uid stringlengths 6 10 | seq_fragment stringlengths 6 35 | annotation stringclasses 1
value | interpro_label int64 0 131 | correct_ipr stringclasses 129
values | correct_letter stringclasses 4
values | distractor_source stringclasses 1
value | option_a_ipr stringclasses 132
values | option_a_desc stringclasses 132
values | option_b_ipr stringclasses 132
values | option_b_desc stringclasses 132
values | option_c_ipr stringclasses 132
values | option_c_desc stringclasses 132
values | option_d_ipr stringclasses 132
values | option_d_desc stringclasses 132
values |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Q6CWS4 | DGPSAGAAI | Act | 24 | IPR008268 | B | pool | IPR020827 | Asparaginase/glutaminase, active site 1 | IPR008268 | Peptidase S16, active site | IPR018208 | Glycoside hydrolase family 11, active site 1 | IPR023011 | ATP synthase, F0 complex, subunit A, active site |
E7CIP7 | IEGDIDFVFG | Act | 122 | IPR033131 | D | pool | IPR033140 | Lipase, GDXG, putative serine active site | IPR031338 | KDPG/KHG aldolase, active site 2 | IPR018114 | Serine proteases, trypsin family, histidine active site | IPR033131 | Pectinesterase, Asp active site |
A7WPL7 | SVFKGDSGGPLL | Act | 114 | IPR033116 | A | pool | IPR033116 | Serine proteases, trypsin family, serine active site | IPR019796 | Glucose-6-phosphate dehydrogenase, active site | IPR008265 | Lipase, GDSL, active site | IPR008268 | Peptidase S16, active site |
Q6MAJ5 | PAIDPLLSWS | Act | 74 | IPR020003 | A | pool | IPR020003 | ATPase, alpha/beta subunit, nucleotide-binding domain, active site | IPR030458 | Glycosyl hydrolases family 31, active site | IPR000189 | Prokaryotic transglycosylase, active site | IPR028301 | Serine proteases, V8 family, histidine active site |
O69230 | GVHIQVTELDM | Act | 109 | IPR031158 | A | pool | IPR031158 | Glycosyl hydrolases family 10, active site | IPR033694 | Pyroglutamyl peptidase I, Cys active site | IPR018299 | Alkaline phosphatase, active site | IPR018521 | DNA topoisomerase IB, active site |
P25036 | SYVLDTGIDTEH | Act | 97 | IPR023827 | D | pool | IPR030656 | Delta-aminolevulinic acid dehydratase, active site | IPR018177 | L-lactate dehydrogenase, active site | IPR023232 | Glycoside hydrolase, family 2, active site | IPR023827 | Peptidase S8, subtilisin, Asp-active site |
P19644 | CKSVNTF | Act | 95 | IPR023411 | D | pool | IPR020625 | Schiff base-forming aldolase, active site | IPR019800 | Glycoside hydrolase, family 3, active site | IPR016130 | Protein-tyrosine phosphatase, active site | IPR023411 | Ribonuclease A, active site |
P23673 | FQSENGIVG | Act | 17 | IPR004164 | B | pool | IPR033127 | Ubiquitin-activating enzyme E1, Cys active site | IPR004164 | Coenzyme A transferase active site | IPR020615 | Thiolase, acyl-enzyme intermediate active site | IPR000138 | Hydroxymethylglutaryl-CoA lyase, active site |
P23902 | GPNYSISTACATSNYCF | Act | 49 | IPR018201 | C | pool | IPR028301 | Serine proteases, V8 family, histidine active site | IPR002071 | Thermonuclease active site | IPR018201 | Beta-ketoacyl synthase, active site | IPR019794 | Peroxidase, active site |
Q6H3D2 | CCHVHKCC | Act | 113 | IPR033113 | D | pool | IPR023828 | Peptidase S8, subtilisin, Ser-active site | IPR018524 | DNA/RNA non-specific endonuclease, active site | IPR018299 | Alkaline phosphatase, active site | IPR033113 | Phospholipase A2, histidine active site |
C0HLL2 | CCQVHDCC | Act | 113 | IPR033113 | D | pool | IPR033124 | Serine carboxypeptidases, histidine active site | IPR020827 | Asparaginase/glutaminase, active site 1 | IPR019826 | Carboxylesterase type B, active site | IPR033113 | Phospholipase A2, histidine active site |
O65595 | ILLMSKVENQEGV | Act | 53 | IPR018209 | A | pool | IPR018209 | Pyruvate kinase, active site | IPR018201 | Beta-ketoacyl synthase, active site | IPR019796 | Glucose-6-phosphate dehydrogenase, active site | IPR018274 | PEP-utilising enzyme, active site |
A0B9K2 | PSINWLDSYS | Act | 74 | IPR020003 | D | pool | IPR018088 | Chalcone/stilbene synthase, active site | IPR049165 | Glycosyl hydrolases family 39, active site | IPR022415 | ATP:guanido phosphotransferase active site | IPR020003 | ATPase, alpha/beta subunit, nucleotide-binding domain, active site |
P03955 | VLFDTGSSNLWV | Act | 12 | IPR001969 | D | pool | IPR020827 | Asparaginase/glutaminase, active site 1 | IPR018120 | Glycoside hydrolase family 1, active site | IPR016129 | Peptidase family C14A, His active site | IPR001969 | Aspartic peptidase, active site |
P03955 | AIVDTGTSLLTV | Act | 12 | IPR001969 | D | pool | IPR020827 | Asparaginase/glutaminase, active site 1 | IPR018120 | Glycoside hydrolase family 1, active site | IPR016129 | Peptidase family C14A, His active site | IPR001969 | Aspartic peptidase, active site |
Q6R2V6 | VLTAHPTQVNRR | Act | 44 | IPR018129 | D | pool | IPR018202 | Serine carboxypeptidase, serine active site | IPR018114 | Serine proteases, trypsin family, histidine active site | IPR031158 | Glycosyl hydrolases family 10, active site | IPR018129 | Phosphoenolpyruvate carboxylase, Lys active site |
O89110 | HKNKDCFICCILSHG | Act | 31 | IPR016129 | D | pool | IPR022469 | 6-pyruvoyl tetrahydropterin synthase, histidine active site | IPR008255 | Pyridine nucleotide-disulphide oxidoreductase, class-II, active site | IPR002471 | Peptidase S9, serine active site | IPR016129 | Peptidase family C14A, His active site |
Q9UNK4 | CCQTHDCC | Act | 113 | IPR033113 | B | pool | IPR004164 | Coenzyme A transferase active site | IPR033113 | Phospholipase A2, histidine active site | IPR033112 | Phospholipase A2, aspartic acid active site | IPR000138 | Hydroxymethylglutaryl-CoA lyase, active site |
Q1JPB9 | CCREHDRC | Act | 113 | IPR033113 | A | pool | IPR033113 | Phospholipase A2, histidine active site | IPR018040 | Pectinesterase, Tyr active site | IPR020878 | Ribulose bisphosphate carboxylase, large chain, active site | IPR000169 | Cysteine peptidase, cysteine active site |
O23791 | QNPCGSCWSFAA | Act | 2 | IPR000169 | B | pool | IPR033127 | Ubiquitin-activating enzyme E1, Cys active site | IPR000169 | Cysteine peptidase, cysteine active site | IPR030458 | Glycosyl hydrolases family 31, active site | IPR018510 | Diaminopimelate epimerase, active site |
O73944 | IPAYISNSAGLYLCN | Act | 130 | IPR033694 | D | pool | IPR018521 | DNA topoisomerase IB, active site | IPR016130 | Protein-tyrosine phosphatase, active site | IPR008266 | Tyrosine-protein kinase, active site | IPR033694 | Pyroglutamyl peptidase I, Cys active site |
A5D447 | TICIGQAASMAS | Act | 54 | IPR018215 | A | pool | IPR018215 | ClpP, Ser active site | IPR031158 | Glycosyl hydrolases family 10, active site | IPR018201 | Beta-ketoacyl synthase, active site | IPR018521 | DNA topoisomerase IB, active site |
P35146 | DIELFSGDANVKALVSLAEENNVYVVMSNHD | Act | 61 | IPR018508 | B | pool | IPR018053 | Glycoside hydrolase, family 32, active site | IPR018508 | 3-dehydroquinate dehydratase, active site | IPR001969 | Aspartic peptidase, active site | IPR018177 | L-lactate dehydrogenase, active site |
O59786 | IVFSAHSLPMSQVAKGDPYVY | Act | 67 | IPR019772 | A | pool | IPR019772 | Ferrochelatase, active site | IPR023013 | N-acetyl-gamma-glutamyl-phosphate reductase, active site | IPR020548 | Fructose-1,6-bisphosphatase, active site | IPR018510 | Diaminopimelate epimerase, active site |
A0A7J6K7I9 | LAHRDLKEDNFLV | Act | 26 | IPR008271 | D | pool | IPR031158 | Glycosyl hydrolases family 10, active site | IPR008270 | Glycosyl hydrolases family 25, active site | IPR011767 | Glutaredoxin active site | IPR008271 | Serine/threonine-protein kinase, active site |
B0RUE4 | DCTTNPTLV | Act | 56 | IPR018225 | C | pool | IPR000590 | Hydroxymethylglutaryl-coenzyme A synthase, active site | IPR020830 | Glyceraldehyde 3-phosphate dehydrogenase, active site | IPR018225 | Transaldolase, active site | IPR018208 | Glycoside hydrolase family 11, active site 1 |
B0RUE4 | ILIKIAATWEGIEAARQL | Act | 56 | IPR018225 | C | pool | IPR000590 | Hydroxymethylglutaryl-coenzyme A synthase, active site | IPR020830 | Glyceraldehyde 3-phosphate dehydrogenase, active site | IPR018225 | Transaldolase, active site | IPR018208 | Glycoside hydrolase family 11, active site 1 |
P00781 | VGIIDTGIAASH | Act | 97 | IPR023827 | D | pool | IPR000590 | Hydroxymethylglutaryl-coenzyme A synthase, active site | IPR001555 | Phosphoribosylglycinamide formyltransferase, active site | IPR030458 | Glycosyl hydrolases family 31, active site | IPR023827 | Peptidase S8, subtilisin, Asp-active site |
A6VX99 | LVLACTHYPLV | Act | 123 | IPR033134 | C | pool | IPR033112 | Phospholipase A2, aspartic acid active site | IPR018188 | Ribonuclease T2, His active site 1 | IPR033134 | Asp/Glu racemase, active site 2 | IPR018521 | DNA topoisomerase IB, active site |
B2J528 | GSIGASGDLVPLSYITG | Act | 84 | IPR022313 | D | pool | IPR018057 | Deoxyribonuclease I, active site | IPR001555 | Phosphoribosylglycinamide formyltransferase, active site | IPR008270 | Glycosyl hydrolases family 25, active site | IPR022313 | Phenylalanine/histidine ammonia-lyases, active site |
Q55452 | SGPLGGDTQ | Act | 45 | IPR018148 | B | pool | IPR033128 | Adenylosuccinate synthase, active site | IPR018148 | Methylglyoxal synthase, active site | IPR020610 | Thiolase, active site | IPR000138 | Hydroxymethylglutaryl-CoA lyase, active site |
O31788 | HGTHCAGDVAS | Act | 85 | IPR022398 | A | pool | IPR022398 | Peptidase S8, subtilisin, His-active site | IPR020610 | Thiolase, active site | IPR020830 | Glyceraldehyde 3-phosphate dehydrogenase, active site | IPR018209 | Pyruvate kinase, active site |
Q03ES4 | VIACNTATN | Act | 47 | IPR018187 | B | pool | IPR017440 | ATP-citrate lyase/succinyl-CoA ligase, active site | IPR018187 | Asp/Glu racemase, active site 1 | IPR023013 | N-acetyl-gamma-glutamyl-phosphate reductase, active site | IPR020615 | Thiolase, acyl-enzyme intermediate active site |
Q7VRT4 | HATTNPSLI | Act | 56 | IPR018225 | D | pool | IPR002168 | Lipase, GDXG, putative histidine active site | IPR020610 | Thiolase, active site | IPR018089 | Orotidine 5'-phosphate decarboxylase, active site | IPR018225 | Transaldolase, active site |
Q7VRT4 | VLIKIAATWEGIQAAEEL | Act | 56 | IPR018225 | D | pool | IPR002168 | Lipase, GDXG, putative histidine active site | IPR020610 | Thiolase, active site | IPR018089 | Orotidine 5'-phosphate decarboxylase, active site | IPR018225 | Transaldolase, active site |
Q12326 | ILRHGQSELN | Act | 7 | IPR001345 | B | pool | IPR030390 | RNA methyltransferase TrmA, active site | IPR001345 | Phosphoglycerate/bisphosphoglycerate mutase, active site | IPR018057 | Deoxyribonuclease I, active site | IPR033130 | Ribonuclease T2, His active site 2 |
P32834 | LTLDTGSPYTWV | Act | 12 | IPR001969 | D | pool | IPR018085 | Uracil-DNA glycosylase, active site | IPR019826 | Carboxylesterase type B, active site | IPR017950 | Urease active site | IPR001969 | Aspartic peptidase, active site |
Q2V4L8 | YPDQRDDYTRSEPATYINA | Act | 117 | IPR033126 | A | pool | IPR033126 | Glycosyl hydrolases family 9, Asp/Glu active sites | IPR030475 | Ribonucleotide reductase small subunit, acitve site | IPR018188 | Ribonuclease T2, His active site 1 | IPR031338 | KDPG/KHG aldolase, active site 2 |
P44454 | KRIVGKGGDRVIF | Act | 66 | IPR019757 | D | pool | IPR019756 | Peptidase S26A, signal peptidase I, serine active site | IPR033694 | Pyroglutamyl peptidase I, Cys active site | IPR017950 | Urease active site | IPR019757 | Peptidase S26A, signal peptidase I, lysine active site |
O13340 | LDLDTGSSDLWV | Act | 12 | IPR001969 | C | pool | IPR033119 | Glycoside hydrolase family 11, active site 2 | IPR008259 | FMN-dependent alpha-hydroxy acid dehydrogenase, active site | IPR001969 | Aspartic peptidase, active site | IPR018129 | Phosphoenolpyruvate carboxylase, Lys active site |
O13340 | GISDTGTTLLYL | Act | 12 | IPR001969 | C | pool | IPR033119 | Glycoside hydrolase family 11, active site 2 | IPR008259 | FMN-dependent alpha-hydroxy acid dehydrogenase, active site | IPR001969 | Aspartic peptidase, active site | IPR018129 | Phosphoenolpyruvate carboxylase, Lys active site |
D3ZZ07 | QGGCGACWAFSV | Act | 2 | IPR000169 | C | pool | IPR025660 | Cysteine peptidase, histidine active site | IPR008255 | Pyridine nucleotide-disulphide oxidoreductase, class-II, active site | IPR000169 | Cysteine peptidase, cysteine active site | IPR018510 | Diaminopimelate epimerase, active site |
A5IUQ0 | PAINAGQSVS | Act | 74 | IPR020003 | B | pool | IPR031158 | Glycosyl hydrolases family 10, active site | IPR020003 | ATPase, alpha/beta subunit, nucleotide-binding domain, active site | IPR008259 | FMN-dependent alpha-hydroxy acid dehydrogenase, active site | IPR020827 | Asparaginase/glutaminase, active site 1 |
O26802 | IISTGGTVA | Act | 79 | IPR020827 | D | pool | IPR018201 | Beta-ketoacyl synthase, active site | IPR018177 | L-lactate dehydrogenase, active site | IPR027475 | Asparaginase/glutaminase, active site 2 | IPR020827 | Asparaginase/glutaminase, active site 1 |
A8NDT2 | GIGPAYSGKASR | Act | 119 | IPR033128 | D | pool | IPR017950 | Urease active site | IPR023827 | Peptidase S8, subtilisin, Asp-active site | IPR000189 | Prokaryotic transglycosylase, active site | IPR033128 | Adenylosuccinate synthase, active site |
A0RKC7 | NNDGSEGKSCGNGLR | Act | 62 | IPR018510 | B | pool | IPR008266 | Tyrosine-protein kinase, active site | IPR018510 | Diaminopimelate epimerase, active site | IPR018372 | Chloramphenicol acetyltransferase, active site | IPR000590 | Hydroxymethylglutaryl-coenzyme A synthase, active site |
Q9JXT8 | MLADTGTDIVLI | Act | 12 | IPR001969 | C | pool | IPR033119 | Glycoside hydrolase family 11, active site 2 | IPR019796 | Glucose-6-phosphate dehydrogenase, active site | IPR001969 | Aspartic peptidase, active site | IPR017950 | Urease active site |
Q3ECS3 | TYITENGVA | Act | 43 | IPR018120 | B | pool | IPR008268 | Peptidase S16, active site | IPR018120 | Glycoside hydrolase family 1, active site | IPR013808 | Transglutaminase, active site | IPR018201 | Beta-ketoacyl synthase, active site |
A7IGM0 | GLDFVKDDE | Act | 82 | IPR020878 | D | pool | IPR018521 | DNA topoisomerase IB, active site | IPR028301 | Serine proteases, V8 family, histidine active site | IPR020003 | ATPase, alpha/beta subunit, nucleotide-binding domain, active site | IPR020878 | Ribulose bisphosphate carboxylase, large chain, active site |
Q06HQ7 | VAAVGDSLTAG | Act | 22 | IPR008265 | B | pool | IPR018215 | ClpP, Ser active site | IPR008265 | Lipase, GDSL, active site | IPR033379 | Histidine acid phosphatase active site | IPR027475 | Asparaginase/glutaminase, active site 2 |
P06181 | AHESIRLVFHDS | Act | 69 | IPR019794 | A | pool | IPR019794 | Peroxidase, active site | IPR033139 | Peptidase family C14A, cysteine active site | IPR033131 | Pectinesterase, Asp active site | IPR020861 | Triosephosphate isomerase, active site |
A0A0A1EQ07 | IIYFHGGGFVLFNADST | Act | 15 | IPR002168 | D | pool | IPR018299 | Alkaline phosphatase, active site | IPR018202 | Serine carboxypeptidase, serine active site | IPR023313 | Ubiquitin-conjugating enzyme, active site | IPR002168 | Lipase, GDXG, putative histidine active site |
A0A649V088 | RFPMCSTSKVMAAAAV | Act | 96 | IPR023650 | B | pool | IPR008263 | Glycoside hydrolase, family 16, active site | IPR023650 | Beta-lactamase, class-A active site | IPR008255 | Pyridine nucleotide-disulphide oxidoreductase, class-II, active site | IPR030475 | Ribonucleotide reductase small subunit, acitve site |
Q5G291 | CCQVHCNC | Act | 113 | IPR033113 | D | pool | IPR020861 | Triosephosphate isomerase, active site | IPR019796 | Glucose-6-phosphate dehydrogenase, active site | IPR018299 | Alkaline phosphatase, active site | IPR033113 | Phospholipase A2, histidine active site |
B7SIW2 | GVEVAITELDI | Act | 109 | IPR031158 | C | pool | IPR033131 | Pectinesterase, Asp active site | IPR018274 | PEP-utilising enzyme, active site | IPR031158 | Glycosyl hydrolases family 10, active site | IPR008255 | Pyridine nucleotide-disulphide oxidoreductase, class-II, active site |
Q6KHE2 | DPARRGLEEDIIELILKLKPQKIIYLSCNVGT | Act | 105 | IPR030390 | D | pool | IPR000180 | Membrane dipeptidase, active site | IPR049165 | Glycosyl hydrolases family 39, active site | IPR018117 | DNA methylase, C-5 cytosine-specific, active site | IPR030390 | RNA methyltransferase TrmA, active site |
A0QWX9 | LLIKIPATMAGLPAISAV | Act | 56 | IPR018225 | C | pool | IPR033693 | Pyroglutamyl peptidase I, Glu active site | IPR033127 | Ubiquitin-activating enzyme E1, Cys active site | IPR018225 | Transaldolase, active site | IPR012999 | Pyridine nucleotide-disulphide oxidoreductase, class I, active site |
P24791 | IQGDTDFIFG | Act | 122 | IPR033131 | B | pool | IPR020830 | Glyceraldehyde 3-phosphate dehydrogenase, active site | IPR033131 | Pectinesterase, Asp active site | IPR018215 | ClpP, Ser active site | IPR023313 | Ubiquitin-conjugating enzyme, active site |
P17721 | ASCTTNSI | Act | 80 | IPR020830 | B | pool | IPR016129 | Peptidase family C14A, His active site | IPR020830 | Glyceraldehyde 3-phosphate dehydrogenase, active site | IPR020878 | Ribulose bisphosphate carboxylase, large chain, active site | IPR023828 | Peptidase S8, subtilisin, Ser-active site |
P00736 | DACQGDSGGVFA | Act | 114 | IPR033116 | B | pool | IPR033112 | Phospholipase A2, aspartic acid active site | IPR033116 | Serine proteases, trypsin family, serine active site | IPR001555 | Phosphoribosylglycinamide formyltransferase, active site | IPR030475 | Ribonucleotide reductase small subunit, acitve site |
A0AJS8 | GVTIMYMVEKLDAGDMISQRKIPI | Act | 9 | IPR001555 | B | pool | IPR018225 | Transaldolase, active site | IPR001555 | Phosphoribosylglycinamide formyltransferase, active site | IPR000180 | Membrane dipeptidase, active site | IPR020610 | Thiolase, active site |
P80929 | CKDTNTF | Act | 95 | IPR023411 | D | pool | IPR002071 | Thermonuclease active site | IPR018524 | DNA/RNA non-specific endonuclease, active site | IPR020625 | Schiff base-forming aldolase, active site | IPR023411 | Ribonuclease A, active site |
Q7NEW2 | TMCVGLAASMGS | Act | 54 | IPR018215 | B | pool | IPR023828 | Peptidase S8, subtilisin, Ser-active site | IPR018215 | ClpP, Ser active site | IPR019794 | Peroxidase, active site | IPR033131 | Pectinesterase, Asp active site |
P50382 | LELGIPPKYAKYDG | Act | 51 | IPR018204 | D | pool | IPR033129 | Phosphoenolpyruvate carboxylase, His active site | IPR033134 | Asp/Glu racemase, active site 2 | IPR001345 | Phosphoglycerate/bisphosphoglycerate mutase, active site | IPR018204 | Tryptophan synthase, alpha chain, active site |
Q54ET3 | LAHRDIKPGNIVL | Act | 26 | IPR008271 | A | pool | IPR008271 | Serine/threonine-protein kinase, active site | IPR028301 | Serine proteases, V8 family, histidine active site | IPR020548 | Fructose-1,6-bisphosphatase, active site | IPR023411 | Ribonuclease A, active site |
G0R947 | VAVEGWGGSGSA | Act | 115 | IPR033119 | B | pool | IPR018085 | Uracil-DNA glycosylase, active site | IPR033119 | Glycoside hydrolase family 11, active site 2 | IPR020830 | Glyceraldehyde 3-phosphate dehydrogenase, active site | IPR020827 | Asparaginase/glutaminase, active site 1 |
B0JH56 | GKLRLIYETAPLA | Act | 75 | IPR020548 | A | pool | IPR020548 | Fructose-1,6-bisphosphatase, active site | IPR023650 | Beta-lactamase, class-A active site | IPR020878 | Ribulose bisphosphate carboxylase, large chain, active site | IPR018225 | Transaldolase, active site |
Q8I430 | VCIIDTGIDENH | Act | 97 | IPR023827 | C | pool | IPR033124 | Serine carboxypeptidases, histidine active site | IPR000169 | Cysteine peptidase, cysteine active site | IPR023827 | Peptidase S8, subtilisin, Asp-active site | IPR004164 | Coenzyme A transferase active site |
P27043 | CKSLNTF | Act | 95 | IPR023411 | A | pool | IPR023411 | Ribonuclease A, active site | IPR033116 | Serine proteases, trypsin family, serine active site | IPR008268 | Peptidase S16, active site | IPR033130 | Ribonuclease T2, His active site 2 |
A2WXB2 | GKLRVLYEVFPMS | Act | 75 | IPR020548 | D | pool | IPR033135 | ClpP, histidine active site | IPR008272 | 4-hydroxybenzoyl-CoA thioesterase, active site | IPR023411 | Ribonuclease A, active site | IPR020548 | Fructose-1,6-bisphosphatase, active site |
P33252 | PAIHVGLSVS | Act | 74 | IPR020003 | B | pool | IPR033126 | Glycosyl hydrolases family 9, Asp/Glu active sites | IPR020003 | ATPase, alpha/beta subunit, nucleotide-binding domain, active site | IPR018225 | Transaldolase, active site | IPR018188 | Ribonuclease T2, His active site 1 |
P04056 | VCACDAAAAKC | Act | 112 | IPR033112 | D | pool | IPR018208 | Glycoside hydrolase family 11, active site 1 | IPR018177 | L-lactate dehydrogenase, active site | IPR020615 | Thiolase, acyl-enzyme intermediate active site | IPR033112 | Phospholipase A2, aspartic acid active site |
O67475 | QESVHAYSYQFILESVV | Act | 107 | IPR030475 | B | pool | IPR018114 | Serine proteases, trypsin family, histidine active site | IPR030475 | Ribonucleotide reductase small subunit, acitve site | IPR018521 | DNA topoisomerase IB, active site | IPR033126 | Glycosyl hydrolases family 9, Asp/Glu active sites |
A2R3L3 | AIADTGTTLILL | Act | 12 | IPR001969 | D | pool | IPR020625 | Schiff base-forming aldolase, active site | IPR029759 | Glutathione peroxidase active site | IPR018204 | Tryptophan synthase, alpha chain, active site | IPR001969 | Aspartic peptidase, active site |
P15115 | ASCTTICL | Act | 80 | IPR020830 | A | pool | IPR020830 | Glyceraldehyde 3-phosphate dehydrogenase, active site | IPR020878 | Ribulose bisphosphate carboxylase, large chain, active site | IPR000590 | Hydroxymethylglutaryl-coenzyme A synthase, active site | IPR023828 | Peptidase S8, subtilisin, Ser-active site |
A3DCX5 | GITTMYTDAGMDTGDMLLKAEIEI | Act | 9 | IPR001555 | D | pool | IPR030656 | Delta-aminolevulinic acid dehydratase, active site | IPR033139 | Peptidase family C14A, cysteine active site | IPR018053 | Glycoside hydrolase, family 32, active site | IPR001555 | Phosphoribosylglycinamide formyltransferase, active site |
P15467 | GQMNCHE | Act | 95 | IPR023411 | C | pool | IPR020615 | Thiolase, acyl-enzyme intermediate active site | IPR023013 | N-acetyl-gamma-glutamyl-phosphate reductase, active site | IPR023411 | Ribonuclease A, active site | IPR019800 | Glycoside hydrolase, family 3, active site |
Q8VYV9 | VALDTGSDLFWL | Act | 12 | IPR001969 | C | pool | IPR023005 | Nucleoside diphosphate kinase, active site | IPR019796 | Glucose-6-phosphate dehydrogenase, active site | IPR001969 | Aspartic peptidase, active site | IPR022415 | ATP:guanido phosphotransferase active site |
Q8VYV9 | AVFDSGTSFTYL | Act | 12 | IPR001969 | C | pool | IPR023005 | Nucleoside diphosphate kinase, active site | IPR019796 | Glucose-6-phosphate dehydrogenase, active site | IPR001969 | Aspartic peptidase, active site | IPR022415 | ATP:guanido phosphotransferase active site |
Q8FS11 | GATTNPAII | Act | 56 | IPR018225 | B | pool | IPR004164 | Coenzyme A transferase active site | IPR018225 | Transaldolase, active site | IPR000126 | Serine proteases, V8 family, serine active site | IPR020940 | Thymidylate synthase, active site |
A0A0R0HPY5 | IIHRDVKSNNILL | Act | 26 | IPR008271 | C | pool | IPR023406 | DNA topoisomerase, type IA, active site | IPR006650 | Adenosine/AMP deaminase active site | IPR008271 | Serine/threonine-protein kinase, active site | IPR018120 | Glycoside hydrolase family 1, active site |
C0HKC1 | CCFVHKCC | Act | 113 | IPR033113 | C | pool | IPR018209 | Pyruvate kinase, active site | IPR008271 | Serine/threonine-protein kinase, active site | IPR033113 | Phospholipase A2, histidine active site | IPR019779 | Galactose-1-phosphate uridyl transferase, class I His-active site |
Q9MB58 | LTRHGESMDN | Act | 7 | IPR001345 | B | pool | IPR023232 | Glycoside hydrolase, family 2, active site | IPR001345 | Phosphoglycerate/bisphosphoglycerate mutase, active site | IPR018508 | 3-dehydroquinate dehydratase, active site | IPR019756 | Peptidase S26A, signal peptidase I, serine active site |
P37427 | SETIHSRSYTHIIRNIV | Act | 107 | IPR030475 | C | pool | IPR022470 | 6-pyruvoyl tetrahydropterin synthase, cysteine active site | IPR019796 | Glucose-6-phosphate dehydrogenase, active site | IPR030475 | Ribonucleotide reductase small subunit, acitve site | IPR024708 | Catalase active site |
P29523 | VPDSSCTAT | Act | 59 | IPR018299 | B | pool | IPR018117 | DNA methylase, C-5 cytosine-specific, active site | IPR018299 | Alkaline phosphatase, active site | IPR020625 | Schiff base-forming aldolase, active site | IPR028301 | Serine proteases, V8 family, histidine active site |
O29592 | IIHGDITPMNLIL | Act | 23 | IPR008266 | C | pool | IPR031337 | KDPG/KHG aldolase, active site 1 | IPR023005 | Nucleoside diphosphate kinase, active site | IPR008266 | Tyrosine-protein kinase, active site | IPR018085 | Uracil-DNA glycosylase, active site |
A0KQR3 | DPPRAGLDDATVKLVQDYDNILYISCNPET | Act | 105 | IPR030390 | C | pool | IPR008255 | Pyridine nucleotide-disulphide oxidoreductase, class-II, active site | IPR033116 | Serine proteases, trypsin family, serine active site | IPR030390 | RNA methyltransferase TrmA, active site | IPR023313 | Ubiquitin-conjugating enzyme, active site |
B9KGY6 | NCVHGSDSL | Act | 89 | IPR023005 | A | pool | IPR023005 | Nucleoside diphosphate kinase, active site | IPR018274 | PEP-utilising enzyme, active site | IPR018201 | Beta-ketoacyl synthase, active site | IPR000126 | Serine proteases, V8 family, serine active site |
P30374 | CKSFNTF | Act | 95 | IPR023411 | A | pool | IPR023411 | Ribonuclease A, active site | IPR018225 | Transaldolase, active site | IPR017440 | ATP-citrate lyase/succinyl-CoA ligase, active site | IPR033129 | Phosphoenolpyruvate carboxylase, His active site |
C5FGX1 | IATESYGG | Act | 50 | IPR018202 | A | pool | IPR018202 | Serine carboxypeptidase, serine active site | IPR002137 | Beta-lactamase, class-D active site | IPR001969 | Aspartic peptidase, active site | IPR013808 | Transglutaminase, active site |
P43478 | EIDVVELTQKSA | Act | 21 | IPR008263 | A | pool | IPR008263 | Glycoside hydrolase, family 16, active site | IPR018129 | Phosphoenolpyruvate carboxylase, Lys active site | IPR030458 | Glycosyl hydrolases family 31, active site | IPR023406 | DNA topoisomerase, type IA, active site |
Q54RF5 | IQIISKIENVEGV | Act | 53 | IPR018209 | B | pool | IPR018114 | Serine proteases, trypsin family, histidine active site | IPR018209 | Pyruvate kinase, active site | IPR002071 | Thermonuclease active site | IPR020610 | Thiolase, active site |
Q9F234 | GIWNDMNE | Act | 106 | IPR030458 | D | pool | IPR033140 | Lipase, GDXG, putative serine active site | IPR000180 | Membrane dipeptidase, active site | IPR018510 | Diaminopimelate epimerase, active site | IPR030458 | Glycosyl hydrolases family 31, active site |
A1R2V3 | IFTAHPTEASRR | Act | 44 | IPR018129 | B | pool | IPR001969 | Aspartic peptidase, active site | IPR018129 | Phosphoenolpyruvate carboxylase, Lys active site | IPR018239 | NAD-dependent DNA ligase, active site | IPR033126 | Glycosyl hydrolases family 9, Asp/Glu active sites |
Q01957 | LNHEVCAVGYG | Act | 100 | IPR025660 | C | pool | IPR033139 | Peptidase family C14A, cysteine active site | IPR033135 | ClpP, histidine active site | IPR025660 | Cysteine peptidase, histidine active site | IPR018177 | L-lactate dehydrogenase, active site |
Q9YB01 | EELYLEALISYPRTN | Act | 94 | IPR023406 | A | pool | IPR023406 | DNA topoisomerase, type IA, active site | IPR019826 | Carboxylesterase type B, active site | IPR033139 | Peptidase family C14A, cysteine active site | IPR018221 | Glycoside hydrolase family 9, His active site |
G8BAW7 | GPIKTPVGACATAVESV | Act | 49 | IPR018201 | A | pool | IPR018201 | Beta-ketoacyl synthase, active site | IPR016129 | Peptidase family C14A, His active site | IPR017440 | ATP-citrate lyase/succinyl-CoA ligase, active site | IPR018521 | DNA topoisomerase IB, active site |
A0A060S684 | FGGDKNRVTLFGQSAG | Act | 73 | IPR019826 | A | pool | IPR019826 | Carboxylesterase type B, active site | IPR033128 | Adenylosuccinate synthase, active site | IPR020878 | Ribulose bisphosphate carboxylase, large chain, active site | IPR001555 | Phosphoribosylglycinamide formyltransferase, active site |
P9WGC6 | GFTAPEGKTMGHAG | Act | 33 | IPR017440 | B | pool | IPR018208 | Glycoside hydrolase family 11, active site 1 | IPR017440 | ATP-citrate lyase/succinyl-CoA ligase, active site | IPR008259 | FMN-dependent alpha-hydroxy acid dehydrogenase, active site | IPR018202 | Serine carboxypeptidase, serine active site |
Q01109 | LLYLHGGSYALGSPQSH | Act | 15 | IPR002168 | A | pool | IPR002168 | Lipase, GDXG, putative histidine active site | IPR018239 | NAD-dependent DNA ligase, active site | IPR033127 | Ubiquitin-activating enzyme E1, Cys active site | IPR020861 | Triosephosphate isomerase, active site |
VenusX Fragment MCQ — Act (MF50)
4-choice multiple-choice question reformulation of the VenusX Fragment-level Act sub-task from the paper VenusX: Unlocking Fine-Grained Functional Understanding of Proteins (ICLR 2026).
This fork adapts the original N-way classification task into a 4-choice MCQ so that zero-shot LLMs can be evaluated fairly. The original task required the model to output one of 132 InterPro class labels—infeasible for a CausalLM that cannot know which IPR IDs are in the benchmark's label subspace.
Schema
Each sample is one multiple-choice question with exactly one correct answer.
| Field | Type | Description |
|---|---|---|
uid |
str | Original VenusX sample UID |
seq_fragment |
str | The protein fragment amino acid sequence |
annotation |
str | "Act" (sub-task name) |
interpro_label |
int | Original VenusX integer label (preserved for compatibility) |
correct_ipr |
str | The correct InterPro accession (e.g. IPR000169) |
correct_letter |
str | "A" / "B" / "C" / "D" — the letter whose option matches correct_ipr |
option_{a,b,c,d}_ipr |
str | InterPro accession for each option |
option_{a,b,c,d}_desc |
str | Human-readable description from InterPro entry.list |
distractor_source |
str | How the 3 distractors were picked: hierarchy, mixed, or pool (see below) |
How the MCQ is constructed
For each sample, we start with one golden InterPro ID (the original label) and pick 3 distractors via a 2-tier fallback:
- Tier 1 — InterPro hierarchy siblings: If the golden IPR is in the InterPro hierarchy tree, take true siblings (same parent, not the golden itself, not any ancestor/descendant of the golden). We use up to 3.
- Tier 2 — Same sub-task label pool (random): Fill the remaining slots by random sampling from the full label pool of the same sub-task, excluding the golden, all its ancestors/descendants, and any Tier 1 picks.
All 4 options (1 golden + 3 distractors) are then shuffled to randomize
letter positions (A/B/C/D), using a deterministic per-sample seed derived
from {annotation}:{split}:{uid}:{golden} so every dataset build is
bit-identical and reviewers can independently verify each MCQ.
The distractor_source column records which strategy was used:
hierarchy— all 3 distractors are InterPro siblingsmixed— some are siblings, some are random pool samplespool— all 3 are random pool samples (most common forActive_site/Binding_site/Conserved_sitetypes, which have no InterPro hierarchy per EBI convention)
Why descriptions are included
The original free-text task expected the LLM to directly output an IPR ID like
IPR019757. This is unfair because the LLM has no way to know which specific
IPRs are in the benchmark's small label subspace. Our MCQ format exposes the
4 candidate options with human-readable names (e.g.
IPR019757 — Peptidase S26A, signal peptidase I, lysine active site) so that
the LLM can use its biological knowledge to match the fragment's features
against the candidate functional descriptions.
Example
Fragment: IHCIAGLGRTP
A) IPR033694 — Pyroglutamyl peptidase I, Cys active site
B) IPR023411 — Ribonuclease A, active site
C) IPR016130 — Protein-tyrosine phosphatase, active site ← correct
D) IPR000169 — Cysteine peptidase, cysteine active site
[ANSWER]C[/ANSWER]
Build Reproducibility
This dataset is fully reproducible from the included build scripts and reference files:
scripts/
parse_interpro.py # Parses InterPro flat files into a queryable cache
build_mcq.py # Builds MCQ samples with 2-tier distractor fallback
reference/
entry.list # InterPro entries dump (downloaded 2026-04-09)
ParentChildTreeFile.txt # InterPro hierarchy tree (downloaded 2026-04-09)
label_pool.json # Union label pool across all 5 sub-tasks
To rebuild:
# 1. Refresh InterPro flat files (optional — pinned versions included)
curl -O https://ftp.ebi.ac.uk/pub/databases/interpro/current_release/entry.list
curl -O https://ftp.ebi.ac.uk/pub/databases/interpro/current_release/ParentChildTreeFile.txt
# 2. Parse into cache
python scripts/parse_interpro.py
# 3. Build MCQ (loads original VenusX Fragment datasets from AI4Protein/*)
python scripts/build_mcq.py
Known Limitations
Distractors are automatically generated, not peer-reviewed. Unlike MMLU or MedMCQA whose distractors are human-written by exam boards, our distractors come from random sampling / hierarchy traversal. Some may be too easy (e.g. a completely unrelated domain for a specific active site), inflating accuracy.
InterPro hierarchy coverage is low for
Active_site,Binding_site,Conserved_site, andRepeatentry types — EBI does not arrange these into hierarchies. As a result, Tier 1 (sibling-based) distractors only apply to a minority of samples (seedistractor_sourcecolumn for each sample's strategy).Random baseline is 25% (not 1/N of the original label space). Accuracy numbers from this MCQ benchmark should be interpreted against this 25% baseline, not the paper's full-label-space accuracy.
interpro_labelfield is preserved for traceability but not used in MCQ scoring. MCQ scoring comparespred_lettertocorrect_letter.Not comparable to VenusX paper Table 4 numbers. The paper reports ESM2 probe accuracy on the full label space; we report LLM accuracy on a 4-way MCQ. Same metric name (ACC), different semantics.
Citation
If you use this MCQ-reformulated dataset, please cite both the original VenusX paper and this fork:
@inproceedings{venusx2026,
title={VenusX: Unlocking Fine-Grained Functional Understanding of Proteins},
author={Tan, Yang and others},
booktitle={ICLR},
year={2026},
url={https://arxiv.org/abs/2505.11812}
}
References
The MCQ reformulation methodology draws from the following literature:
- Hendrycks et al., Measuring Massive Multitask Language Understanding (MMLU), ICLR 2021
- Pal et al., MedMCQA: A Large-scale Multi-Subject Multi-Choice Dataset for Medical domain Question Answering, CHIL 2022. https://arxiv.org/abs/2203.14371
- El-Sanyoury et al., Automatic distractor generation in multiple-choice questions: a systematic literature review, PeerJ Computer Science 2024. https://pmc.ncbi.nlm.nih.gov/articles/PMC11623049/
- Susanti, Iida & Tokunaga, Automatic Generation of English Vocabulary Tests (WordNet-based distractor), CSEDU 2015
- Gene Ontology sibling negatives: Frontiers in Genetics 2020, BMC Bioinformatics 2009
License
Derived from VenusX (AI4Protein). InterPro data is licensed CC-BY-4.0 from EMBL-EBI. This fork is released under CC-BY-4.0.
Contact
Built by hauser7733 as part of the SiEval evaluation framework. Questions or issues: open an issue at the SiEval repo.
- Downloads last month
- 10