, Wav2Vec2Config, Wav2Vec2FeatureExtractor, Wav2Vec2Model, logging, ) logger = logging.get_logger(__name__) def recursively_load_weights_wav2vec2(fairseq_model, hf_model): unused_weights = [] fairseq_dict = fairseq_model.state_dict() feature_extractor = hf_model.feature_extractor adapter = hf_model.adapter for name, value in fairseq_dict.items(): is_used = False if "conv_layers" in name: load_conv_layer( name, value, feature_extractor, unused_weights, hf_model.config.feat_extract_norm == "group", ) is_used = True elif any(x in name for x in ["adaptor", "w2v_encoder.proj.", "w2v_proj_ln."]): load_adapter(name, value, adapter, unused_weights) is_used = True else: for key, mapped_key in MAPPING.items(): if key in name or key.split("w2v_model.")[-1] == name.split(".")[0]: is_used = True if "*" in mapped_key: layer_index = name.split(key)[0].split(".")[-2] mapped_key = mapped_key.replace("*", layer_index) if "weight_g" in name: weight_type = "weight_g" elif "weight_v" in name: weight_type = "weight_v" elif "bias" in name: weight_type = "bias" elif "weight" in name: weight_type = "weight" else: weight_type = None set_recursively(hf_model, mapped_key, value, name, weight_type) continue if not is_used: unused_weights.append(name) logger.warning(f"Unused weights: {unused_weights}") The provided code snippet includes necessary dependencies for implementing the `convert_wav2vec2_checkpoint` function. Write a Python function `def convert_wav2vec2_checkpoint( checkpoint_path, pytorch_dump_folder_path, dict_path, config_yaml_path, encoder_config_path, decoder_config_path, add_adapter, adapter_kernel_size, adapter_stride, decoder_start_token_id, encoder_output_dim, )` to solve the following problem: Copy/paste/tweak model's weights to transformers design. Here is the function: def convert_wav2vec2_checkpoint( checkpoint_path, pytorch_dump_folder_path, dict_path, config_yaml_path, encoder_config_path, decoder_config_path, add_adapter, adapter_kernel_size, adapter_stride, decoder_start_token_id, encoder_output_dim, ): """ Copy/paste/tweak model's weights to transformers design. """ # load configs encoder_config = Wav2Vec2Config.from_pretrained( encoder_config_path, add_adapter=True, adapter_stride=adapter_stride, adapter_kernel_size=adapter_kernel_size, use_auth_token=True, output_hidden_size=encoder_output_dim, ) decoder_config = MBartConfig.from_pretrained(decoder_config_path) # load model model, _, _ = fairseq.checkpoint_utils.load_model_ensemble_and_task( [checkpoint_path], arg_overrides={ "config_yaml": config_yaml_path, "data": "/".join(dict_path.split("/")[:-1]), "w2v_path": checkpoint_path, "load_pretrained_decoder_from": None, }, ) model = model[0].eval() # load feature extractor feature_extractor = Wav2Vec2FeatureExtractor.from_pretrained(encoder_config_path, use_auth_token=True) # set weights for wav2vec2 encoder hf_encoder = Wav2Vec2Model(encoder_config) recursively_load_weights_wav2vec2(model.encoder, hf_encoder) # load decoder weights hf_decoder = MBartForCausalLM(decoder_config) missing_keys, unexpected_keys = hf_decoder.model.decoder.load_state_dict(model.decoder.state_dict(), strict=False) logger.warning(f"The following keys are missing when loading the decoder weights: {missing_keys}") logger.warning(f"The following keys are unexpected when loading the decoder weights: {unexpected_keys}") hf_wav2vec = SpeechEncoderDecoderModel(encoder=hf_encoder, decoder=hf_decoder) hf_wav2vec.config.tie_word_embeddings = False tokenizer = MBart50Tokenizer(dict_path) tokenizer.save_pretrained(pytorch_dump_folder_path) config = hf_wav2vec.config.to_dict() config["pad_token_id"] = tokenizer.pad_token_id config["bos_token_id"] = tokenizer.bos_token_id config["eos_token_id"] = tokenizer.eos_token_id config["tokenizer_class"] = "mbart50" config["feature_extractor_type"] = "wav2vec2" config["decoder_start_token_id"] = tokenizer.eos_token_id config["forced_bos_token_id"] = 250004 config["forced_eos_token_id"] = tokenizer.eos_token_id hf_wav2vec.config = SpeechEncoderDecoderConfig.from_dict(config) hf_wav2vec.save_pretrained(pytorch_dump_folder_path) feature_extractor.save_pretrained(pytorch_dump_folder_path)
Copy/paste/tweak model's weights to transformers design.
10,925
from typing import Optional import torch from torch import nn from torch.nn import CrossEntropyLoss from ...configuration_utils import PretrainedConfig from ...modeling_outputs import BaseModelOutput, Seq2SeqLMOutput from ...modeling_utils import PreTrainedModel from ...utils import add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings from ..auto.configuration_auto import AutoConfig from ..auto.modeling_auto import AutoModel, AutoModelForCausalLM from .configuration_speech_encoder_decoder import SpeechEncoderDecoderConfig The provided code snippet includes necessary dependencies for implementing the `shift_tokens_right` function. Write a Python function `def shift_tokens_right(input_ids: torch.Tensor, pad_token_id: int, decoder_start_token_id: int)` to solve the following problem: Shift input ids one token to the right. Here is the function: def shift_tokens_right(input_ids: torch.Tensor, pad_token_id: int, decoder_start_token_id: int): """ Shift input ids one token to the right. """ shifted_input_ids = input_ids.new_zeros(input_ids.shape) shifted_input_ids[:, 1:] = input_ids[:, :-1].clone() if decoder_start_token_id is None: raise ValueError("Make sure to set the decoder_start_token_id attribute of the model's configuration.") shifted_input_ids[:, 0] = decoder_start_token_id if pad_token_id is None: raise ValueError("Make sure to set the pad_token_id attribute of the model's configuration.") # replace possible -100 values in labels by `pad_token_id` shifted_input_ids.masked_fill_(shifted_input_ids == -100, pad_token_id) return shifted_input_ids
Shift input ids one token to the right.
10,926
import argparse import json import os import fairseq import torch from torch import nn from transformers import ( Speech2Text2Config, Speech2Text2ForCausalLM, Speech2Text2Tokenizer, SpeechEncoderDecoderConfig, SpeechEncoderDecoderModel, Wav2Vec2Config, Wav2Vec2FeatureExtractor, Wav2Vec2Model, logging, ) def make_linear_from_emb(emb): vocab_size, emb_size = emb.weight.shape lin_layer = nn.Linear(vocab_size, emb_size, bias=False) lin_layer.weight.data = emb.weight.data return lin_layer
null
10,927
import argparse import json import os import fairseq import torch from torch import nn from transformers import ( Speech2Text2Config, Speech2Text2ForCausalLM, Speech2Text2Tokenizer, SpeechEncoderDecoderConfig, SpeechEncoderDecoderModel, Wav2Vec2Config, Wav2Vec2FeatureExtractor, Wav2Vec2Model, logging, ) logger = logging.get_logger(__name__) def recursively_load_weights_wav2vec2(fairseq_model, hf_model): unused_weights = [] fairseq_dict = fairseq_model.state_dict() feature_extractor = hf_model.feature_extractor # if encoder has different dim to decoder -> use proj_weight proj_weight = None for name, value in fairseq_dict.items(): is_used = False if "conv_layers" in name: load_conv_layer( name, value, feature_extractor, unused_weights, hf_model.config.feat_extract_norm == "group", ) is_used = True elif name.split(".")[0] == "proj": proj_weight = fairseq_model.proj is_used = True else: for key, mapped_key in MAPPING.items(): if key in name or key.split("w2v_model.")[-1] == name.split(".")[0]: is_used = True if "*" in mapped_key: layer_index = name.split(key)[0].split(".")[-2] mapped_key = mapped_key.replace("*", layer_index) if "weight_g" in name: weight_type = "weight_g" elif "weight_v" in name: weight_type = "weight_v" elif "bias" in name: weight_type = "bias" elif "weight" in name: weight_type = "weight" else: weight_type = None set_recursively(hf_model, mapped_key, value, name, weight_type) continue if not is_used: unused_weights.append(name) logger.warning(f"Unused weights: {unused_weights}") return proj_weight def create_vocab_dict(dict_path): with open(dict_path, "r", encoding="utf-8") as f: lines = f.readlines() words = [line.split(" ")[0] for line in lines] num_words = len(words) vocab_dict = { "<s>": 0, "<pad>": 1, "</s>": 2, "<unk>": 3, } vocab_dict.update({k: v for k, v in zip(words, range(4, num_words + 4))}) return vocab_dict The provided code snippet includes necessary dependencies for implementing the `convert_wav2vec2_checkpoint` function. Write a Python function `def convert_wav2vec2_checkpoint( checkpoint_path, pytorch_dump_folder_path, dict_path, encoder_config_path, decoder_config_path, vocab_size, num_decoder_layers, )` to solve the following problem: Copy/paste/tweak model's weights to transformers design. Here is the function: def convert_wav2vec2_checkpoint( checkpoint_path, pytorch_dump_folder_path, dict_path, encoder_config_path, decoder_config_path, vocab_size, num_decoder_layers, ): """ Copy/paste/tweak model's weights to transformers design. """ encoder_config = Wav2Vec2Config.from_pretrained(encoder_config_path) decoder_config = Speech2Text2Config.from_pretrained( decoder_config_path, vocab_size=vocab_size, decoder_layers=num_decoder_layers, do_stable_layer_norm=True ) feature_extractor = Wav2Vec2FeatureExtractor( feature_size=1, sampling_rate=16000, padding_value=0, do_normalize=True, return_attention_mask=True, ) model, _, _ = fairseq.checkpoint_utils.load_model_ensemble_and_task( [checkpoint_path], arg_overrides={"data": "/".join(dict_path.split("/")[:-1])} ) model = model[0].eval() # set weights for wav2vec2 encoder hf_encoder = Wav2Vec2Model(encoder_config) projection_layer = recursively_load_weights_wav2vec2(model.encoder, hf_encoder) hf_decoder = Speech2Text2ForCausalLM(decoder_config) missing_keys, unexpected_keys = hf_decoder.model.decoder.load_state_dict(model.decoder.state_dict(), strict=False) # set output linear layer unexpected_keys.remove("embed_out") hf_decoder.lm_head.weight = nn.Parameter(model.decoder.embed_out.detach()) # layer norm is init to identity matrix so leaving it is fine logger.warning(f"The following keys are missing when loading the decoder weights: {missing_keys}") logger.warning(f"The following keys are unexpected when loading the decoder weights: {unexpected_keys}") hf_wav2vec = SpeechEncoderDecoderModel(encoder=hf_encoder, decoder=hf_decoder) hf_wav2vec.config.tie_word_embeddings = False # add projection layer hf_wav2vec.enc_to_dec_proj.weight = nn.Parameter(projection_layer.weight) hf_wav2vec.enc_to_dec_proj.bias = nn.Parameter(projection_layer.bias) vocab_dict = create_vocab_dict(dict_path) with open(os.path.join(pytorch_dump_folder_path, "vocab.json"), "w") as fp: json.dump(vocab_dict, fp) tokenizer = Speech2Text2Tokenizer(os.path.join(pytorch_dump_folder_path, "vocab.json")) tokenizer.save_pretrained(pytorch_dump_folder_path) config = hf_wav2vec.config.to_dict() config["pad_token_id"] = tokenizer.pad_token_id config["bos_token_id"] = tokenizer.bos_token_id config["eos_token_id"] = tokenizer.eos_token_id config["tokenizer_class"] = "speech_to_text_2" config["feature_extractor_type"] = "wav2vec2" hf_wav2vec.config = SpeechEncoderDecoderConfig.from_dict(config) hf_wav2vec.save_pretrained(pytorch_dump_folder_path) feature_extractor.save_pretrained(pytorch_dump_folder_path)
Copy/paste/tweak model's weights to transformers design.
10,928
import math from typing import List, Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...activations import ACT2FN, gelu from ...modeling_outputs import ( BaseModelOutputWithPastAndCrossAttentions, BaseModelOutputWithPoolingAndCrossAttentions, CausalLMOutputWithCrossAttentions, MaskedLMOutput, MultipleChoiceModelOutput, QuestionAnsweringModelOutput, SequenceClassifierOutput, TokenClassifierOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import apply_chunking_to_forward, find_pruneable_heads_and_indices, prune_linear_layer from ...utils import ( add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_camembert import CamembertConfig The provided code snippet includes necessary dependencies for implementing the `create_position_ids_from_input_ids` function. Write a Python function `def create_position_ids_from_input_ids(input_ids, padding_idx, past_key_values_length=0)` to solve the following problem: Replace non-padding symbols with their position numbers. Position numbers begin at padding_idx+1. Padding symbols are ignored. This is modified from fairseq's `utils.make_positions`. Args: x: torch.Tensor x: Returns: torch.Tensor Here is the function: def create_position_ids_from_input_ids(input_ids, padding_idx, past_key_values_length=0): """ Replace non-padding symbols with their position numbers. Position numbers begin at padding_idx+1. Padding symbols are ignored. This is modified from fairseq's `utils.make_positions`. Args: x: torch.Tensor x: Returns: torch.Tensor """ # The series of casts and type-conversions here are carefully balanced to both work with ONNX export and XLA. mask = input_ids.ne(padding_idx).int() incremental_indices = (torch.cumsum(mask, dim=1).type_as(mask) + past_key_values_length) * mask return incremental_indices.long() + padding_idx
Replace non-padding symbols with their position numbers. Position numbers begin at padding_idx+1. Padding symbols are ignored. This is modified from fairseq's `utils.make_positions`. Args: x: torch.Tensor x: Returns: torch.Tensor
10,929
import argparse import torch from transformers import HubertConfig, HubertForSequenceClassification, Wav2Vec2FeatureExtractor, logging SUPPORTED_MODELS = ["UtteranceLevel"] The provided code snippet includes necessary dependencies for implementing the `convert_s3prl_checkpoint` function. Write a Python function `def convert_s3prl_checkpoint(base_model_name, config_path, checkpoint_path, model_dump_path)` to solve the following problem: Copy/paste/tweak model's weights to transformers design. Here is the function: def convert_s3prl_checkpoint(base_model_name, config_path, checkpoint_path, model_dump_path): """ Copy/paste/tweak model's weights to transformers design. """ checkpoint = torch.load(checkpoint_path, map_location="cpu") if checkpoint["Config"]["downstream_expert"]["modelrc"]["select"] not in SUPPORTED_MODELS: raise NotImplementedError(f"The supported s3prl models are {SUPPORTED_MODELS}") downstream_dict = checkpoint["Downstream"] hf_congfig = HubertConfig.from_pretrained(config_path) hf_model = HubertForSequenceClassification.from_pretrained(base_model_name, config=hf_congfig) hf_feature_extractor = Wav2Vec2FeatureExtractor.from_pretrained( base_model_name, return_attention_mask=True, do_normalize=False ) if hf_congfig.use_weighted_layer_sum: hf_model.layer_weights.data = checkpoint["Featurizer"]["weights"] hf_model.projector.weight.data = downstream_dict["projector.weight"] hf_model.projector.bias.data = downstream_dict["projector.bias"] hf_model.classifier.weight.data = downstream_dict["model.post_net.linear.weight"] hf_model.classifier.bias.data = downstream_dict["model.post_net.linear.bias"] hf_feature_extractor.save_pretrained(model_dump_path) hf_model.save_pretrained(model_dump_path)
Copy/paste/tweak model's weights to transformers design.
10,930
import warnings from typing import Optional, Tuple, Union import numpy as np import torch import torch.utils.checkpoint from torch import nn from torch.nn import CrossEntropyLoss from transformers.deepspeed import is_deepspeed_zero3_enabled from ...activations import ACT2FN from ...modeling_outputs import BaseModelOutput, CausalLMOutput, SequenceClassifierOutput from ...modeling_utils import PreTrainedModel from ...pytorch_utils import torch_int_div from ...utils import ( add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_hubert import HubertConfig The provided code snippet includes necessary dependencies for implementing the `_compute_mask_indices` function. Write a Python function `def _compute_mask_indices( shape: Tuple[int, int], mask_prob: float, mask_length: int, attention_mask: Optional[torch.LongTensor] = None, min_masks: int = 0, ) -> np.ndarray` to solve the following problem: Computes random mask spans for a given shape. Used to implement [SpecAugment: A Simple Data Augmentation Method for ASR](https://arxiv.org/abs/1904.08779). Note that this method is not optimized to run on TPU and should be run on CPU as part of the preprocessing during training. Args: shape: The shape for which to compute masks. This should be of a tuple of size 2 where the first element is the batch size and the second element is the length of the axis to span. mask_prob: The percentage of the whole axis (between 0 and 1) which will be masked. The number of independently generated mask spans of length `mask_length` is computed by `mask_prob*shape[1]/mask_length`. Note that due to overlaps, `mask_prob` is an upper bound and the actual percentage will be smaller. mask_length: size of the mask min_masks: minimum number of masked spans attention_mask: A (right-padded) attention mask which independently shortens the feature axis of each batch dimension. Here is the function: def _compute_mask_indices( shape: Tuple[int, int], mask_prob: float, mask_length: int, attention_mask: Optional[torch.LongTensor] = None, min_masks: int = 0, ) -> np.ndarray: """ Computes random mask spans for a given shape. Used to implement [SpecAugment: A Simple Data Augmentation Method for ASR](https://arxiv.org/abs/1904.08779). Note that this method is not optimized to run on TPU and should be run on CPU as part of the preprocessing during training. Args: shape: The shape for which to compute masks. This should be of a tuple of size 2 where the first element is the batch size and the second element is the length of the axis to span. mask_prob: The percentage of the whole axis (between 0 and 1) which will be masked. The number of independently generated mask spans of length `mask_length` is computed by `mask_prob*shape[1]/mask_length`. Note that due to overlaps, `mask_prob` is an upper bound and the actual percentage will be smaller. mask_length: size of the mask min_masks: minimum number of masked spans attention_mask: A (right-padded) attention mask which independently shortens the feature axis of each batch dimension. """ batch_size, sequence_length = shape if mask_length < 1: raise ValueError("`mask_length` has to be bigger than 0.") if mask_length > sequence_length: raise ValueError( f"`mask_length` has to be smaller than `sequence_length`, but got `mask_length`: {mask_length}" f" and `sequence_length`: {sequence_length}`" ) # epsilon is used for probabilistic rounding epsilon = np.random.rand(1).item() def compute_num_masked_span(input_length): """Given input length, compute how many spans should be masked""" num_masked_span = int(mask_prob * input_length / mask_length + epsilon) num_masked_span = max(num_masked_span, min_masks) # make sure num masked span <= sequence_length if num_masked_span * mask_length > sequence_length: num_masked_span = sequence_length // mask_length # make sure num_masked span is also <= input_length - (mask_length - 1) if input_length - (mask_length - 1) < num_masked_span: num_masked_span = max(input_length - (mask_length - 1), 0) return num_masked_span # compute number of masked spans in batch input_lengths = ( attention_mask.sum(-1).detach().tolist() if attention_mask is not None else [sequence_length for _ in range(batch_size)] ) # SpecAugment mask to fill spec_aug_mask = np.zeros((batch_size, sequence_length), dtype=bool) spec_aug_mask_idxs = [] max_num_masked_span = compute_num_masked_span(sequence_length) if max_num_masked_span == 0: return spec_aug_mask for input_length in input_lengths: # compute num of masked spans for this input num_masked_span = compute_num_masked_span(input_length) # get random indices to mask spec_aug_mask_idx = np.random.choice( np.arange(input_length - (mask_length - 1)), num_masked_span, replace=False ) # pick first sampled index that will serve as a dummy index to pad vector # to ensure same dimension for all batches due to probabilistic rounding # Picking first sample just pads those vectors twice. if len(spec_aug_mask_idx) == 0: # this case can only happen if `input_length` is strictly smaller then # `sequence_length` in which case the last token has to be a padding # token which we can use as a dummy mask id dummy_mask_idx = sequence_length - 1 else: dummy_mask_idx = spec_aug_mask_idx[0] spec_aug_mask_idx = np.concatenate( [spec_aug_mask_idx, np.ones(max_num_masked_span - num_masked_span, dtype=np.int32) * dummy_mask_idx] ) spec_aug_mask_idxs.append(spec_aug_mask_idx) spec_aug_mask_idxs = np.array(spec_aug_mask_idxs) # expand masked indices to masked spans spec_aug_mask_idxs = np.broadcast_to( spec_aug_mask_idxs[:, :, None], (batch_size, max_num_masked_span, mask_length) ) spec_aug_mask_idxs = spec_aug_mask_idxs.reshape(batch_size, max_num_masked_span * mask_length) # add offset to the starting indexes so that indexes now create a span offsets = np.arange(mask_length)[None, None, :] offsets = np.broadcast_to(offsets, (batch_size, max_num_masked_span, mask_length)).reshape( batch_size, max_num_masked_span * mask_length ) spec_aug_mask_idxs = spec_aug_mask_idxs + offsets # ensure that we cannot have indices larger than sequence_length if spec_aug_mask_idxs.max() > sequence_length - 1: spec_aug_mask_idxs[spec_aug_mask_idxs > sequence_length - 1] = sequence_length - 1 # scatter indices to mask np.put_along_axis(spec_aug_mask, spec_aug_mask_idxs, 1, -1) return spec_aug_mask
Computes random mask spans for a given shape. Used to implement [SpecAugment: A Simple Data Augmentation Method for ASR](https://arxiv.org/abs/1904.08779). Note that this method is not optimized to run on TPU and should be run on CPU as part of the preprocessing during training. Args: shape: The shape for which to compute masks. This should be of a tuple of size 2 where the first element is the batch size and the second element is the length of the axis to span. mask_prob: The percentage of the whole axis (between 0 and 1) which will be masked. The number of independently generated mask spans of length `mask_length` is computed by `mask_prob*shape[1]/mask_length`. Note that due to overlaps, `mask_prob` is an upper bound and the actual percentage will be smaller. mask_length: size of the mask min_masks: minimum number of masked spans attention_mask: A (right-padded) attention mask which independently shortens the feature axis of each batch dimension.
10,931
import argparse import torch from s3prl.hub import distilhubert from transformers import HubertConfig, HubertModel, Wav2Vec2FeatureExtractor, logging def recursively_load_weights(fairseq_model, hf_model): unused_weights = [] fairseq_dict = fairseq_model.state_dict() feature_extractor = hf_model.feature_extractor for name, value in fairseq_dict.items(): is_used = False if "conv_layers" in name: load_conv_layer( name, value, feature_extractor, unused_weights, hf_model.config.feat_extract_norm == "group", ) is_used = True else: for key, mapped_key in MAPPING.items(): mapped_key = mapped_key if key in name: is_used = True if "*" in mapped_key: layer_index = name.split(key)[0].split(".")[-2] mapped_key = mapped_key.replace("*", layer_index) if "weight_g" in name: weight_type = "weight_g" elif "weight_v" in name: weight_type = "weight_v" elif "weight" in name: weight_type = "weight" elif "bias" in name: weight_type = "bias" else: weight_type = None set_recursively(hf_model, mapped_key, value, name, weight_type) continue if not is_used: unused_weights.append(name) logger.warning(f"Unused weights: {unused_weights}") def convert_config(model): config = HubertConfig() fs_config = model.config config.activation_dropout = fs_config.activation_dropout config.apply_spec_augment = False config.attention_dropout = fs_config.attention_dropout config.conv_bias = False conv_layers = eval(fs_config.extractor_conv_feature_layers) config.conv_dim = [x[0] for x in conv_layers] config.conv_kernel = [x[1] for x in conv_layers] config.conv_stride = [x[2] for x in conv_layers] config.feat_extract_activation = "gelu" config.feat_extract_norm = "layer" if fs_config.extractor_mode == "layer_norm" else "group" config.feat_proj_layer_norm = False config.feat_proj_dropout = 0.0 config.final_dropout = 0.0 config.hidden_act = fs_config.activation_fn config.hidden_dropout = fs_config.dropout config.hidden_size = fs_config.encoder_embed_dim config.initializer_range = 0.02 config.intermediate_size = fs_config.encoder_ffn_embed_dim config.layer_norm_eps = 1e-5 config.layerdrop = 0.0 config.num_attention_heads = fs_config.encoder_attention_heads config.num_conv_pos_embedding_groups = fs_config.conv_pos_groups config.num_conv_pos_embeddings = fs_config.conv_pos config.num_feat_extract_layers = len(conv_layers) config.num_hidden_layers = fs_config.encoder_layers return config The provided code snippet includes necessary dependencies for implementing the `convert_hubert_checkpoint` function. Write a Python function `def convert_hubert_checkpoint(pytorch_dump_folder_path, config_path=None)` to solve the following problem: Copy/paste/tweak model's weights to transformers design. Here is the function: def convert_hubert_checkpoint(pytorch_dump_folder_path, config_path=None): """ Copy/paste/tweak model's weights to transformers design. """ model = distilhubert().model.model if config_path is not None: config = HubertConfig.from_pretrained(config_path) else: config = convert_config(model) model = model.eval() feature_extractor = Wav2Vec2FeatureExtractor( feature_size=1, sampling_rate=16000, padding_value=0, do_normalize=False, return_attention_mask=False, ) hf_model = HubertModel(config) recursively_load_weights(model, hf_model) feature_extractor.save_pretrained(pytorch_dump_folder_path) hf_model.save_pretrained(pytorch_dump_folder_path)
Copy/paste/tweak model's weights to transformers design.
10,932
import inspect import warnings from collections.abc import Mapping from typing import Any, Dict, Optional, Tuple, Union import numpy as np import tensorflow as tf from ...activations_tf import get_tf_activation from ...modeling_tf_outputs import TFBaseModelOutput, TFCausalLMOutput from ...modeling_tf_utils import TFPreTrainedModel, booleans_processing, get_initializer, keras_serializable from ...tf_utils import shape_list, stable_softmax from ...utils import ( ModelOutput, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_hubert import HubertConfig logger = logging.get_logger(__name__) def booleans_processing(config, **kwargs): """ Process the input booleans of each model. Args: config ([`PretrainedConfig`]): The config of the running model. **kwargs: The boolean parameters Returns: A dictionary with the proper values for each boolean """ final_booleans = {} # Pure conv models (such as ConvNext) do not have `output_attentions`. If the signature has # `output_attentions`, it will be present here in `kwargs`, even if unset (in that case, as `None`) if "output_attentions" in kwargs: final_booleans["output_attentions"] = ( kwargs["output_attentions"] if kwargs["output_attentions"] is not None else config.output_attentions ) final_booleans["output_hidden_states"] = ( kwargs["output_hidden_states"] if kwargs["output_hidden_states"] is not None else config.output_hidden_states ) final_booleans["return_dict"] = kwargs["return_dict"] if kwargs["return_dict"] is not None else config.return_dict if "use_cache" in kwargs: final_booleans["use_cache"] = ( kwargs["use_cache"] if kwargs["use_cache"] is not None else getattr(config, "use_cache", None) ) return final_booleans The provided code snippet includes necessary dependencies for implementing the `input_values_processing` function. Write a Python function `def input_values_processing(func, config, input_values, **kwargs)` to solve the following problem: Process the input of each TensorFlow model including the booleans. In case of a list of symbolic inputs, each input has to be named accordingly to the parameters name, i.e. `input_values = tf.keras.Input(shape=(128,), dtype='float32', name="input_values")` otherwise the order of the tensors will not be guaranteed during the training. Args: func (`callable`): The callable function of the TensorFlow model. config ([`PretrainedConfig`]): The config of the running model. **kwargs: The inputs of the model. Returns: Two lists, one for the missing layers, and another one for the unexpected layers. Here is the function: def input_values_processing(func, config, input_values, **kwargs): """ Process the input of each TensorFlow model including the booleans. In case of a list of symbolic inputs, each input has to be named accordingly to the parameters name, i.e. `input_values = tf.keras.Input(shape=(128,), dtype='float32', name="input_values")` otherwise the order of the tensors will not be guaranteed during the training. Args: func (`callable`): The callable function of the TensorFlow model. config ([`PretrainedConfig`]): The config of the running model. **kwargs: The inputs of the model. Returns: Two lists, one for the missing layers, and another one for the unexpected layers. """ signature = dict(inspect.signature(func).parameters) signature.pop("kwargs", None) signature.pop("self", None) parameter_names = list(signature.keys()) output = {} allowed_types = (tf.Tensor, bool, int, ModelOutput, tuple, list, dict, np.ndarray) for k, v in kwargs.items(): if isinstance(v, allowed_types) or v is None: output[k] = v else: raise ValueError(f"Data of type {type(v)} is not allowed only {allowed_types} is accepted for {k}.") if isinstance(input_values, (tuple, list)): for i, input in enumerate(input_values): # EagerTensors don't allow to use the .name property so we check for a real Tensor if type(input) == tf.Tensor: # Tensor names have always the pattern `name:id` then we check only the # `name` part tensor_name = input.name.split(":")[0] if tensor_name in parameter_names: output[tensor_name] = input else: output[parameter_names[i]] = input elif isinstance(input, allowed_types) or input is None: output[parameter_names[i]] = input else: raise ValueError( f"Data of type {type(input)} is not allowed only {allowed_types} is accepted for" f" {parameter_names[i]}." ) elif isinstance(input_values, Mapping): if "inputs" in input_values: warnings.warn( "The `inputs` argument is deprecated and will be removed in a future version, use `input_values`" " instead.", FutureWarning, ) output["input_values"] = input_values.pop("inputs") if "decoder_cached_states" in input_values: warnings.warn( "The `decoder_cached_states` argument is deprecated and will be removed in a future version, use" " `past_key_values` instead.", FutureWarning, ) output["past_key_values"] = input_values.pop("decoder_cached_states") for k, v in dict(input_values).items(): if isinstance(v, allowed_types) or v is None: output[k] = v elif k not in parameter_names and "args" not in parameter_names: logger.warning( f"The parameter {k} does not belongs to the parameter list {parameter_names} and will be ignored." ) continue else: raise ValueError(f"Data of type {type(v)} is not allowed only {allowed_types} is accepted for {k}.") else: if isinstance(input_values, tf.Tensor) or input_values is None: output[parameter_names[0]] = input_values else: raise ValueError( f"Data of type {type(input_values)} is not allowed only {allowed_types} is accepted for" f" {parameter_names[0]}." ) for name in parameter_names: if name not in list(output.keys()) and name != "args": output[name] = kwargs.pop(name, signature[name].default) # When creating a SavedModel TF calls the method with LayerCall.__call__(args, **kwargs) # So to respect the proper output we have to add this exception if "args" in output: if output["args"] is not None and type(output["args"]) == tf.Tensor: tensor_name = output["args"].name.split(":")[0] output[tensor_name] = output["args"] else: # `args` in this case is always the first parameter, then `input_values` output["input_values"] = output["args"] del output["args"] if "kwargs" in output: del output["kwargs"] boolean_dict = { k: v for k, v in output.items() if k in ["return_dict", "output_attentions", "output_hidden_states", "use_cache"] } output.update(booleans_processing(config=config, **boolean_dict)) return output
Process the input of each TensorFlow model including the booleans. In case of a list of symbolic inputs, each input has to be named accordingly to the parameters name, i.e. `input_values = tf.keras.Input(shape=(128,), dtype='float32', name="input_values")` otherwise the order of the tensors will not be guaranteed during the training. Args: func (`callable`): The callable function of the TensorFlow model. config ([`PretrainedConfig`]): The config of the running model. **kwargs: The inputs of the model. Returns: Two lists, one for the missing layers, and another one for the unexpected layers.
10,933
import inspect import warnings from collections.abc import Mapping from typing import Any, Dict, Optional, Tuple, Union import numpy as np import tensorflow as tf from ...activations_tf import get_tf_activation from ...modeling_tf_outputs import TFBaseModelOutput, TFCausalLMOutput from ...modeling_tf_utils import TFPreTrainedModel, booleans_processing, get_initializer, keras_serializable from ...tf_utils import shape_list, stable_softmax from ...utils import ( ModelOutput, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_hubert import HubertConfig def _sample_without_replacement(distribution, num_samples): """ Categorical sampling without replacement is currently not implemented. The gumbel-max trick will do for now - see https://github.com/tensorflow/tensorflow/issues/9260 for more info """ z = -tf.math.log(tf.random.uniform(shape_list(distribution), 0, 1)) _, indices = tf.nn.top_k(distribution + z, num_samples) return indices def _scatter_values_on_batch_indices(values, batch_indices, output_shape): """ Scatter function as in PyTorch with indices in format (batch_dim, indixes) """ indices_shape = shape_list(batch_indices) # broadcast batch dim to indices_shape broad_casted_batch_dims = tf.reshape( tf.broadcast_to(tf.expand_dims(tf.range(indices_shape[0]), axis=-1), indices_shape), [1, -1] ) # transform batch_indices to pair_indices pair_indices = tf.transpose(tf.concat([broad_casted_batch_dims, tf.reshape(batch_indices, [1, -1])], 0)) # scatter values to pair indices return tf.scatter_nd(pair_indices, tf.reshape(values, [-1]), output_shape) The provided code snippet includes necessary dependencies for implementing the `_compute_mask_indices` function. Write a Python function `def _compute_mask_indices( shape: Tuple[int, int], mask_prob: float, mask_length: int, min_masks: int = 0, ) -> tf.Tensor` to solve the following problem: Computes random mask spans for a given shape Args: shape: the shape for which to compute masks. should be of size 2 where first element is batch size and 2nd is timesteps attention_mask: optional padding mask of the same size as shape, which will prevent masking padded elements mask_prob: probability for each token to be chosen as start of the span to be masked. this will be multiplied by number of timesteps divided by length of mask span to mask approximately this percentage of all elements. however due to overlaps, the actual number will be smaller (unless no_overlap is True) mask_length: size of the mask min_masks: minimum number of masked spans Adapted from [fairseq's data_utils.py](https://github.com/pytorch/fairseq/blob/e0788f7007a8473a76db573985031f3c94201e79/fairseq/data/data_utils.py#L376). Here is the function: def _compute_mask_indices( shape: Tuple[int, int], mask_prob: float, mask_length: int, min_masks: int = 0, ) -> tf.Tensor: """ Computes random mask spans for a given shape Args: shape: the shape for which to compute masks. should be of size 2 where first element is batch size and 2nd is timesteps attention_mask: optional padding mask of the same size as shape, which will prevent masking padded elements mask_prob: probability for each token to be chosen as start of the span to be masked. this will be multiplied by number of timesteps divided by length of mask span to mask approximately this percentage of all elements. however due to overlaps, the actual number will be smaller (unless no_overlap is True) mask_length: size of the mask min_masks: minimum number of masked spans Adapted from [fairseq's data_utils.py](https://github.com/pytorch/fairseq/blob/e0788f7007a8473a76db573985031f3c94201e79/fairseq/data/data_utils.py#L376). """ batch_size, sequence_length = shape if mask_length < 1: raise ValueError("`mask_length` has to be bigger than 0.") if mask_length > sequence_length: raise ValueError( f"`mask_length` has to be smaller than `sequence_length`, but got `mask_length`: {mask_length} and" f" `sequence_length`: {sequence_length}`" ) # compute number of masked spans in batch num_masked_spans = mask_prob * sequence_length / mask_length + tf.random.uniform((1,)) num_masked_spans = tf.maximum(num_masked_spans, min_masks) num_masked_spans = tf.cast(num_masked_spans, tf.int32) # make sure num masked indices <= sequence_length num_masked_spans = tf.math.minimum(sequence_length // mask_length, num_masked_spans) num_masked_spans = tf.squeeze(num_masked_spans) # SpecAugment mask to fill spec_aug_mask = tf.zeros((batch_size, sequence_length), dtype=tf.int32) # uniform distribution to sample from, make sure that offset samples are < sequence_length uniform_dist = tf.ones((batch_size, sequence_length - (mask_length - 1))) # get random indices to mask spec_aug_mask_idxs = _sample_without_replacement(uniform_dist, num_masked_spans) # expand masked indices to masked spans spec_aug_mask_idxs = tf.expand_dims(spec_aug_mask_idxs, -1) spec_aug_mask_idxs = tf.tile(spec_aug_mask_idxs, (1, 1, mask_length)) spec_aug_mask_idxs = tf.reshape(spec_aug_mask_idxs, (batch_size, num_masked_spans * mask_length)) offsets = tf.range(mask_length)[tf.newaxis, tf.newaxis, :] offsets = tf.tile(offsets, (batch_size, num_masked_spans, 1)) offsets = tf.reshape(offsets, (batch_size, num_masked_spans * mask_length)) spec_aug_mask_idxs = spec_aug_mask_idxs + offsets # scatter indices to mask spec_aug_mask = _scatter_values_on_batch_indices( tf.ones_like(spec_aug_mask_idxs), spec_aug_mask_idxs, tf.shape(spec_aug_mask) ) return spec_aug_mask
Computes random mask spans for a given shape Args: shape: the shape for which to compute masks. should be of size 2 where first element is batch size and 2nd is timesteps attention_mask: optional padding mask of the same size as shape, which will prevent masking padded elements mask_prob: probability for each token to be chosen as start of the span to be masked. this will be multiplied by number of timesteps divided by length of mask span to mask approximately this percentage of all elements. however due to overlaps, the actual number will be smaller (unless no_overlap is True) mask_length: size of the mask min_masks: minimum number of masked spans Adapted from [fairseq's data_utils.py](https://github.com/pytorch/fairseq/blob/e0788f7007a8473a76db573985031f3c94201e79/fairseq/data/data_utils.py#L376).
10,934
import inspect import warnings from collections.abc import Mapping from typing import Any, Dict, Optional, Tuple, Union import numpy as np import tensorflow as tf from ...activations_tf import get_tf_activation from ...modeling_tf_outputs import TFBaseModelOutput, TFCausalLMOutput from ...modeling_tf_utils import TFPreTrainedModel, booleans_processing, get_initializer, keras_serializable from ...tf_utils import shape_list, stable_softmax from ...utils import ( ModelOutput, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_hubert import HubertConfig LARGE_NEGATIVE = -1e8 def shape_list(tensor: Union[tf.Tensor, np.ndarray]) -> List[int]: """ Deal with dynamic shape in tensorflow cleanly. Args: tensor (`tf.Tensor` or `np.ndarray`): The tensor we want the shape of. Returns: `List[int]`: The shape of the tensor as a list. """ if isinstance(tensor, np.ndarray): return list(tensor.shape) dynamic = tf.shape(tensor) if tensor.shape == tf.TensorShape(None): return dynamic static = tensor.shape.as_list() return [dynamic[i] if s is None else s for i, s in enumerate(static)] The provided code snippet includes necessary dependencies for implementing the `_expand_mask` function. Write a Python function `def _expand_mask(mask: tf.Tensor, tgt_len: Optional[int] = None)` to solve the following problem: Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`. Here is the function: def _expand_mask(mask: tf.Tensor, tgt_len: Optional[int] = None): """ Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`. """ src_len = shape_list(mask)[1] tgt_len = tgt_len if tgt_len is not None else src_len one_cst = tf.constant(1.0) mask = tf.cast(mask, dtype=one_cst.dtype) expanded_mask = tf.tile(mask[:, None, None, :], (1, 1, tgt_len, 1)) return (one_cst - expanded_mask) * LARGE_NEGATIVE
Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`.
10,935
import argparse import json import os import fairseq import torch from fairseq.data import Dictionary from transformers import ( HubertConfig, HubertForCTC, HubertModel, Wav2Vec2CTCTokenizer, Wav2Vec2FeatureExtractor, Wav2Vec2Processor, logging, ) logger = logging.get_logger(__name__) def recursively_load_weights(fairseq_model, hf_model, is_finetuned): unused_weights = [] fairseq_dict = fairseq_model.state_dict() feature_extractor = hf_model.hubert.feature_extractor if is_finetuned else hf_model.feature_extractor for name, value in fairseq_dict.items(): is_used = False if "conv_layers" in name: load_conv_layer( name, value, feature_extractor, unused_weights, hf_model.config.feat_extract_norm == "group", ) is_used = True else: for key, mapped_key in MAPPING.items(): mapped_key = "hubert." + mapped_key if (is_finetuned and mapped_key != "lm_head") else mapped_key if key in name or (key.split("w2v_model.")[-1] == name.split(".")[0] and not is_finetuned): is_used = True if "*" in mapped_key: layer_index = name.split(key)[0].split(".")[-2] mapped_key = mapped_key.replace("*", layer_index) if "weight_g" in name: weight_type = "weight_g" elif "weight_v" in name: weight_type = "weight_v" elif "weight" in name: weight_type = "weight" elif "bias" in name: weight_type = "bias" else: weight_type = None set_recursively(hf_model, mapped_key, value, name, weight_type) continue if not is_used: unused_weights.append(name) logger.warning(f"Unused weights: {unused_weights}") The provided code snippet includes necessary dependencies for implementing the `convert_hubert_checkpoint` function. Write a Python function `def convert_hubert_checkpoint( checkpoint_path, pytorch_dump_folder_path, config_path=None, dict_path=None, is_finetuned=True )` to solve the following problem: Copy/paste/tweak model's weights to transformers design. Here is the function: def convert_hubert_checkpoint( checkpoint_path, pytorch_dump_folder_path, config_path=None, dict_path=None, is_finetuned=True ): """ Copy/paste/tweak model's weights to transformers design. """ if config_path is not None: config = HubertConfig.from_pretrained(config_path) else: config = HubertConfig() if is_finetuned: if dict_path: target_dict = Dictionary.load(dict_path) # important change bos & pad token id since CTC symbol is <pad> and # not <s> as in fairseq config.bos_token_id = target_dict.pad_index config.pad_token_id = target_dict.bos_index config.eos_token_id = target_dict.eos_index config.vocab_size = len(target_dict.symbols) vocab_path = os.path.join(pytorch_dump_folder_path, "vocab.json") if not os.path.isdir(pytorch_dump_folder_path): logger.error("--pytorch_dump_folder_path ({}) should be a directory".format(pytorch_dump_folder_path)) return os.makedirs(pytorch_dump_folder_path, exist_ok=True) with open(vocab_path, "w", encoding="utf-8") as vocab_handle: json.dump(target_dict.indices, vocab_handle) tokenizer = Wav2Vec2CTCTokenizer( vocab_path, unk_token=target_dict.unk_word, pad_token=target_dict.pad_word, bos_token=target_dict.bos_word, eos_token=target_dict.eos_word, word_delimiter_token="|", do_lower_case=False, ) return_attention_mask = True if config.feat_extract_norm == "layer" else False feature_extractor = Wav2Vec2FeatureExtractor( feature_size=1, sampling_rate=16000, padding_value=0, do_normalize=True, return_attention_mask=return_attention_mask, ) processor = Wav2Vec2Processor(feature_extractor=feature_extractor, tokenizer=tokenizer) processor.save_pretrained(pytorch_dump_folder_path) hf_wav2vec = HubertForCTC(config) else: hf_wav2vec = HubertModel(config) if is_finetuned: model, _, _ = fairseq.checkpoint_utils.load_model_ensemble_and_task( [checkpoint_path], arg_overrides={"data": "/".join(dict_path.split("/")[:-1])} ) else: model, _, _ = fairseq.checkpoint_utils.load_model_ensemble_and_task([checkpoint_path]) model = model[0].eval() recursively_load_weights(model, hf_wav2vec, is_finetuned) hf_wav2vec.save_pretrained(pytorch_dump_folder_path)
Copy/paste/tweak model's weights to transformers design.
10,936
import argparse import json import os import fairseq import torch from fairseq.data import Dictionary from transformers import ( Wav2Vec2Config, Wav2Vec2CTCTokenizer, Wav2Vec2FeatureExtractor, Wav2Vec2ForCTC, Wav2Vec2ForPreTraining, Wav2Vec2Processor, logging, ) logger = logging.get_logger(__name__) def recursively_load_weights(fairseq_model, hf_model, is_headless): unused_weights = [] fairseq_dict = fairseq_model.state_dict() feature_extractor = hf_model.wav2vec2.feature_extractor for name, value in fairseq_dict.items(): is_used = False if "conv_layers" in name: load_conv_layer( name, value, feature_extractor, unused_weights, hf_model.config.feat_extract_norm == "group", ) is_used = True else: for key, mapped_key in MAPPING.items(): mapped_key = "wav2vec2." + mapped_key if mapped_key not in TOP_LEVEL_KEYS else mapped_key if key in name or key.split("w2v_model.")[-1] == name.split(".")[0]: is_used = True if "*" in mapped_key: layer_index = name.split(key)[0].split(".")[-2] mapped_key = mapped_key.replace("*", layer_index) if "weight_g" in name: weight_type = "weight_g" elif "weight_v" in name: weight_type = "weight_v" elif "bias" in name: weight_type = "bias" elif "weight" in name: # TODO: don't match quantizer.weight_proj weight_type = "weight" else: weight_type = None set_recursively(hf_model, mapped_key, value, name, weight_type) continue if not is_used: unused_weights.append(name) logger.warning(f"Unused weights: {unused_weights}") The provided code snippet includes necessary dependencies for implementing the `convert_wav2vec2_checkpoint` function. Write a Python function `def convert_wav2vec2_checkpoint( checkpoint_path, pytorch_dump_folder_path, config_path=None, dict_path=None, is_finetuned=True )` to solve the following problem: Copy/paste/tweak model's weights to transformers design. Here is the function: def convert_wav2vec2_checkpoint( checkpoint_path, pytorch_dump_folder_path, config_path=None, dict_path=None, is_finetuned=True ): """ Copy/paste/tweak model's weights to transformers design. """ if config_path is not None: config = Wav2Vec2Config.from_pretrained(config_path) else: config = Wav2Vec2Config() if is_finetuned: if dict_path: target_dict = Dictionary.load(dict_path) # important change bos & pad token id since CTC symbol is <pad> and # not <s> as in fairseq config.bos_token_id = target_dict.pad_index config.pad_token_id = target_dict.bos_index config.eos_token_id = target_dict.eos_index config.vocab_size = len(target_dict.symbols) vocab_path = os.path.join(pytorch_dump_folder_path, "vocab.json") if not os.path.isdir(pytorch_dump_folder_path): logger.error("--pytorch_dump_folder_path ({}) should be a directory".format(pytorch_dump_folder_path)) return os.makedirs(pytorch_dump_folder_path, exist_ok=True) vocab_dict = target_dict.indices # fairseq has the <pad> and <s> switched vocab_dict["<pad>"] = 0 vocab_dict["<s>"] = 1 with open(vocab_path, "w", encoding="utf-8") as vocab_handle: json.dump(vocab_dict, vocab_handle) tokenizer = Wav2Vec2CTCTokenizer( vocab_path, unk_token=target_dict.unk_word, pad_token=target_dict.pad_word, bos_token=target_dict.bos_word, eos_token=target_dict.eos_word, word_delimiter_token="|", do_lower_case=False, ) return_attention_mask = True if config.feat_extract_norm == "layer" else False feature_extractor = Wav2Vec2FeatureExtractor( feature_size=1, sampling_rate=16000, padding_value=0, do_normalize=True, return_attention_mask=return_attention_mask, ) processor = Wav2Vec2Processor(feature_extractor=feature_extractor, tokenizer=tokenizer) processor.save_pretrained(pytorch_dump_folder_path) hf_wav2vec = Wav2Vec2ForCTC(config) else: hf_wav2vec = Wav2Vec2ForPreTraining(config) if is_finetuned: model, _, _ = fairseq.checkpoint_utils.load_model_ensemble_and_task( [checkpoint_path], arg_overrides={"data": "/".join(dict_path.split("/")[:-1])} ) else: task_arg = argparse.Namespace(task="audio_pretraining") task = fairseq.tasks.setup_task(task_arg) model, _, _ = fairseq.checkpoint_utils.load_model_ensemble_and_task([checkpoint_path], task=task) model = model[0].eval() recursively_load_weights(model, hf_wav2vec, not is_finetuned) hf_wav2vec.save_pretrained(pytorch_dump_folder_path)
Copy/paste/tweak model's weights to transformers design.
10,937
import inspect import warnings from collections.abc import Mapping from dataclasses import dataclass from typing import Any, Dict, Optional, Tuple, Union import numpy as np import tensorflow as tf from ...activations_tf import get_tf_activation from ...modeling_tf_outputs import TFBaseModelOutput, TFCausalLMOutput from ...modeling_tf_utils import ( TFPreTrainedModel, booleans_processing, get_initializer, keras_serializable, unpack_inputs, ) from ...tf_utils import shape_list, stable_softmax from ...utils import ( ModelOutput, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_wav2vec2 import Wav2Vec2Config logger = logging.get_logger(__name__) def booleans_processing(config, **kwargs): """ Process the input booleans of each model. Args: config ([`PretrainedConfig`]): The config of the running model. **kwargs: The boolean parameters Returns: A dictionary with the proper values for each boolean """ final_booleans = {} # Pure conv models (such as ConvNext) do not have `output_attentions`. If the signature has # `output_attentions`, it will be present here in `kwargs`, even if unset (in that case, as `None`) if "output_attentions" in kwargs: final_booleans["output_attentions"] = ( kwargs["output_attentions"] if kwargs["output_attentions"] is not None else config.output_attentions ) final_booleans["output_hidden_states"] = ( kwargs["output_hidden_states"] if kwargs["output_hidden_states"] is not None else config.output_hidden_states ) final_booleans["return_dict"] = kwargs["return_dict"] if kwargs["return_dict"] is not None else config.return_dict if "use_cache" in kwargs: final_booleans["use_cache"] = ( kwargs["use_cache"] if kwargs["use_cache"] is not None else getattr(config, "use_cache", None) ) return final_booleans The provided code snippet includes necessary dependencies for implementing the `input_values_processing` function. Write a Python function `def input_values_processing(func, config, input_values, **kwargs)` to solve the following problem: Process the input of each TensorFlow model including the booleans. In case of a list of symbolic inputs, each input has to be named accordingly to the parameters name, i.e. `input_values = tf.keras.Input(shape=(128,), dtype='float32', name="input_values")` otherwise the order of the tensors will not be guaranteed during the training. Args: func (`callable`): The callable function of the TensorFlow model. config ([`PretrainedConfig`]): The config of the running model. **kwargs: The inputs of the model. Returns: Two lists, one for the missing layers, and another one for the unexpected layers. Here is the function: def input_values_processing(func, config, input_values, **kwargs): """ Process the input of each TensorFlow model including the booleans. In case of a list of symbolic inputs, each input has to be named accordingly to the parameters name, i.e. `input_values = tf.keras.Input(shape=(128,), dtype='float32', name="input_values")` otherwise the order of the tensors will not be guaranteed during the training. Args: func (`callable`): The callable function of the TensorFlow model. config ([`PretrainedConfig`]): The config of the running model. **kwargs: The inputs of the model. Returns: Two lists, one for the missing layers, and another one for the unexpected layers. """ signature = dict(inspect.signature(func).parameters) signature.pop("kwargs", None) signature.pop("self", None) parameter_names = list(signature.keys()) output = {} allowed_types = (tf.Tensor, bool, int, ModelOutput, tuple, list, dict, np.ndarray) for k, v in kwargs.items(): if isinstance(v, allowed_types) or v is None: output[k] = v else: raise ValueError(f"Data of type {type(v)} is not allowed only {allowed_types} is accepted for {k}.") if isinstance(input_values, (tuple, list)): for i, input in enumerate(input_values): # EagerTensors don't allow to use the .name property so we check for a real Tensor if type(input) == tf.Tensor: # Tensor names have always the pattern `name:id` then we check only the # `name` part tensor_name = input.name.split(":")[0] if tensor_name in parameter_names: output[tensor_name] = input else: output[parameter_names[i]] = input elif isinstance(input, allowed_types) or input is None: output[parameter_names[i]] = input else: raise ValueError( f"Data of type {type(input)} is not allowed only {allowed_types} is accepted for" f" {parameter_names[i]}." ) elif isinstance(input_values, Mapping): if "inputs" in input_values: warnings.warn( "The `inputs` argument is deprecated and will be removed in a future version, use `input_values`" " instead.", FutureWarning, ) output["input_values"] = input_values.pop("inputs") if "decoder_cached_states" in input_values: warnings.warn( "The `decoder_cached_states` argument is deprecated and will be removed in a future version, use" " `past_key_values` instead.", FutureWarning, ) output["past_key_values"] = input_values.pop("decoder_cached_states") for k, v in dict(input_values).items(): if isinstance(v, allowed_types) or v is None: output[k] = v elif k not in parameter_names and "args" not in parameter_names: logger.warning( f"The parameter {k} does not belongs to the parameter list {parameter_names} and will be ignored." ) continue else: raise ValueError(f"Data of type {type(v)} is not allowed only {allowed_types} is accepted for {k}.") else: if isinstance(input_values, tf.Tensor) or input_values is None: output[parameter_names[0]] = input_values else: raise ValueError( f"Data of type {type(input_values)} is not allowed only {allowed_types} is accepted for" f" {parameter_names[0]}." ) for name in parameter_names: if name not in list(output.keys()) and name != "args": output[name] = kwargs.pop(name, signature[name].default) # When creating a SavedModel TF calls the method with LayerCall.__call__(args, **kwargs) # So to respect the proper output we have to add this exception if "args" in output: if output["args"] is not None and type(output["args"]) == tf.Tensor: tensor_name = output["args"].name.split(":")[0] output[tensor_name] = output["args"] else: # `args` in this case is always the first parameter, then `input_values` output["input_values"] = output["args"] del output["args"] if "kwargs" in output: del output["kwargs"] boolean_dict = { k: v for k, v in output.items() if k in ["return_dict", "output_attentions", "output_hidden_states", "use_cache"] } output.update(booleans_processing(config=config, **boolean_dict)) return output
Process the input of each TensorFlow model including the booleans. In case of a list of symbolic inputs, each input has to be named accordingly to the parameters name, i.e. `input_values = tf.keras.Input(shape=(128,), dtype='float32', name="input_values")` otherwise the order of the tensors will not be guaranteed during the training. Args: func (`callable`): The callable function of the TensorFlow model. config ([`PretrainedConfig`]): The config of the running model. **kwargs: The inputs of the model. Returns: Two lists, one for the missing layers, and another one for the unexpected layers.
10,938
import inspect import warnings from collections.abc import Mapping from dataclasses import dataclass from typing import Any, Dict, Optional, Tuple, Union import numpy as np import tensorflow as tf from ...activations_tf import get_tf_activation from ...modeling_tf_outputs import TFBaseModelOutput, TFCausalLMOutput from ...modeling_tf_utils import ( TFPreTrainedModel, booleans_processing, get_initializer, keras_serializable, unpack_inputs, ) from ...tf_utils import shape_list, stable_softmax from ...utils import ( ModelOutput, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_wav2vec2 import Wav2Vec2Config def _sample_without_replacement(distribution, num_samples): """ Categorical sampling without replacement is currently not implemented. The gumbel-max trick will do for now - see https://github.com/tensorflow/tensorflow/issues/9260 for more info """ z = -tf.math.log(tf.random.uniform(shape_list(distribution), 0, 1)) _, indices = tf.nn.top_k(distribution + z, num_samples) return indices def _scatter_values_on_batch_indices(values, batch_indices, output_shape): """ Scatter function as in PyTorch with indices in format (batch_dim, indixes) """ indices_shape = shape_list(batch_indices) # broadcast batch dim to indices_shape broad_casted_batch_dims = tf.reshape( tf.broadcast_to(tf.expand_dims(tf.range(indices_shape[0]), axis=-1), indices_shape), [1, -1] ) # transform batch_indices to pair_indices pair_indices = tf.transpose(tf.concat([broad_casted_batch_dims, tf.reshape(batch_indices, [1, -1])], 0)) # scatter values to pair indices return tf.scatter_nd(pair_indices, tf.reshape(values, [-1]), output_shape) The provided code snippet includes necessary dependencies for implementing the `_compute_mask_indices` function. Write a Python function `def _compute_mask_indices( shape: Tuple[int, int], mask_prob: float, mask_length: int, min_masks: int = 0, ) -> tf.Tensor` to solve the following problem: Computes random mask spans for a given shape Args: shape: the shape for which to compute masks. should be of size 2 where first element is batch size and 2nd is timesteps attention_mask: optional padding mask of the same size as shape, which will prevent masking padded elements mask_prob: probability for each token to be chosen as start of the span to be masked. this will be multiplied by number of timesteps divided by length of mask span to mask approximately this percentage of all elements. however due to overlaps, the actual number will be smaller (unless no_overlap is True) mask_length: size of the mask min_masks: minimum number of masked spans Adapted from [fairseq's data_utils.py](https://github.com/pytorch/fairseq/blob/e0788f7007a8473a76db573985031f3c94201e79/fairseq/data/data_utils.py#L376). Here is the function: def _compute_mask_indices( shape: Tuple[int, int], mask_prob: float, mask_length: int, min_masks: int = 0, ) -> tf.Tensor: """ Computes random mask spans for a given shape Args: shape: the shape for which to compute masks. should be of size 2 where first element is batch size and 2nd is timesteps attention_mask: optional padding mask of the same size as shape, which will prevent masking padded elements mask_prob: probability for each token to be chosen as start of the span to be masked. this will be multiplied by number of timesteps divided by length of mask span to mask approximately this percentage of all elements. however due to overlaps, the actual number will be smaller (unless no_overlap is True) mask_length: size of the mask min_masks: minimum number of masked spans Adapted from [fairseq's data_utils.py](https://github.com/pytorch/fairseq/blob/e0788f7007a8473a76db573985031f3c94201e79/fairseq/data/data_utils.py#L376). """ batch_size, sequence_length = shape if mask_length < 1: raise ValueError("`mask_length` has to be bigger than 0.") if mask_length > sequence_length: raise ValueError( f"`mask_length` has to be smaller than `sequence_length`, but got `mask_length`: {mask_length} and" f" `sequence_length`: {sequence_length}`" ) # compute number of masked spans in batch num_masked_spans = mask_prob * sequence_length / mask_length + tf.random.uniform((1,)) num_masked_spans = tf.maximum(num_masked_spans, min_masks) num_masked_spans = tf.cast(num_masked_spans, tf.int32) # make sure num masked indices <= sequence_length num_masked_spans = tf.math.minimum(sequence_length // mask_length, num_masked_spans) num_masked_spans = tf.squeeze(num_masked_spans) # SpecAugment mask to fill spec_aug_mask = tf.zeros((batch_size, sequence_length), dtype=tf.int32) # uniform distribution to sample from, make sure that offset samples are < sequence_length uniform_dist = tf.ones((batch_size, sequence_length - (mask_length - 1))) # get random indices to mask spec_aug_mask_idxs = _sample_without_replacement(uniform_dist, num_masked_spans) # expand masked indices to masked spans spec_aug_mask_idxs = tf.expand_dims(spec_aug_mask_idxs, -1) spec_aug_mask_idxs = tf.tile(spec_aug_mask_idxs, (1, 1, mask_length)) spec_aug_mask_idxs = tf.reshape(spec_aug_mask_idxs, (batch_size, num_masked_spans * mask_length)) offsets = tf.range(mask_length)[tf.newaxis, tf.newaxis, :] offsets = tf.tile(offsets, (batch_size, num_masked_spans, 1)) offsets = tf.reshape(offsets, (batch_size, num_masked_spans * mask_length)) spec_aug_mask_idxs = spec_aug_mask_idxs + offsets # scatter indices to mask spec_aug_mask = _scatter_values_on_batch_indices( tf.ones_like(spec_aug_mask_idxs), spec_aug_mask_idxs, tf.shape(spec_aug_mask) ) return spec_aug_mask
Computes random mask spans for a given shape Args: shape: the shape for which to compute masks. should be of size 2 where first element is batch size and 2nd is timesteps attention_mask: optional padding mask of the same size as shape, which will prevent masking padded elements mask_prob: probability for each token to be chosen as start of the span to be masked. this will be multiplied by number of timesteps divided by length of mask span to mask approximately this percentage of all elements. however due to overlaps, the actual number will be smaller (unless no_overlap is True) mask_length: size of the mask min_masks: minimum number of masked spans Adapted from [fairseq's data_utils.py](https://github.com/pytorch/fairseq/blob/e0788f7007a8473a76db573985031f3c94201e79/fairseq/data/data_utils.py#L376).
10,939
import inspect import warnings from collections.abc import Mapping from dataclasses import dataclass from typing import Any, Dict, Optional, Tuple, Union import numpy as np import tensorflow as tf from ...activations_tf import get_tf_activation from ...modeling_tf_outputs import TFBaseModelOutput, TFCausalLMOutput from ...modeling_tf_utils import ( TFPreTrainedModel, booleans_processing, get_initializer, keras_serializable, unpack_inputs, ) from ...tf_utils import shape_list, stable_softmax from ...utils import ( ModelOutput, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_wav2vec2 import Wav2Vec2Config LARGE_NEGATIVE = -1e8 def shape_list(tensor: Union[tf.Tensor, np.ndarray]) -> List[int]: """ Deal with dynamic shape in tensorflow cleanly. Args: tensor (`tf.Tensor` or `np.ndarray`): The tensor we want the shape of. Returns: `List[int]`: The shape of the tensor as a list. """ if isinstance(tensor, np.ndarray): return list(tensor.shape) dynamic = tf.shape(tensor) if tensor.shape == tf.TensorShape(None): return dynamic static = tensor.shape.as_list() return [dynamic[i] if s is None else s for i, s in enumerate(static)] The provided code snippet includes necessary dependencies for implementing the `_expand_mask` function. Write a Python function `def _expand_mask(mask: tf.Tensor, tgt_len: Optional[int] = None)` to solve the following problem: Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`. Here is the function: def _expand_mask(mask: tf.Tensor, tgt_len: Optional[int] = None): """ Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`. """ src_len = shape_list(mask)[1] tgt_len = tgt_len if tgt_len is not None else src_len one_cst = tf.constant(1.0) mask = tf.cast(mask, dtype=one_cst.dtype) expanded_mask = tf.tile(mask[:, None, None, :], (1, 1, tgt_len, 1)) return (one_cst - expanded_mask) * LARGE_NEGATIVE
Expands attention_mask from `[bsz, seq_len]` to `[bsz, 1, tgt_seq_len, src_seq_len]`.
10,940
import argparse import torch from transformers import ( Wav2Vec2Config, Wav2Vec2FeatureExtractor, Wav2Vec2ForAudioFrameClassification, Wav2Vec2ForSequenceClassification, Wav2Vec2ForXVector, logging, ) def convert_classification(base_model_name, hf_config, downstream_dict): model = Wav2Vec2ForSequenceClassification.from_pretrained(base_model_name, config=hf_config) model.projector.weight.data = downstream_dict["projector.weight"] model.projector.bias.data = downstream_dict["projector.bias"] model.classifier.weight.data = downstream_dict["model.post_net.linear.weight"] model.classifier.bias.data = downstream_dict["model.post_net.linear.bias"] return model def convert_diarization(base_model_name, hf_config, downstream_dict): model = Wav2Vec2ForAudioFrameClassification.from_pretrained(base_model_name, config=hf_config) model.classifier.weight.data = downstream_dict["model.linear.weight"] model.classifier.bias.data = downstream_dict["model.linear.bias"] return model def convert_xvector(base_model_name, hf_config, downstream_dict): model = Wav2Vec2ForXVector.from_pretrained(base_model_name, config=hf_config) model.projector.weight.data = downstream_dict["connector.weight"] model.projector.bias.data = downstream_dict["connector.bias"] for i, kernel_size in enumerate(hf_config.tdnn_kernel): model.tdnn[i].kernel.weight.data = downstream_dict[ f"model.framelevel_feature_extractor.module.{i}.kernel.weight" ] model.tdnn[i].kernel.bias.data = downstream_dict[f"model.framelevel_feature_extractor.module.{i}.kernel.bias"] model.feature_extractor.weight.data = downstream_dict["model.utterancelevel_feature_extractor.linear1.weight"] model.feature_extractor.bias.data = downstream_dict["model.utterancelevel_feature_extractor.linear1.bias"] model.classifier.weight.data = downstream_dict["model.utterancelevel_feature_extractor.linear2.weight"] model.classifier.bias.data = downstream_dict["model.utterancelevel_feature_extractor.linear2.bias"] model.objective.weight.data = downstream_dict["objective.W"] return model The provided code snippet includes necessary dependencies for implementing the `convert_s3prl_checkpoint` function. Write a Python function `def convert_s3prl_checkpoint(base_model_name, config_path, checkpoint_path, model_dump_path)` to solve the following problem: Copy/paste/tweak model's weights to transformers design. Here is the function: def convert_s3prl_checkpoint(base_model_name, config_path, checkpoint_path, model_dump_path): """ Copy/paste/tweak model's weights to transformers design. """ checkpoint = torch.load(checkpoint_path, map_location="cpu") downstream_dict = checkpoint["Downstream"] hf_config = Wav2Vec2Config.from_pretrained(config_path) hf_feature_extractor = Wav2Vec2FeatureExtractor.from_pretrained( base_model_name, return_attention_mask=True, do_normalize=False ) arch = hf_config.architectures[0] if arch.endswith("ForSequenceClassification"): hf_model = convert_classification(base_model_name, hf_config, downstream_dict) elif arch.endswith("ForAudioFrameClassification"): hf_model = convert_diarization(base_model_name, hf_config, downstream_dict) elif arch.endswith("ForXVector"): hf_model = convert_xvector(base_model_name, hf_config, downstream_dict) else: raise NotImplementedError(f"S3PRL weights conversion is not supported for {arch}") if hf_config.use_weighted_layer_sum: hf_model.layer_weights.data = checkpoint["Featurizer"]["weights"] hf_feature_extractor.save_pretrained(model_dump_path) hf_model.save_pretrained(model_dump_path)
Copy/paste/tweak model's weights to transformers design.
10,941
import math import warnings from dataclasses import dataclass from typing import Optional, Tuple, Union import numpy as np import torch import torch.utils.checkpoint from torch import nn from torch.nn import CrossEntropyLoss from ...activations import ACT2FN from ...deepspeed import is_deepspeed_zero3_enabled from ...modeling_outputs import ( BaseModelOutput, CausalLMOutput, MaskedLMOutput, SequenceClassifierOutput, TokenClassifierOutput, Wav2Vec2BaseModelOutput, XVectorOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import torch_int_div from ...utils import ( ModelOutput, add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_wav2vec2 import Wav2Vec2Config The provided code snippet includes necessary dependencies for implementing the `_compute_mask_indices` function. Write a Python function `def _compute_mask_indices( shape: Tuple[int, int], mask_prob: float, mask_length: int, attention_mask: Optional[torch.LongTensor] = None, min_masks: int = 0, ) -> np.ndarray` to solve the following problem: Computes random mask spans for a given shape. Used to implement [SpecAugment: A Simple Data Augmentation Method for ASR](https://arxiv.org/abs/1904.08779). Note that this method is not optimized to run on TPU and should be run on CPU as part of the preprocessing during training. Args: shape: The shape for which to compute masks. This should be of a tuple of size 2 where the first element is the batch size and the second element is the length of the axis to span. mask_prob: The percentage of the whole axis (between 0 and 1) which will be masked. The number of independently generated mask spans of length `mask_length` is computed by `mask_prob*shape[1]/mask_length`. Note that due to overlaps, `mask_prob` is an upper bound and the actual percentage will be smaller. mask_length: size of the mask min_masks: minimum number of masked spans attention_mask: A (right-padded) attention mask which independently shortens the feature axis of each batch dimension. Here is the function: def _compute_mask_indices( shape: Tuple[int, int], mask_prob: float, mask_length: int, attention_mask: Optional[torch.LongTensor] = None, min_masks: int = 0, ) -> np.ndarray: """ Computes random mask spans for a given shape. Used to implement [SpecAugment: A Simple Data Augmentation Method for ASR](https://arxiv.org/abs/1904.08779). Note that this method is not optimized to run on TPU and should be run on CPU as part of the preprocessing during training. Args: shape: The shape for which to compute masks. This should be of a tuple of size 2 where the first element is the batch size and the second element is the length of the axis to span. mask_prob: The percentage of the whole axis (between 0 and 1) which will be masked. The number of independently generated mask spans of length `mask_length` is computed by `mask_prob*shape[1]/mask_length`. Note that due to overlaps, `mask_prob` is an upper bound and the actual percentage will be smaller. mask_length: size of the mask min_masks: minimum number of masked spans attention_mask: A (right-padded) attention mask which independently shortens the feature axis of each batch dimension. """ batch_size, sequence_length = shape if mask_length < 1: raise ValueError("`mask_length` has to be bigger than 0.") if mask_length > sequence_length: raise ValueError( f"`mask_length` has to be smaller than `sequence_length`, but got `mask_length`: {mask_length}" f" and `sequence_length`: {sequence_length}`" ) # epsilon is used for probabilistic rounding epsilon = np.random.rand(1).item() def compute_num_masked_span(input_length): """Given input length, compute how many spans should be masked""" num_masked_span = int(mask_prob * input_length / mask_length + epsilon) num_masked_span = max(num_masked_span, min_masks) # make sure num masked span <= sequence_length if num_masked_span * mask_length > sequence_length: num_masked_span = sequence_length // mask_length # make sure num_masked span is also <= input_length - (mask_length - 1) if input_length - (mask_length - 1) < num_masked_span: num_masked_span = max(input_length - (mask_length - 1), 0) return num_masked_span # compute number of masked spans in batch input_lengths = ( attention_mask.sum(-1).detach().tolist() if attention_mask is not None else [sequence_length for _ in range(batch_size)] ) # SpecAugment mask to fill spec_aug_mask = np.zeros((batch_size, sequence_length), dtype=bool) spec_aug_mask_idxs = [] max_num_masked_span = compute_num_masked_span(sequence_length) if max_num_masked_span == 0: return spec_aug_mask for input_length in input_lengths: # compute num of masked spans for this input num_masked_span = compute_num_masked_span(input_length) # get random indices to mask spec_aug_mask_idx = np.random.choice( np.arange(input_length - (mask_length - 1)), num_masked_span, replace=False ) # pick first sampled index that will serve as a dummy index to pad vector # to ensure same dimension for all batches due to probabilistic rounding # Picking first sample just pads those vectors twice. if len(spec_aug_mask_idx) == 0: # this case can only happen if `input_length` is strictly smaller then # `sequence_length` in which case the last token has to be a padding # token which we can use as a dummy mask id dummy_mask_idx = sequence_length - 1 else: dummy_mask_idx = spec_aug_mask_idx[0] spec_aug_mask_idx = np.concatenate( [spec_aug_mask_idx, np.ones(max_num_masked_span - num_masked_span, dtype=np.int32) * dummy_mask_idx] ) spec_aug_mask_idxs.append(spec_aug_mask_idx) spec_aug_mask_idxs = np.array(spec_aug_mask_idxs) # expand masked indices to masked spans spec_aug_mask_idxs = np.broadcast_to( spec_aug_mask_idxs[:, :, None], (batch_size, max_num_masked_span, mask_length) ) spec_aug_mask_idxs = spec_aug_mask_idxs.reshape(batch_size, max_num_masked_span * mask_length) # add offset to the starting indexes so that indexes now create a span offsets = np.arange(mask_length)[None, None, :] offsets = np.broadcast_to(offsets, (batch_size, max_num_masked_span, mask_length)).reshape( batch_size, max_num_masked_span * mask_length ) spec_aug_mask_idxs = spec_aug_mask_idxs + offsets # ensure that we cannot have indices larger than sequence_length if spec_aug_mask_idxs.max() > sequence_length - 1: spec_aug_mask_idxs[spec_aug_mask_idxs > sequence_length - 1] = sequence_length - 1 # scatter indices to mask np.put_along_axis(spec_aug_mask, spec_aug_mask_idxs, 1, -1) return spec_aug_mask
Computes random mask spans for a given shape. Used to implement [SpecAugment: A Simple Data Augmentation Method for ASR](https://arxiv.org/abs/1904.08779). Note that this method is not optimized to run on TPU and should be run on CPU as part of the preprocessing during training. Args: shape: The shape for which to compute masks. This should be of a tuple of size 2 where the first element is the batch size and the second element is the length of the axis to span. mask_prob: The percentage of the whole axis (between 0 and 1) which will be masked. The number of independently generated mask spans of length `mask_length` is computed by `mask_prob*shape[1]/mask_length`. Note that due to overlaps, `mask_prob` is an upper bound and the actual percentage will be smaller. mask_length: size of the mask min_masks: minimum number of masked spans attention_mask: A (right-padded) attention mask which independently shortens the feature axis of each batch dimension.
10,942
import math import warnings from dataclasses import dataclass from typing import Optional, Tuple, Union import numpy as np import torch import torch.utils.checkpoint from torch import nn from torch.nn import CrossEntropyLoss from ...activations import ACT2FN from ...deepspeed import is_deepspeed_zero3_enabled from ...modeling_outputs import ( BaseModelOutput, CausalLMOutput, MaskedLMOutput, SequenceClassifierOutput, TokenClassifierOutput, Wav2Vec2BaseModelOutput, XVectorOutput, ) from ...modeling_utils import PreTrainedModel from ...pytorch_utils import torch_int_div from ...utils import ( ModelOutput, add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward, logging, replace_return_docstrings, ) from .configuration_wav2vec2 import Wav2Vec2Config The provided code snippet includes necessary dependencies for implementing the `_sample_negative_indices` function. Write a Python function `def _sample_negative_indices( features_shape: Tuple, num_negatives: int, mask_time_indices: Optional[np.ndarray] = None )` to solve the following problem: Sample `num_negatives` vectors from feature vectors. Here is the function: def _sample_negative_indices( features_shape: Tuple, num_negatives: int, mask_time_indices: Optional[np.ndarray] = None ): """ Sample `num_negatives` vectors from feature vectors. """ batch_size, sequence_length = features_shape # generate indices of the positive vectors themselves, repeat them `num_negatives` times sequence_length_range = np.arange(sequence_length) # get `num_negatives` random vector indices from the same utterance sampled_negative_indices = np.zeros(shape=(batch_size, sequence_length, num_negatives), dtype=np.int32) mask_time_indices = ( mask_time_indices.astype(bool) if mask_time_indices is not None else np.ones(features_shape, dtype=bool) ) for batch_idx in range(batch_size): high = mask_time_indices[batch_idx].sum() - 1 mapped_masked_indices = sequence_length_range[mask_time_indices[batch_idx]] feature_indices = np.broadcast_to(np.arange(high + 1)[:, None], (high + 1, num_negatives)) sampled_indices = np.random.randint(0, high, size=(high + 1, num_negatives)) # avoid sampling the same positive vector, but keep the distribution uniform sampled_indices[sampled_indices >= feature_indices] += 1 # remap to actual indices sampled_negative_indices[batch_idx][mask_time_indices[batch_idx]] = mapped_masked_indices[sampled_indices] # correct for batch size sampled_negative_indices[batch_idx] += batch_idx * sequence_length return sampled_negative_indices
Sample `num_negatives` vectors from feature vectors.
10,943
from functools import partial from typing import Optional, Tuple, Union import numpy as np import flax import flax.linen as nn import jax import jax.numpy as jnp from flax.core.frozen_dict import FrozenDict, freeze, unfreeze from flax.linen.attention import dot_product_attention_weights from flax.traverse_util import flatten_dict, unflatten_dict from jax import lax from ...modeling_flax_outputs import FlaxBaseModelOutput, FlaxCausalLMOutput from ...modeling_flax_utils import ( ACT2FN, FlaxPreTrainedModel, append_replace_return_docstrings, overwrite_call_docstring, ) from ...utils import ModelOutput, add_start_docstrings, add_start_docstrings_to_model_forward, logging from .configuration_wav2vec2 import Wav2Vec2Config The provided code snippet includes necessary dependencies for implementing the `_compute_mask_indices` function. Write a Python function `def _compute_mask_indices( shape: Tuple[int, int], mask_prob: float, mask_length: int, attention_mask: Optional[np.ndarray] = None, min_masks: int = 0, ) -> np.ndarray` to solve the following problem: Computes random mask spans for a given shape. Used to implement [SpecAugment: A Simple Data Augmentation Method for ASR](https://arxiv.org/abs/1904.08779). Note that this method is not optimized to run on TPU and should be run on CPU as part of the preprocessing during training. Args: shape: the shape for which to compute masks. should be of size 2 where first element is batch size and 2nd is timesteps mask_prob: probability for each token to be chosen as start of the span to be masked. this will be multiplied by number of timesteps divided by length of mask span to mask approximately this percentage of all elements. however due to overlaps, the actual number will be smaller (unless no_overlap is True) mask_length: size of the mask min_masks: minimum number of masked spans Here is the function: def _compute_mask_indices( shape: Tuple[int, int], mask_prob: float, mask_length: int, attention_mask: Optional[np.ndarray] = None, min_masks: int = 0, ) -> np.ndarray: """ Computes random mask spans for a given shape. Used to implement [SpecAugment: A Simple Data Augmentation Method for ASR](https://arxiv.org/abs/1904.08779). Note that this method is not optimized to run on TPU and should be run on CPU as part of the preprocessing during training. Args: shape: the shape for which to compute masks. should be of size 2 where first element is batch size and 2nd is timesteps mask_prob: probability for each token to be chosen as start of the span to be masked. this will be multiplied by number of timesteps divided by length of mask span to mask approximately this percentage of all elements. however due to overlaps, the actual number will be smaller (unless no_overlap is True) mask_length: size of the mask min_masks: minimum number of masked spans """ batch_size, sequence_length = shape if mask_length < 1: raise ValueError("`mask_length` has to be bigger than 0.") if mask_length > sequence_length: raise ValueError( f"`mask_length` has to be smaller than `sequence_length`, but got `mask_length`: {mask_length} and" f" `sequence_length`: {sequence_length}`" ) # compute number of masked spans in batch num_masked_spans = int(mask_prob * sequence_length / mask_length + np.random.rand(1).item()) num_masked_spans = max(num_masked_spans, min_masks) # make sure num masked indices <= sequence_length if num_masked_spans * mask_length > sequence_length: num_masked_spans = sequence_length // mask_length # SpecAugment mask to fill spec_aug_mask = np.zeros((batch_size, sequence_length), dtype=bool) # get random indices to mask spec_aug_mask_idxs = np.array( [ np.random.choice(np.arange(sequence_length - (mask_length - 1)), num_masked_spans, replace=False) for _ in range(batch_size) ] ) # expand masked indices to masked spans spec_aug_mask_idxs = np.broadcast_to(spec_aug_mask_idxs[:, :, None], (batch_size, num_masked_spans, mask_length)) spec_aug_mask_idxs = spec_aug_mask_idxs.reshape(batch_size, num_masked_spans * mask_length) offsets = np.arange(mask_length)[None, None, :] offsets = np.broadcast_to(offsets, (batch_size, num_masked_spans, mask_length)).reshape( batch_size, num_masked_spans * mask_length ) spec_aug_mask_idxs = spec_aug_mask_idxs + offsets # scatter indices to mask np.put_along_axis(spec_aug_mask, spec_aug_mask_idxs, 1, -1) if attention_mask is not None: # make sure padded input ids cannot be masked spec_aug_mask = np.where(attention_mask, spec_aug_mask, False) return spec_aug_mask
Computes random mask spans for a given shape. Used to implement [SpecAugment: A Simple Data Augmentation Method for ASR](https://arxiv.org/abs/1904.08779). Note that this method is not optimized to run on TPU and should be run on CPU as part of the preprocessing during training. Args: shape: the shape for which to compute masks. should be of size 2 where first element is batch size and 2nd is timesteps mask_prob: probability for each token to be chosen as start of the span to be masked. this will be multiplied by number of timesteps divided by length of mask span to mask approximately this percentage of all elements. however due to overlaps, the actual number will be smaller (unless no_overlap is True) mask_length: size of the mask min_masks: minimum number of masked spans
10,944
from functools import partial from typing import Optional, Tuple, Union import numpy as np import flax import flax.linen as nn import jax import jax.numpy as jnp from flax.core.frozen_dict import FrozenDict, freeze, unfreeze from flax.linen.attention import dot_product_attention_weights from flax.traverse_util import flatten_dict, unflatten_dict from jax import lax from ...modeling_flax_outputs import FlaxBaseModelOutput, FlaxCausalLMOutput from ...modeling_flax_utils import ( ACT2FN, FlaxPreTrainedModel, append_replace_return_docstrings, overwrite_call_docstring, ) from ...utils import ModelOutput, add_start_docstrings, add_start_docstrings_to_model_forward, logging from .configuration_wav2vec2 import Wav2Vec2Config The provided code snippet includes necessary dependencies for implementing the `_sample_negative_indices` function. Write a Python function `def _sample_negative_indices(features_shape: Tuple, num_negatives: int, attention_mask: Optional[np.ndarray] = None)` to solve the following problem: Sample `num_negatives` vectors from feature vectors. Here is the function: def _sample_negative_indices(features_shape: Tuple, num_negatives: int, attention_mask: Optional[np.ndarray] = None): """ Sample `num_negatives` vectors from feature vectors. """ batch_size, sequence_length, hidden_size = features_shape if sequence_length <= 1: raise ValueError( "`features should have `sequence_length` > 1, but are of shape " f"(batch_size, sequence_length, hidden_size) = ({batch_size, sequence_length, hidden_size})." ) # get `num_negatives` random vector indices from the same utterance sampled_negative_indices = [] for batch_idx in range(batch_size): high = attention_mask[batch_idx].sum() - 1 if attention_mask is not None else sequence_length - 1 sampled_indices_slice = np.random.randint(0, high, size=(num_negatives * sequence_length,)) sampled_negative_indices.append(sampled_indices_slice) sampled_negative_indices = np.asarray(sampled_negative_indices, dtype=np.int32) # generate indices of the positive vectors themselves, repeat them `num_negatives` times feature_indices = np.broadcast_to(np.arange(sequence_length)[:, None], (sequence_length, num_negatives)).flatten() # avoid sampling the same positive vector, but keep the distribution uniform sampled_negative_indices[sampled_negative_indices >= feature_indices] += 1 # correct for batch size for batch_idx in range(1, batch_size): sampled_negative_indices[batch_idx] += batch_idx * sequence_length return sampled_negative_indices
Sample `num_negatives` vectors from feature vectors.
10,945
from dataclasses import asdict, dataclass from typing import Optional from ...configuration_utils import PretrainedConfig from ...utils import logging def get_default_vocab_list(): return ( "<cls>", "<pad>", "<eos>", "<unk>", "L", "A", "G", "V", "S", "E", "R", "T", "I", "D", "P", "K", "Q", "N", "F", "Y", "M", "H", "W", "C", "X", "B", "U", "Z", "O", ".", "-", "<null_1>", "<mask>", )
null
10,946
import argparse import pathlib from pathlib import Path from tempfile import TemporaryDirectory import torch import esm as esm_module from esm.esmfold.v1.pretrained import esmfold_v1 from transformers.models.esm.configuration_esm import EsmConfig, EsmFoldConfig from transformers.models.esm.modeling_esm import ( EsmForMaskedLM, EsmForSequenceClassification, EsmIntermediate, EsmLayer, EsmOutput, EsmSelfAttention, EsmSelfOutput, ) from transformers.models.esm.modeling_esmfold import EsmForProteinFolding from transformers.models.esm.tokenization_esm import EsmTokenizer from transformers.utils import logging SAMPLE_DATA = [ ("protein1", "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"), ("protein2", "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLA"), ("protein3", "MKTVRQERLKSI<mask>RILERSKEPVSGAQLAEELS<mask>SRQVIVQDIAYLRSLGYN<mask>VATPRGYVLAGG"), ("protein4", "MKTVRQERLKSI<mask>RILERSKEPVSGAQLAEELS<mask>SRQVIVQDIAYLRSLGYN<mask>VATPRGYVLA"), ] MODEL_MAPPING = { "esm1b_t33_650M_UR50S": esm_module.pretrained.esm1b_t33_650M_UR50S, "esm1v_t33_650M_UR90S_1": esm_module.pretrained.esm1v_t33_650M_UR90S_1, "esm1v_t33_650M_UR90S_2": esm_module.pretrained.esm1v_t33_650M_UR90S_2, "esm1v_t33_650M_UR90S_3": esm_module.pretrained.esm1v_t33_650M_UR90S_3, "esm1v_t33_650M_UR90S_4": esm_module.pretrained.esm1v_t33_650M_UR90S_4, "esm1v_t33_650M_UR90S_5": esm_module.pretrained.esm1v_t33_650M_UR90S_5, "esm2_t48_15B_UR50D": esm_module.pretrained.esm2_t48_15B_UR50D, "esm2_t36_3B_UR50D": esm_module.pretrained.esm2_t36_3B_UR50D, "esm2_t33_650M_UR50D": esm_module.pretrained.esm2_t33_650M_UR50D, "esm2_t30_150M_UR50D": esm_module.pretrained.esm2_t30_150M_UR50D, "esm2_t12_35M_UR50D": esm_module.pretrained.esm2_t12_35M_UR50D, "esm2_t6_8M_UR50D": esm_module.pretrained.esm2_t6_8M_UR50D, "esmfold_v1": esmfold_v1, } def transfer_and_check_weights(original_module, our_module): status = our_module.load_state_dict(original_module.state_dict()) if status.missing_keys: raise ValueError(f"Missing keys: {status.missing_keys}") if status.unexpected_keys: raise ValueError(f"Unexpected keys: {status.unexpected_keys}") The provided code snippet includes necessary dependencies for implementing the `convert_esm_checkpoint_to_pytorch` function. Write a Python function `def convert_esm_checkpoint_to_pytorch( model: str, pytorch_dump_folder_path: str, classification_head: bool, push_to_repo: str, auth_token: str )` to solve the following problem: Copy/paste/tweak esm's weights to our BERT structure. Here is the function: def convert_esm_checkpoint_to_pytorch( model: str, pytorch_dump_folder_path: str, classification_head: bool, push_to_repo: str, auth_token: str ): """ Copy/paste/tweak esm's weights to our BERT structure. """ if model.startswith("esmfold"): esm = MODEL_MAPPING[model]() alphabet = esm.esm.alphabet else: esm, alphabet = MODEL_MAPPING[model]() esm.eval() # disable dropout if model.startswith("esmfold"): embed_dim = esm.esm.embed_dim num_layers = esm.esm.num_layers num_attention_heads = esm.esm.attention_heads intermediate_size = 4 * embed_dim token_dropout = esm.esm.token_dropout emb_layer_norm_before = False # This code path does not exist in ESM-2 position_embedding_type = "rotary" is_folding_model = True esmfold_config = EsmFoldConfig() for key, val in esm.cfg.items(): if hasattr(esmfold_config, key) and key != "trunk": setattr(esmfold_config, key, val) for key, val in esm.cfg.trunk.items(): if hasattr(esmfold_config.trunk, key) and key != "structure_module": setattr(esmfold_config.trunk, key, val) for key, val in esm.cfg.trunk.structure_module.items(): if hasattr(esmfold_config.trunk.structure_module, key): setattr(esmfold_config.trunk.structure_module, key, val) elif hasattr(esm, "args"): # Indicates an ESM-1b or ESM-1v model embed_dim = esm.args.embed_dim num_layers = esm.args.layers num_attention_heads = esm.args.attention_heads intermediate_size = esm.args.ffn_embed_dim token_dropout = esm.args.token_dropout emb_layer_norm_before = True if esm.emb_layer_norm_before else False position_embedding_type = "absolute" is_folding_model = False esmfold_config = None else: # Indicates an ESM-2 model embed_dim = esm.embed_dim num_layers = esm.num_layers num_attention_heads = esm.attention_heads intermediate_size = 4 * embed_dim # This is hardcoded in ESM-2 token_dropout = esm.token_dropout emb_layer_norm_before = False # This code path does not exist in ESM-2 position_embedding_type = "rotary" is_folding_model = False esmfold_config = None vocab_list = tuple(alphabet.all_toks) if is_folding_model: original_esm_model = esm.esm else: original_esm_model = esm config = EsmConfig( vocab_size=original_esm_model.embed_tokens.num_embeddings, mask_token_id=alphabet.mask_idx, hidden_size=embed_dim, num_hidden_layers=num_layers, num_attention_heads=num_attention_heads, intermediate_size=intermediate_size, max_position_embeddings=1026, layer_norm_eps=1e-5, # PyTorch default used in fairseq attention_probs_dropout_prob=0.0, hidden_dropout_prob=0.0, pad_token_id=alphabet.padding_idx, emb_layer_norm_before=emb_layer_norm_before, token_dropout=token_dropout, position_embedding_type=position_embedding_type, is_folding_model=is_folding_model, esmfold_config=esmfold_config, vocab_list=vocab_list, ) if classification_head: config.num_labels = esm.classification_heads["mnli"].out_proj.weight.shape[0] print("Our ESM config:", config) if model.startswith("esmfold"): model_class = EsmForProteinFolding elif classification_head: model_class = EsmForSequenceClassification else: model_class = EsmForMaskedLM model = model_class(config) model.eval() # Now let's copy all the weights. # Embeddings model.esm.embeddings.word_embeddings.weight = original_esm_model.embed_tokens.weight if position_embedding_type == "absolute": model.esm.embeddings.position_embeddings.weight = original_esm_model.embed_positions.weight if config.emb_layer_norm_before: model.esm.embeddings.layer_norm.weight = original_esm_model.emb_layer_norm_before.weight model.esm.embeddings.layer_norm.bias = original_esm_model.emb_layer_norm_before.bias model.esm.encoder.emb_layer_norm_after.weight = original_esm_model.emb_layer_norm_after.weight model.esm.encoder.emb_layer_norm_after.bias = original_esm_model.emb_layer_norm_after.bias for i in range(config.num_hidden_layers): # Encoder: start of layer layer: EsmLayer = model.esm.encoder.layer[i] # esm_layer: TransformerSentenceEncoderLayer = original_esm_model.layers[i] esm_layer = original_esm_model.layers[i] # self attention self_attn: EsmSelfAttention = layer.attention.self assert ( esm_layer.self_attn.k_proj.weight.data.shape == esm_layer.self_attn.q_proj.weight.data.shape == esm_layer.self_attn.v_proj.weight.data.shape == torch.Size((config.hidden_size, config.hidden_size)) ) self_attn.query.weight.data = esm_layer.self_attn.q_proj.weight self_attn.query.bias.data = esm_layer.self_attn.q_proj.bias self_attn.key.weight.data = esm_layer.self_attn.k_proj.weight self_attn.key.bias.data = esm_layer.self_attn.k_proj.bias self_attn.value.weight.data = esm_layer.self_attn.v_proj.weight self_attn.value.bias.data = esm_layer.self_attn.v_proj.bias if getattr(esm_layer.self_attn, "rot_emb", None) is not None: # Matt: Although inv_freq is not a trainable weight, it is computed at model init and cached. # During the training of ESM-2 the model was converted to float16 precision, which also converts # the inv_freq tensor, and the loss of precision remains even if the model is loaded later as float32. # If we recompute inv_freq without this loss of precision then we will get subtly different rotary # embeddings, which are enough to cause significant discrepancies in model outputs. To avoid this, # we make sure the new model copies the data from the old inv_freq. self_attn.rotary_embeddings.inv_freq.data = esm_layer.self_attn.rot_emb.inv_freq # LayerNorm changes for pre-activation layer.attention.LayerNorm.weight = esm_layer.self_attn_layer_norm.weight layer.attention.LayerNorm.bias = esm_layer.self_attn_layer_norm.bias layer.LayerNorm.weight = esm_layer.final_layer_norm.weight layer.LayerNorm.bias = esm_layer.final_layer_norm.bias # self-attention output self_output: EsmSelfOutput = layer.attention.output assert self_output.dense.weight.shape == esm_layer.self_attn.out_proj.weight.shape self_output.dense.weight = esm_layer.self_attn.out_proj.weight self_output.dense.bias = esm_layer.self_attn.out_proj.bias # intermediate intermediate: EsmIntermediate = layer.intermediate assert intermediate.dense.weight.shape == esm_layer.fc1.weight.shape intermediate.dense.weight = esm_layer.fc1.weight intermediate.dense.bias = esm_layer.fc1.bias # output bert_output: EsmOutput = layer.output assert bert_output.dense.weight.shape == esm_layer.fc2.weight.shape bert_output.dense.weight = esm_layer.fc2.weight bert_output.dense.bias = esm_layer.fc2.bias # end of layer if is_folding_model: model.esm_s_combine.data = esm.esm_s_combine.data transfer_and_check_weights(esm.embedding, model.embedding) transfer_and_check_weights(esm.esm_s_mlp, model.esm_s_mlp) transfer_and_check_weights(esm.trunk, model.trunk) transfer_and_check_weights(esm.distogram_head, model.distogram_head) transfer_and_check_weights(esm.ptm_head, model.ptm_head) transfer_and_check_weights(esm.lm_head, model.lm_head) transfer_and_check_weights(esm.lddt_head, model.lddt_head) elif classification_head: model.classifier.dense.weight = esm.esm.classification_heads["mnli"].dense.weight model.classifier.dense.bias = esm.classification_heads["mnli"].dense.bias model.classifier.out_proj.weight = esm.classification_heads["mnli"].out_proj.weight model.classifier.out_proj.bias = esm.classification_heads["mnli"].out_proj.bias else: # LM Head model.lm_head.dense.weight = esm.lm_head.dense.weight model.lm_head.dense.bias = esm.lm_head.dense.bias model.lm_head.layer_norm.weight = esm.lm_head.layer_norm.weight model.lm_head.layer_norm.bias = esm.lm_head.layer_norm.bias model.lm_head.decoder.weight = esm.lm_head.weight model.lm_head.bias = esm.lm_head.bias # Let's check that we get the same results. batch_converter = alphabet.get_batch_converter() # Prepare data (first 2 sequences from ESMStructuralSplitDataset superfamily / 4) if is_folding_model: # Folding models aren't trained on masked inputs and don't like mask tokens. sample_data = SAMPLE_DATA[:2] else: sample_data = SAMPLE_DATA batch_labels, batch_strs, batch_tokens = batch_converter(sample_data) # Prepare tokenizer and make sure it matches with TemporaryDirectory() as tempdir: vocab = "\n".join(alphabet.all_toks) vocab_file = Path(tempdir) / "vocab.txt" vocab_file.write_text(vocab) hf_tokenizer = EsmTokenizer(vocab_file=str(vocab_file)) hf_tokens = hf_tokenizer([row[1] for row in sample_data], return_tensors="pt", padding=True) success = torch.all(hf_tokens["input_ids"] == batch_tokens) print("Do both models tokenizers output the same tokens?", "🔥" if success else "💩") if not success: raise Exception("Tokenization does not match!") with torch.no_grad(): if is_folding_model: # Let's test the model in parts # ESMFold always converts the ESM stem to float16, which requires float16 ops # that don't exist on CPU. Therefore, to test it we need to run it on GPU. However, # ESMFold is what we in the community call a "big boy" and so we desperately avoid putting both the # original and the converted model on the GPU at the same time. our_output = model.cuda()( input_ids=hf_tokens["input_ids"].cuda(), attention_mask=hf_tokens["attention_mask"].cuda() ) their_output = esm.cuda()(hf_tokens["input_ids"].cuda(), hf_tokens["attention_mask"].cuda()) else: our_output = model(**hf_tokens, output_hidden_states=True) our_output = our_output["logits"] if classification_head: their_output = esm.model.classification_heads["mnli"](esm.extract_features(batch_tokens)) else: their_output = esm(hf_tokens["input_ids"], repr_layers=list(range(999))) their_output = their_output["logits"] if is_folding_model: max_absolute_diff = torch.max(torch.abs(our_output["positions"] - their_output["positions"])).item() success = torch.allclose(our_output["positions"], their_output["positions"], atol=1e-5) else: max_absolute_diff = torch.max(torch.abs(our_output - their_output)).item() success = torch.allclose(our_output, their_output, atol=1e-5) print(f"max_absolute_diff = {max_absolute_diff}") # ~ 1e-5 print("Do both models output the same tensors?", "🔥" if success else "💩") if not success: raise Exception("Something went wRoNg") pathlib.Path(pytorch_dump_folder_path).mkdir(parents=True, exist_ok=True) print(f"Saving model to {pytorch_dump_folder_path}") model.save_pretrained(pytorch_dump_folder_path) reloaded = model_class.from_pretrained(pytorch_dump_folder_path).cuda() reloaded_output = reloaded( input_ids=hf_tokens["input_ids"].cuda(), attention_mask=hf_tokens["attention_mask"].cuda() ) if is_folding_model: max_absolute_diff = torch.max(torch.abs(our_output["positions"] - reloaded_output["positions"])).item() success = torch.allclose(our_output["positions"], their_output["positions"], atol=1e-6) else: max_absolute_diff = torch.max(torch.abs(our_output - reloaded_output["logits"])).item() success = torch.allclose(our_output, reloaded_output["logits"], atol=1e-6) print(f"max_absolute_diff = {max_absolute_diff}") print("Does the model output the same tensors after reloading?", "🔥" if success else "💩") if not success: raise Exception("Something went wRoNg") print(f"Saving tokenizer to {pytorch_dump_folder_path}") hf_tokenizer.save_pretrained(pytorch_dump_folder_path) if push_to_repo: model.push_to_hub(repo_id=push_to_repo, use_auth_token=auth_token) hf_tokenizer.push_to_hub(repo_id=push_to_repo, use_auth_token=auth_token)
Copy/paste/tweak esm's weights to our BERT structure.
10,947
import os from typing import List, Optional, Union from ...tokenization_utils import PreTrainedTokenizer from ...tokenization_utils_base import AddedToken from ...utils import logging def load_vocab_file(vocab_file): with open(vocab_file, "r") as f: lines = f.read().splitlines() return [l.strip() for l in lines]
null
10,948
from typing import Optional, Tuple, Union import numpy as np import tensorflow as tf from tensorflow.keras.activations import gelu from tensorflow.keras.layers import Dense, Dropout, Embedding, Layer, LayerNormalization from ...file_utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward from ...modeling_tf_outputs import ( TFBaseModelOutputWithPastAndCrossAttentions, TFBaseModelOutputWithPoolingAndCrossAttentions, TFMaskedLMOutput, TFSequenceClassifierOutput, TFTokenClassifierOutput, ) from ...modeling_tf_utils import ( TFMaskedLanguageModelingLoss, TFModelInputType, TFPreTrainedModel, TFSequenceClassificationLoss, TFTokenClassificationLoss, get_initializer, get_tf_activation, shape_list, unpack_inputs, ) from ...tf_utils import stable_softmax from ...utils import logging from .configuration_esm import EsmConfig def rotate_half(x): x1, x2 = tf.split(x, 2, axis=-1) return tf.concat((-x2, x1), axis=-1) def apply_rotary_pos_emb(x, cos, sin): cos = cos[:, :, : tf.shape(x)[-2], :] sin = sin[:, :, : tf.shape(x)[-2], :] return (x * cos) + (rotate_half(x) * sin)
null
10,949
from typing import Optional, Tuple, Union import numpy as np import tensorflow as tf from tensorflow.keras.activations import gelu from tensorflow.keras.layers import Dense, Dropout, Embedding, Layer, LayerNormalization from ...file_utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward from ...modeling_tf_outputs import ( TFBaseModelOutputWithPastAndCrossAttentions, TFBaseModelOutputWithPoolingAndCrossAttentions, TFMaskedLMOutput, TFSequenceClassifierOutput, TFTokenClassifierOutput, ) from ...modeling_tf_utils import ( TFMaskedLanguageModelingLoss, TFModelInputType, TFPreTrainedModel, TFSequenceClassificationLoss, TFTokenClassificationLoss, get_initializer, get_tf_activation, shape_list, unpack_inputs, ) from ...tf_utils import stable_softmax from ...utils import logging from .configuration_esm import EsmConfig The provided code snippet includes necessary dependencies for implementing the `create_position_ids_from_input_ids` function. Write a Python function `def create_position_ids_from_input_ids(input_ids, padding_idx, past_key_values_length=0)` to solve the following problem: Replace non-padding symbols with their position numbers. Position numbers begin at padding_idx+1. Padding symbols are ignored. This is modified from fairseq's `utils.make_positions`. Args: x: tf.Tensor x: Returns: tf.Tensor Here is the function: def create_position_ids_from_input_ids(input_ids, padding_idx, past_key_values_length=0): """ Replace non-padding symbols with their position numbers. Position numbers begin at padding_idx+1. Padding symbols are ignored. This is modified from fairseq's `utils.make_positions`. Args: x: tf.Tensor x: Returns: tf.Tensor """ # The series of casts and type-conversions here are carefully balanced to both work with ONNX export and XLA. mask = tf.cast(input_ids != padding_idx, tf.int64) incremental_indices = (tf.cumsum(mask, axis=1) + past_key_values_length) * mask return incremental_indices + padding_idx
Replace non-padding symbols with their position numbers. Position numbers begin at padding_idx+1. Padding symbols are ignored. This is modified from fairseq's `utils.make_positions`. Args: x: tf.Tensor x: Returns: tf.Tensor
10,950
import math from typing import List, Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...file_utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward from ...modeling_outputs import ( BaseModelOutputWithPastAndCrossAttentions, BaseModelOutputWithPoolingAndCrossAttentions, MaskedLMOutput, SequenceClassifierOutput, TokenClassifierOutput, ) from ...modeling_utils import PreTrainedModel, find_pruneable_heads_and_indices, prune_linear_layer from ...utils import logging from .configuration_esm import EsmConfig def rotate_half(x): x1, x2 = x.chunk(2, dim=-1) return torch.cat((-x2, x1), dim=-1) def apply_rotary_pos_emb(x, cos, sin): cos = cos[:, :, : x.shape[-2], :] sin = sin[:, :, : x.shape[-2], :] return (x * cos) + (rotate_half(x) * sin)
null
10,951
import math from typing import List, Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...file_utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward from ...modeling_outputs import ( BaseModelOutputWithPastAndCrossAttentions, BaseModelOutputWithPoolingAndCrossAttentions, MaskedLMOutput, SequenceClassifierOutput, TokenClassifierOutput, ) from ...modeling_utils import PreTrainedModel, find_pruneable_heads_and_indices, prune_linear_layer from ...utils import logging from .configuration_esm import EsmConfig The provided code snippet includes necessary dependencies for implementing the `gelu` function. Write a Python function `def gelu(x)` to solve the following problem: This is the gelu implementation from the original ESM repo. Using F.gelu yields subtly wrong results. Here is the function: def gelu(x): """ This is the gelu implementation from the original ESM repo. Using F.gelu yields subtly wrong results. """ return x * 0.5 * (1.0 + torch.erf(x / math.sqrt(2.0)))
This is the gelu implementation from the original ESM repo. Using F.gelu yields subtly wrong results.
10,952
import math from typing import List, Optional, Tuple, Union import torch import torch.utils.checkpoint from torch import nn from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss from ...file_utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward from ...modeling_outputs import ( BaseModelOutputWithPastAndCrossAttentions, BaseModelOutputWithPoolingAndCrossAttentions, MaskedLMOutput, SequenceClassifierOutput, TokenClassifierOutput, ) from ...modeling_utils import PreTrainedModel, find_pruneable_heads_and_indices, prune_linear_layer from ...utils import logging from .configuration_esm import EsmConfig The provided code snippet includes necessary dependencies for implementing the `create_position_ids_from_input_ids` function. Write a Python function `def create_position_ids_from_input_ids(input_ids, padding_idx, past_key_values_length=0)` to solve the following problem: Replace non-padding symbols with their position numbers. Position numbers begin at padding_idx+1. Padding symbols are ignored. This is modified from fairseq's `utils.make_positions`. Args: x: torch.Tensor x: Returns: torch.Tensor Here is the function: def create_position_ids_from_input_ids(input_ids, padding_idx, past_key_values_length=0): """ Replace non-padding symbols with their position numbers. Position numbers begin at padding_idx+1. Padding symbols are ignored. This is modified from fairseq's `utils.make_positions`. Args: x: torch.Tensor x: Returns: torch.Tensor """ # The series of casts and type-conversions here are carefully balanced to both work with ONNX export and XLA. mask = input_ids.ne(padding_idx).int() incremental_indices = (torch.cumsum(mask, dim=1).type_as(mask) + past_key_values_length) * mask return incremental_indices.long() + padding_idx
Replace non-padding symbols with their position numbers. Position numbers begin at padding_idx+1. Padding symbols are ignored. This is modified from fairseq's `utils.make_positions`. Args: x: torch.Tensor x: Returns: torch.Tensor
10,953
import math import sys from dataclasses import dataclass from functools import partial from typing import Callable, Dict, List, Optional, Sequence, Tuple, Union import numpy as np import torch import torch.nn as nn from torch.nn import LayerNorm from ...deepspeed import is_deepspeed_available from ...modeling_outputs import ModelOutput from ...utils import ( ContextManagers, add_start_docstrings, add_start_docstrings_to_model_forward, is_scipy_available, logging, replace_return_docstrings, ) from .configuration_esm import EsmConfig from .modeling_esm import ESM_START_DOCSTRING, EsmModel, EsmPreTrainedModel from .openfold_utils import ( OFProtein, Rigid, Rotation, atom14_to_atom37, chunk_layer, compute_predicted_aligned_error, compute_tm, frames_and_literature_positions_to_atom14_pos, make_atom14_masks, residue_constants, to_pdb, torsion_angles_to_frames, ) def is_fp16_enabled(): # Autocast world fp16_enabled = torch.get_autocast_gpu_dtype() == torch.float16 fp16_enabled = fp16_enabled and torch.is_autocast_enabled() return fp16_enabled
null
10,954
import math import sys from dataclasses import dataclass from functools import partial from typing import Callable, Dict, List, Optional, Sequence, Tuple, Union import numpy as np import torch import torch.nn as nn from torch.nn import LayerNorm from ...deepspeed import is_deepspeed_available from ...modeling_outputs import ModelOutput from ...utils import ( ContextManagers, add_start_docstrings, add_start_docstrings_to_model_forward, is_scipy_available, logging, replace_return_docstrings, ) from .configuration_esm import EsmConfig from .modeling_esm import ESM_START_DOCSTRING, EsmModel, EsmPreTrainedModel from .openfold_utils import ( OFProtein, Rigid, Rotation, atom14_to_atom37, chunk_layer, compute_predicted_aligned_error, compute_tm, frames_and_literature_positions_to_atom14_pos, make_atom14_masks, residue_constants, to_pdb, torsion_angles_to_frames, ) The provided code snippet includes necessary dependencies for implementing the `collate_dense_tensors` function. Write a Python function `def collate_dense_tensors(samples: List[torch.Tensor], pad_v: float = 0) -> torch.Tensor` to solve the following problem: Takes a list of tensors with the following dimensions: [(d_11, ..., d_1K), (d_21, ..., d_2K), ..., (d_N1, ..., d_NK)] and stack + pads them into a single tensor of: (N, max_i=1,N { d_i1 }, ..., max_i=1,N {diK}) Here is the function: def collate_dense_tensors(samples: List[torch.Tensor], pad_v: float = 0) -> torch.Tensor: """ Takes a list of tensors with the following dimensions: [(d_11, ..., d_1K), (d_21, ..., d_2K), ..., (d_N1, ..., d_NK)] and stack + pads them into a single tensor of: (N, max_i=1,N { d_i1 }, ..., max_i=1,N {diK}) """ if len(samples) == 0: return torch.Tensor() if len(set(x.dim() for x in samples)) != 1: raise RuntimeError(f"Samples has varying dimensions: {[x.dim() for x in samples]}") (device,) = tuple(set(x.device for x in samples)) # assumes all on same device max_shape = [max(lst) for lst in zip(*[x.shape for x in samples])] result = torch.empty(len(samples), *max_shape, dtype=samples[0].dtype, device=device) result.fill_(pad_v) for i in range(len(samples)): result_i = result[i] t = samples[i] result_i[tuple(slice(0, k) for k in t.shape)] = t return result
Takes a list of tensors with the following dimensions: [(d_11, ..., d_1K), (d_21, ..., d_2K), ..., (d_N1, ..., d_NK)] and stack + pads them into a single tensor of: (N, max_i=1,N { d_i1 }, ..., max_i=1,N {diK})
10,955
import math import sys from dataclasses import dataclass from functools import partial from typing import Callable, Dict, List, Optional, Sequence, Tuple, Union import numpy as np import torch import torch.nn as nn from torch.nn import LayerNorm from ...deepspeed import is_deepspeed_available from ...modeling_outputs import ModelOutput from ...utils import ( ContextManagers, add_start_docstrings, add_start_docstrings_to_model_forward, is_scipy_available, logging, replace_return_docstrings, ) from .configuration_esm import EsmConfig from .modeling_esm import ESM_START_DOCSTRING, EsmModel, EsmPreTrainedModel from .openfold_utils import ( OFProtein, Rigid, Rotation, atom14_to_atom37, chunk_layer, compute_predicted_aligned_error, compute_tm, frames_and_literature_positions_to_atom14_pos, make_atom14_masks, residue_constants, to_pdb, torsion_angles_to_frames, ) def flatten_final_dims(t: torch.Tensor, no_dims: int): return t.reshape(t.shape[:-no_dims] + (-1,))
null
10,956
import math import sys from dataclasses import dataclass from functools import partial from typing import Callable, Dict, List, Optional, Sequence, Tuple, Union import numpy as np import torch import torch.nn as nn from torch.nn import LayerNorm from ...deepspeed import is_deepspeed_available from ...modeling_outputs import ModelOutput from ...utils import ( ContextManagers, add_start_docstrings, add_start_docstrings_to_model_forward, is_scipy_available, logging, replace_return_docstrings, ) from .configuration_esm import EsmConfig from .modeling_esm import ESM_START_DOCSTRING, EsmModel, EsmPreTrainedModel from .openfold_utils import ( OFProtein, Rigid, Rotation, atom14_to_atom37, chunk_layer, compute_predicted_aligned_error, compute_tm, frames_and_literature_positions_to_atom14_pos, make_atom14_masks, residue_constants, to_pdb, torsion_angles_to_frames, ) def permute_final_dims(tensor: torch.Tensor, inds: List[int]): zero_index = -1 * len(inds) first_inds = list(range(len(tensor.shape[:zero_index]))) return tensor.permute(first_inds + [zero_index + i for i in inds])
null
10,957
import math import sys from dataclasses import dataclass from functools import partial from typing import Callable, Dict, List, Optional, Sequence, Tuple, Union import numpy as np import torch import torch.nn as nn from torch.nn import LayerNorm from ...deepspeed import is_deepspeed_available from ...modeling_outputs import ModelOutput from ...utils import ( ContextManagers, add_start_docstrings, add_start_docstrings_to_model_forward, is_scipy_available, logging, replace_return_docstrings, ) from .configuration_esm import EsmConfig from .modeling_esm import ESM_START_DOCSTRING, EsmModel, EsmPreTrainedModel from .openfold_utils import ( OFProtein, Rigid, Rotation, atom14_to_atom37, chunk_layer, compute_predicted_aligned_error, compute_tm, frames_and_literature_positions_to_atom14_pos, make_atom14_masks, residue_constants, to_pdb, torsion_angles_to_frames, ) def dict_multimap(fn, dicts): first = dicts[0] new_dict = {} for k, v in first.items(): all_v = [d[k] for d in dicts] if type(v) is dict: new_dict[k] = dict_multimap(fn, all_v) else: new_dict[k] = fn(all_v) return new_dict
null