uid stringlengths 6 10 | seq_fragment stringlengths 6 35 | annotation stringclasses 1
value | interpro_label int64 0 131 | correct_ipr stringclasses 129
values | correct_letter stringclasses 4
values | distractor_source stringclasses 1
value | option_a_ipr stringclasses 132
values | option_a_desc stringclasses 132
values | option_b_ipr stringclasses 132
values | option_b_desc stringclasses 132
values | option_c_ipr stringclasses 132
values | option_c_desc stringclasses 132
values | option_d_ipr stringclasses 132
values | option_d_desc stringclasses 132
values |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Q6CWS4 | DGPSAGAAI | Act | 24 | IPR008268 | B | pool | IPR020827 | Asparaginase/glutaminase, active site 1 | IPR008268 | Peptidase S16, active site | IPR018208 | Glycoside hydrolase family 11, active site 1 | IPR023011 | ATP synthase, F0 complex, subunit A, active site |
E7CIP7 | IEGDIDFVFG | Act | 122 | IPR033131 | D | pool | IPR033140 | Lipase, GDXG, putative serine active site | IPR031338 | KDPG/KHG aldolase, active site 2 | IPR018114 | Serine proteases, trypsin family, histidine active site | IPR033131 | Pectinesterase, Asp active site |
A7WPL7 | SVFKGDSGGPLL | Act | 114 | IPR033116 | A | pool | IPR033116 | Serine proteases, trypsin family, serine active site | IPR019796 | Glucose-6-phosphate dehydrogenase, active site | IPR008265 | Lipase, GDSL, active site | IPR008268 | Peptidase S16, active site |
Q6MAJ5 | PAIDPLLSWS | Act | 74 | IPR020003 | A | pool | IPR020003 | ATPase, alpha/beta subunit, nucleotide-binding domain, active site | IPR030458 | Glycosyl hydrolases family 31, active site | IPR000189 | Prokaryotic transglycosylase, active site | IPR028301 | Serine proteases, V8 family, histidine active site |
O69230 | GVHIQVTELDM | Act | 109 | IPR031158 | A | pool | IPR031158 | Glycosyl hydrolases family 10, active site | IPR033694 | Pyroglutamyl peptidase I, Cys active site | IPR018299 | Alkaline phosphatase, active site | IPR018521 | DNA topoisomerase IB, active site |
P25036 | SYVLDTGIDTEH | Act | 97 | IPR023827 | D | pool | IPR030656 | Delta-aminolevulinic acid dehydratase, active site | IPR018177 | L-lactate dehydrogenase, active site | IPR023232 | Glycoside hydrolase, family 2, active site | IPR023827 | Peptidase S8, subtilisin, Asp-active site |
P19644 | CKSVNTF | Act | 95 | IPR023411 | D | pool | IPR020625 | Schiff base-forming aldolase, active site | IPR019800 | Glycoside hydrolase, family 3, active site | IPR016130 | Protein-tyrosine phosphatase, active site | IPR023411 | Ribonuclease A, active site |
P23673 | FQSENGIVG | Act | 17 | IPR004164 | B | pool | IPR033127 | Ubiquitin-activating enzyme E1, Cys active site | IPR004164 | Coenzyme A transferase active site | IPR020615 | Thiolase, acyl-enzyme intermediate active site | IPR000138 | Hydroxymethylglutaryl-CoA lyase, active site |
P23902 | GPNYSISTACATSNYCF | Act | 49 | IPR018201 | C | pool | IPR028301 | Serine proteases, V8 family, histidine active site | IPR002071 | Thermonuclease active site | IPR018201 | Beta-ketoacyl synthase, active site | IPR019794 | Peroxidase, active site |
Q6H3D2 | CCHVHKCC | Act | 113 | IPR033113 | D | pool | IPR023828 | Peptidase S8, subtilisin, Ser-active site | IPR018524 | DNA/RNA non-specific endonuclease, active site | IPR018299 | Alkaline phosphatase, active site | IPR033113 | Phospholipase A2, histidine active site |
C0HLL2 | CCQVHDCC | Act | 113 | IPR033113 | D | pool | IPR033124 | Serine carboxypeptidases, histidine active site | IPR020827 | Asparaginase/glutaminase, active site 1 | IPR019826 | Carboxylesterase type B, active site | IPR033113 | Phospholipase A2, histidine active site |
O65595 | ILLMSKVENQEGV | Act | 53 | IPR018209 | A | pool | IPR018209 | Pyruvate kinase, active site | IPR018201 | Beta-ketoacyl synthase, active site | IPR019796 | Glucose-6-phosphate dehydrogenase, active site | IPR018274 | PEP-utilising enzyme, active site |
A0B9K2 | PSINWLDSYS | Act | 74 | IPR020003 | D | pool | IPR018088 | Chalcone/stilbene synthase, active site | IPR049165 | Glycosyl hydrolases family 39, active site | IPR022415 | ATP:guanido phosphotransferase active site | IPR020003 | ATPase, alpha/beta subunit, nucleotide-binding domain, active site |
P03955 | VLFDTGSSNLWV | Act | 12 | IPR001969 | D | pool | IPR020827 | Asparaginase/glutaminase, active site 1 | IPR018120 | Glycoside hydrolase family 1, active site | IPR016129 | Peptidase family C14A, His active site | IPR001969 | Aspartic peptidase, active site |
P03955 | AIVDTGTSLLTV | Act | 12 | IPR001969 | D | pool | IPR020827 | Asparaginase/glutaminase, active site 1 | IPR018120 | Glycoside hydrolase family 1, active site | IPR016129 | Peptidase family C14A, His active site | IPR001969 | Aspartic peptidase, active site |
Q6R2V6 | VLTAHPTQVNRR | Act | 44 | IPR018129 | D | pool | IPR018202 | Serine carboxypeptidase, serine active site | IPR018114 | Serine proteases, trypsin family, histidine active site | IPR031158 | Glycosyl hydrolases family 10, active site | IPR018129 | Phosphoenolpyruvate carboxylase, Lys active site |
O89110 | HKNKDCFICCILSHG | Act | 31 | IPR016129 | D | pool | IPR022469 | 6-pyruvoyl tetrahydropterin synthase, histidine active site | IPR008255 | Pyridine nucleotide-disulphide oxidoreductase, class-II, active site | IPR002471 | Peptidase S9, serine active site | IPR016129 | Peptidase family C14A, His active site |
Q9UNK4 | CCQTHDCC | Act | 113 | IPR033113 | B | pool | IPR004164 | Coenzyme A transferase active site | IPR033113 | Phospholipase A2, histidine active site | IPR033112 | Phospholipase A2, aspartic acid active site | IPR000138 | Hydroxymethylglutaryl-CoA lyase, active site |
Q1JPB9 | CCREHDRC | Act | 113 | IPR033113 | A | pool | IPR033113 | Phospholipase A2, histidine active site | IPR018040 | Pectinesterase, Tyr active site | IPR020878 | Ribulose bisphosphate carboxylase, large chain, active site | IPR000169 | Cysteine peptidase, cysteine active site |
O23791 | QNPCGSCWSFAA | Act | 2 | IPR000169 | B | pool | IPR033127 | Ubiquitin-activating enzyme E1, Cys active site | IPR000169 | Cysteine peptidase, cysteine active site | IPR030458 | Glycosyl hydrolases family 31, active site | IPR018510 | Diaminopimelate epimerase, active site |
O73944 | IPAYISNSAGLYLCN | Act | 130 | IPR033694 | D | pool | IPR018521 | DNA topoisomerase IB, active site | IPR016130 | Protein-tyrosine phosphatase, active site | IPR008266 | Tyrosine-protein kinase, active site | IPR033694 | Pyroglutamyl peptidase I, Cys active site |
A5D447 | TICIGQAASMAS | Act | 54 | IPR018215 | A | pool | IPR018215 | ClpP, Ser active site | IPR031158 | Glycosyl hydrolases family 10, active site | IPR018201 | Beta-ketoacyl synthase, active site | IPR018521 | DNA topoisomerase IB, active site |
P35146 | DIELFSGDANVKALVSLAEENNVYVVMSNHD | Act | 61 | IPR018508 | B | pool | IPR018053 | Glycoside hydrolase, family 32, active site | IPR018508 | 3-dehydroquinate dehydratase, active site | IPR001969 | Aspartic peptidase, active site | IPR018177 | L-lactate dehydrogenase, active site |
O59786 | IVFSAHSLPMSQVAKGDPYVY | Act | 67 | IPR019772 | A | pool | IPR019772 | Ferrochelatase, active site | IPR023013 | N-acetyl-gamma-glutamyl-phosphate reductase, active site | IPR020548 | Fructose-1,6-bisphosphatase, active site | IPR018510 | Diaminopimelate epimerase, active site |
A0A7J6K7I9 | LAHRDLKEDNFLV | Act | 26 | IPR008271 | D | pool | IPR031158 | Glycosyl hydrolases family 10, active site | IPR008270 | Glycosyl hydrolases family 25, active site | IPR011767 | Glutaredoxin active site | IPR008271 | Serine/threonine-protein kinase, active site |
B0RUE4 | DCTTNPTLV | Act | 56 | IPR018225 | C | pool | IPR000590 | Hydroxymethylglutaryl-coenzyme A synthase, active site | IPR020830 | Glyceraldehyde 3-phosphate dehydrogenase, active site | IPR018225 | Transaldolase, active site | IPR018208 | Glycoside hydrolase family 11, active site 1 |
B0RUE4 | ILIKIAATWEGIEAARQL | Act | 56 | IPR018225 | C | pool | IPR000590 | Hydroxymethylglutaryl-coenzyme A synthase, active site | IPR020830 | Glyceraldehyde 3-phosphate dehydrogenase, active site | IPR018225 | Transaldolase, active site | IPR018208 | Glycoside hydrolase family 11, active site 1 |
P00781 | VGIIDTGIAASH | Act | 97 | IPR023827 | D | pool | IPR000590 | Hydroxymethylglutaryl-coenzyme A synthase, active site | IPR001555 | Phosphoribosylglycinamide formyltransferase, active site | IPR030458 | Glycosyl hydrolases family 31, active site | IPR023827 | Peptidase S8, subtilisin, Asp-active site |
A6VX99 | LVLACTHYPLV | Act | 123 | IPR033134 | C | pool | IPR033112 | Phospholipase A2, aspartic acid active site | IPR018188 | Ribonuclease T2, His active site 1 | IPR033134 | Asp/Glu racemase, active site 2 | IPR018521 | DNA topoisomerase IB, active site |
B2J528 | GSIGASGDLVPLSYITG | Act | 84 | IPR022313 | D | pool | IPR018057 | Deoxyribonuclease I, active site | IPR001555 | Phosphoribosylglycinamide formyltransferase, active site | IPR008270 | Glycosyl hydrolases family 25, active site | IPR022313 | Phenylalanine/histidine ammonia-lyases, active site |
Q55452 | SGPLGGDTQ | Act | 45 | IPR018148 | B | pool | IPR033128 | Adenylosuccinate synthase, active site | IPR018148 | Methylglyoxal synthase, active site | IPR020610 | Thiolase, active site | IPR000138 | Hydroxymethylglutaryl-CoA lyase, active site |
O31788 | HGTHCAGDVAS | Act | 85 | IPR022398 | A | pool | IPR022398 | Peptidase S8, subtilisin, His-active site | IPR020610 | Thiolase, active site | IPR020830 | Glyceraldehyde 3-phosphate dehydrogenase, active site | IPR018209 | Pyruvate kinase, active site |
Q03ES4 | VIACNTATN | Act | 47 | IPR018187 | B | pool | IPR017440 | ATP-citrate lyase/succinyl-CoA ligase, active site | IPR018187 | Asp/Glu racemase, active site 1 | IPR023013 | N-acetyl-gamma-glutamyl-phosphate reductase, active site | IPR020615 | Thiolase, acyl-enzyme intermediate active site |
Q7VRT4 | HATTNPSLI | Act | 56 | IPR018225 | D | pool | IPR002168 | Lipase, GDXG, putative histidine active site | IPR020610 | Thiolase, active site | IPR018089 | Orotidine 5'-phosphate decarboxylase, active site | IPR018225 | Transaldolase, active site |
Q7VRT4 | VLIKIAATWEGIQAAEEL | Act | 56 | IPR018225 | D | pool | IPR002168 | Lipase, GDXG, putative histidine active site | IPR020610 | Thiolase, active site | IPR018089 | Orotidine 5'-phosphate decarboxylase, active site | IPR018225 | Transaldolase, active site |
Q12326 | ILRHGQSELN | Act | 7 | IPR001345 | B | pool | IPR030390 | RNA methyltransferase TrmA, active site | IPR001345 | Phosphoglycerate/bisphosphoglycerate mutase, active site | IPR018057 | Deoxyribonuclease I, active site | IPR033130 | Ribonuclease T2, His active site 2 |
P32834 | LTLDTGSPYTWV | Act | 12 | IPR001969 | D | pool | IPR018085 | Uracil-DNA glycosylase, active site | IPR019826 | Carboxylesterase type B, active site | IPR017950 | Urease active site | IPR001969 | Aspartic peptidase, active site |
Q2V4L8 | YPDQRDDYTRSEPATYINA | Act | 117 | IPR033126 | A | pool | IPR033126 | Glycosyl hydrolases family 9, Asp/Glu active sites | IPR030475 | Ribonucleotide reductase small subunit, acitve site | IPR018188 | Ribonuclease T2, His active site 1 | IPR031338 | KDPG/KHG aldolase, active site 2 |
P44454 | KRIVGKGGDRVIF | Act | 66 | IPR019757 | D | pool | IPR019756 | Peptidase S26A, signal peptidase I, serine active site | IPR033694 | Pyroglutamyl peptidase I, Cys active site | IPR017950 | Urease active site | IPR019757 | Peptidase S26A, signal peptidase I, lysine active site |
O13340 | LDLDTGSSDLWV | Act | 12 | IPR001969 | C | pool | IPR033119 | Glycoside hydrolase family 11, active site 2 | IPR008259 | FMN-dependent alpha-hydroxy acid dehydrogenase, active site | IPR001969 | Aspartic peptidase, active site | IPR018129 | Phosphoenolpyruvate carboxylase, Lys active site |
O13340 | GISDTGTTLLYL | Act | 12 | IPR001969 | C | pool | IPR033119 | Glycoside hydrolase family 11, active site 2 | IPR008259 | FMN-dependent alpha-hydroxy acid dehydrogenase, active site | IPR001969 | Aspartic peptidase, active site | IPR018129 | Phosphoenolpyruvate carboxylase, Lys active site |
D3ZZ07 | QGGCGACWAFSV | Act | 2 | IPR000169 | C | pool | IPR025660 | Cysteine peptidase, histidine active site | IPR008255 | Pyridine nucleotide-disulphide oxidoreductase, class-II, active site | IPR000169 | Cysteine peptidase, cysteine active site | IPR018510 | Diaminopimelate epimerase, active site |
A5IUQ0 | PAINAGQSVS | Act | 74 | IPR020003 | B | pool | IPR031158 | Glycosyl hydrolases family 10, active site | IPR020003 | ATPase, alpha/beta subunit, nucleotide-binding domain, active site | IPR008259 | FMN-dependent alpha-hydroxy acid dehydrogenase, active site | IPR020827 | Asparaginase/glutaminase, active site 1 |
O26802 | IISTGGTVA | Act | 79 | IPR020827 | D | pool | IPR018201 | Beta-ketoacyl synthase, active site | IPR018177 | L-lactate dehydrogenase, active site | IPR027475 | Asparaginase/glutaminase, active site 2 | IPR020827 | Asparaginase/glutaminase, active site 1 |
A8NDT2 | GIGPAYSGKASR | Act | 119 | IPR033128 | D | pool | IPR017950 | Urease active site | IPR023827 | Peptidase S8, subtilisin, Asp-active site | IPR000189 | Prokaryotic transglycosylase, active site | IPR033128 | Adenylosuccinate synthase, active site |
A0RKC7 | NNDGSEGKSCGNGLR | Act | 62 | IPR018510 | B | pool | IPR008266 | Tyrosine-protein kinase, active site | IPR018510 | Diaminopimelate epimerase, active site | IPR018372 | Chloramphenicol acetyltransferase, active site | IPR000590 | Hydroxymethylglutaryl-coenzyme A synthase, active site |
Q9JXT8 | MLADTGTDIVLI | Act | 12 | IPR001969 | C | pool | IPR033119 | Glycoside hydrolase family 11, active site 2 | IPR019796 | Glucose-6-phosphate dehydrogenase, active site | IPR001969 | Aspartic peptidase, active site | IPR017950 | Urease active site |
Q3ECS3 | TYITENGVA | Act | 43 | IPR018120 | B | pool | IPR008268 | Peptidase S16, active site | IPR018120 | Glycoside hydrolase family 1, active site | IPR013808 | Transglutaminase, active site | IPR018201 | Beta-ketoacyl synthase, active site |
A7IGM0 | GLDFVKDDE | Act | 82 | IPR020878 | D | pool | IPR018521 | DNA topoisomerase IB, active site | IPR028301 | Serine proteases, V8 family, histidine active site | IPR020003 | ATPase, alpha/beta subunit, nucleotide-binding domain, active site | IPR020878 | Ribulose bisphosphate carboxylase, large chain, active site |
Q06HQ7 | VAAVGDSLTAG | Act | 22 | IPR008265 | B | pool | IPR018215 | ClpP, Ser active site | IPR008265 | Lipase, GDSL, active site | IPR033379 | Histidine acid phosphatase active site | IPR027475 | Asparaginase/glutaminase, active site 2 |
P06181 | AHESIRLVFHDS | Act | 69 | IPR019794 | A | pool | IPR019794 | Peroxidase, active site | IPR033139 | Peptidase family C14A, cysteine active site | IPR033131 | Pectinesterase, Asp active site | IPR020861 | Triosephosphate isomerase, active site |
A0A0A1EQ07 | IIYFHGGGFVLFNADST | Act | 15 | IPR002168 | D | pool | IPR018299 | Alkaline phosphatase, active site | IPR018202 | Serine carboxypeptidase, serine active site | IPR023313 | Ubiquitin-conjugating enzyme, active site | IPR002168 | Lipase, GDXG, putative histidine active site |
A0A649V088 | RFPMCSTSKVMAAAAV | Act | 96 | IPR023650 | B | pool | IPR008263 | Glycoside hydrolase, family 16, active site | IPR023650 | Beta-lactamase, class-A active site | IPR008255 | Pyridine nucleotide-disulphide oxidoreductase, class-II, active site | IPR030475 | Ribonucleotide reductase small subunit, acitve site |
Q5G291 | CCQVHCNC | Act | 113 | IPR033113 | D | pool | IPR020861 | Triosephosphate isomerase, active site | IPR019796 | Glucose-6-phosphate dehydrogenase, active site | IPR018299 | Alkaline phosphatase, active site | IPR033113 | Phospholipase A2, histidine active site |
B7SIW2 | GVEVAITELDI | Act | 109 | IPR031158 | C | pool | IPR033131 | Pectinesterase, Asp active site | IPR018274 | PEP-utilising enzyme, active site | IPR031158 | Glycosyl hydrolases family 10, active site | IPR008255 | Pyridine nucleotide-disulphide oxidoreductase, class-II, active site |
Q6KHE2 | DPARRGLEEDIIELILKLKPQKIIYLSCNVGT | Act | 105 | IPR030390 | D | pool | IPR000180 | Membrane dipeptidase, active site | IPR049165 | Glycosyl hydrolases family 39, active site | IPR018117 | DNA methylase, C-5 cytosine-specific, active site | IPR030390 | RNA methyltransferase TrmA, active site |
A0QWX9 | LLIKIPATMAGLPAISAV | Act | 56 | IPR018225 | C | pool | IPR033693 | Pyroglutamyl peptidase I, Glu active site | IPR033127 | Ubiquitin-activating enzyme E1, Cys active site | IPR018225 | Transaldolase, active site | IPR012999 | Pyridine nucleotide-disulphide oxidoreductase, class I, active site |
P24791 | IQGDTDFIFG | Act | 122 | IPR033131 | B | pool | IPR020830 | Glyceraldehyde 3-phosphate dehydrogenase, active site | IPR033131 | Pectinesterase, Asp active site | IPR018215 | ClpP, Ser active site | IPR023313 | Ubiquitin-conjugating enzyme, active site |
P17721 | ASCTTNSI | Act | 80 | IPR020830 | B | pool | IPR016129 | Peptidase family C14A, His active site | IPR020830 | Glyceraldehyde 3-phosphate dehydrogenase, active site | IPR020878 | Ribulose bisphosphate carboxylase, large chain, active site | IPR023828 | Peptidase S8, subtilisin, Ser-active site |
P00736 | DACQGDSGGVFA | Act | 114 | IPR033116 | B | pool | IPR033112 | Phospholipase A2, aspartic acid active site | IPR033116 | Serine proteases, trypsin family, serine active site | IPR001555 | Phosphoribosylglycinamide formyltransferase, active site | IPR030475 | Ribonucleotide reductase small subunit, acitve site |
A0AJS8 | GVTIMYMVEKLDAGDMISQRKIPI | Act | 9 | IPR001555 | B | pool | IPR018225 | Transaldolase, active site | IPR001555 | Phosphoribosylglycinamide formyltransferase, active site | IPR000180 | Membrane dipeptidase, active site | IPR020610 | Thiolase, active site |
P80929 | CKDTNTF | Act | 95 | IPR023411 | D | pool | IPR002071 | Thermonuclease active site | IPR018524 | DNA/RNA non-specific endonuclease, active site | IPR020625 | Schiff base-forming aldolase, active site | IPR023411 | Ribonuclease A, active site |
Q7NEW2 | TMCVGLAASMGS | Act | 54 | IPR018215 | B | pool | IPR023828 | Peptidase S8, subtilisin, Ser-active site | IPR018215 | ClpP, Ser active site | IPR019794 | Peroxidase, active site | IPR033131 | Pectinesterase, Asp active site |
P50382 | LELGIPPKYAKYDG | Act | 51 | IPR018204 | D | pool | IPR033129 | Phosphoenolpyruvate carboxylase, His active site | IPR033134 | Asp/Glu racemase, active site 2 | IPR001345 | Phosphoglycerate/bisphosphoglycerate mutase, active site | IPR018204 | Tryptophan synthase, alpha chain, active site |
Q54ET3 | LAHRDIKPGNIVL | Act | 26 | IPR008271 | A | pool | IPR008271 | Serine/threonine-protein kinase, active site | IPR028301 | Serine proteases, V8 family, histidine active site | IPR020548 | Fructose-1,6-bisphosphatase, active site | IPR023411 | Ribonuclease A, active site |
G0R947 | VAVEGWGGSGSA | Act | 115 | IPR033119 | B | pool | IPR018085 | Uracil-DNA glycosylase, active site | IPR033119 | Glycoside hydrolase family 11, active site 2 | IPR020830 | Glyceraldehyde 3-phosphate dehydrogenase, active site | IPR020827 | Asparaginase/glutaminase, active site 1 |
B0JH56 | GKLRLIYETAPLA | Act | 75 | IPR020548 | A | pool | IPR020548 | Fructose-1,6-bisphosphatase, active site | IPR023650 | Beta-lactamase, class-A active site | IPR020878 | Ribulose bisphosphate carboxylase, large chain, active site | IPR018225 | Transaldolase, active site |
Q8I430 | VCIIDTGIDENH | Act | 97 | IPR023827 | C | pool | IPR033124 | Serine carboxypeptidases, histidine active site | IPR000169 | Cysteine peptidase, cysteine active site | IPR023827 | Peptidase S8, subtilisin, Asp-active site | IPR004164 | Coenzyme A transferase active site |
P27043 | CKSLNTF | Act | 95 | IPR023411 | A | pool | IPR023411 | Ribonuclease A, active site | IPR033116 | Serine proteases, trypsin family, serine active site | IPR008268 | Peptidase S16, active site | IPR033130 | Ribonuclease T2, His active site 2 |
A2WXB2 | GKLRVLYEVFPMS | Act | 75 | IPR020548 | D | pool | IPR033135 | ClpP, histidine active site | IPR008272 | 4-hydroxybenzoyl-CoA thioesterase, active site | IPR023411 | Ribonuclease A, active site | IPR020548 | Fructose-1,6-bisphosphatase, active site |
P33252 | PAIHVGLSVS | Act | 74 | IPR020003 | B | pool | IPR033126 | Glycosyl hydrolases family 9, Asp/Glu active sites | IPR020003 | ATPase, alpha/beta subunit, nucleotide-binding domain, active site | IPR018225 | Transaldolase, active site | IPR018188 | Ribonuclease T2, His active site 1 |
P04056 | VCACDAAAAKC | Act | 112 | IPR033112 | D | pool | IPR018208 | Glycoside hydrolase family 11, active site 1 | IPR018177 | L-lactate dehydrogenase, active site | IPR020615 | Thiolase, acyl-enzyme intermediate active site | IPR033112 | Phospholipase A2, aspartic acid active site |
O67475 | QESVHAYSYQFILESVV | Act | 107 | IPR030475 | B | pool | IPR018114 | Serine proteases, trypsin family, histidine active site | IPR030475 | Ribonucleotide reductase small subunit, acitve site | IPR018521 | DNA topoisomerase IB, active site | IPR033126 | Glycosyl hydrolases family 9, Asp/Glu active sites |
A2R3L3 | AIADTGTTLILL | Act | 12 | IPR001969 | D | pool | IPR020625 | Schiff base-forming aldolase, active site | IPR029759 | Glutathione peroxidase active site | IPR018204 | Tryptophan synthase, alpha chain, active site | IPR001969 | Aspartic peptidase, active site |
P15115 | ASCTTICL | Act | 80 | IPR020830 | A | pool | IPR020830 | Glyceraldehyde 3-phosphate dehydrogenase, active site | IPR020878 | Ribulose bisphosphate carboxylase, large chain, active site | IPR000590 | Hydroxymethylglutaryl-coenzyme A synthase, active site | IPR023828 | Peptidase S8, subtilisin, Ser-active site |
A3DCX5 | GITTMYTDAGMDTGDMLLKAEIEI | Act | 9 | IPR001555 | D | pool | IPR030656 | Delta-aminolevulinic acid dehydratase, active site | IPR033139 | Peptidase family C14A, cysteine active site | IPR018053 | Glycoside hydrolase, family 32, active site | IPR001555 | Phosphoribosylglycinamide formyltransferase, active site |
P15467 | GQMNCHE | Act | 95 | IPR023411 | C | pool | IPR020615 | Thiolase, acyl-enzyme intermediate active site | IPR023013 | N-acetyl-gamma-glutamyl-phosphate reductase, active site | IPR023411 | Ribonuclease A, active site | IPR019800 | Glycoside hydrolase, family 3, active site |
Q8VYV9 | VALDTGSDLFWL | Act | 12 | IPR001969 | C | pool | IPR023005 | Nucleoside diphosphate kinase, active site | IPR019796 | Glucose-6-phosphate dehydrogenase, active site | IPR001969 | Aspartic peptidase, active site | IPR022415 | ATP:guanido phosphotransferase active site |
Q8VYV9 | AVFDSGTSFTYL | Act | 12 | IPR001969 | C | pool | IPR023005 | Nucleoside diphosphate kinase, active site | IPR019796 | Glucose-6-phosphate dehydrogenase, active site | IPR001969 | Aspartic peptidase, active site | IPR022415 | ATP:guanido phosphotransferase active site |
Q8FS11 | GATTNPAII | Act | 56 | IPR018225 | B | pool | IPR004164 | Coenzyme A transferase active site | IPR018225 | Transaldolase, active site | IPR000126 | Serine proteases, V8 family, serine active site | IPR020940 | Thymidylate synthase, active site |
A0A0R0HPY5 | IIHRDVKSNNILL | Act | 26 | IPR008271 | C | pool | IPR023406 | DNA topoisomerase, type IA, active site | IPR006650 | Adenosine/AMP deaminase active site | IPR008271 | Serine/threonine-protein kinase, active site | IPR018120 | Glycoside hydrolase family 1, active site |
C0HKC1 | CCFVHKCC | Act | 113 | IPR033113 | C | pool | IPR018209 | Pyruvate kinase, active site | IPR008271 | Serine/threonine-protein kinase, active site | IPR033113 | Phospholipase A2, histidine active site | IPR019779 | Galactose-1-phosphate uridyl transferase, class I His-active site |
Q9MB58 | LTRHGESMDN | Act | 7 | IPR001345 | B | pool | IPR023232 | Glycoside hydrolase, family 2, active site | IPR001345 | Phosphoglycerate/bisphosphoglycerate mutase, active site | IPR018508 | 3-dehydroquinate dehydratase, active site | IPR019756 | Peptidase S26A, signal peptidase I, serine active site |
P37427 | SETIHSRSYTHIIRNIV | Act | 107 | IPR030475 | C | pool | IPR022470 | 6-pyruvoyl tetrahydropterin synthase, cysteine active site | IPR019796 | Glucose-6-phosphate dehydrogenase, active site | IPR030475 | Ribonucleotide reductase small subunit, acitve site | IPR024708 | Catalase active site |
P29523 | VPDSSCTAT | Act | 59 | IPR018299 | B | pool | IPR018117 | DNA methylase, C-5 cytosine-specific, active site | IPR018299 | Alkaline phosphatase, active site | IPR020625 | Schiff base-forming aldolase, active site | IPR028301 | Serine proteases, V8 family, histidine active site |
O29592 | IIHGDITPMNLIL | Act | 23 | IPR008266 | C | pool | IPR031337 | KDPG/KHG aldolase, active site 1 | IPR023005 | Nucleoside diphosphate kinase, active site | IPR008266 | Tyrosine-protein kinase, active site | IPR018085 | Uracil-DNA glycosylase, active site |
A0KQR3 | DPPRAGLDDATVKLVQDYDNILYISCNPET | Act | 105 | IPR030390 | C | pool | IPR008255 | Pyridine nucleotide-disulphide oxidoreductase, class-II, active site | IPR033116 | Serine proteases, trypsin family, serine active site | IPR030390 | RNA methyltransferase TrmA, active site | IPR023313 | Ubiquitin-conjugating enzyme, active site |
B9KGY6 | NCVHGSDSL | Act | 89 | IPR023005 | A | pool | IPR023005 | Nucleoside diphosphate kinase, active site | IPR018274 | PEP-utilising enzyme, active site | IPR018201 | Beta-ketoacyl synthase, active site | IPR000126 | Serine proteases, V8 family, serine active site |
P30374 | CKSFNTF | Act | 95 | IPR023411 | A | pool | IPR023411 | Ribonuclease A, active site | IPR018225 | Transaldolase, active site | IPR017440 | ATP-citrate lyase/succinyl-CoA ligase, active site | IPR033129 | Phosphoenolpyruvate carboxylase, His active site |
C5FGX1 | IATESYGG | Act | 50 | IPR018202 | A | pool | IPR018202 | Serine carboxypeptidase, serine active site | IPR002137 | Beta-lactamase, class-D active site | IPR001969 | Aspartic peptidase, active site | IPR013808 | Transglutaminase, active site |
P43478 | EIDVVELTQKSA | Act | 21 | IPR008263 | A | pool | IPR008263 | Glycoside hydrolase, family 16, active site | IPR018129 | Phosphoenolpyruvate carboxylase, Lys active site | IPR030458 | Glycosyl hydrolases family 31, active site | IPR023406 | DNA topoisomerase, type IA, active site |
Q54RF5 | IQIISKIENVEGV | Act | 53 | IPR018209 | B | pool | IPR018114 | Serine proteases, trypsin family, histidine active site | IPR018209 | Pyruvate kinase, active site | IPR002071 | Thermonuclease active site | IPR020610 | Thiolase, active site |
Q9F234 | GIWNDMNE | Act | 106 | IPR030458 | D | pool | IPR033140 | Lipase, GDXG, putative serine active site | IPR000180 | Membrane dipeptidase, active site | IPR018510 | Diaminopimelate epimerase, active site | IPR030458 | Glycosyl hydrolases family 31, active site |
A1R2V3 | IFTAHPTEASRR | Act | 44 | IPR018129 | B | pool | IPR001969 | Aspartic peptidase, active site | IPR018129 | Phosphoenolpyruvate carboxylase, Lys active site | IPR018239 | NAD-dependent DNA ligase, active site | IPR033126 | Glycosyl hydrolases family 9, Asp/Glu active sites |
Q01957 | LNHEVCAVGYG | Act | 100 | IPR025660 | C | pool | IPR033139 | Peptidase family C14A, cysteine active site | IPR033135 | ClpP, histidine active site | IPR025660 | Cysteine peptidase, histidine active site | IPR018177 | L-lactate dehydrogenase, active site |
Q9YB01 | EELYLEALISYPRTN | Act | 94 | IPR023406 | A | pool | IPR023406 | DNA topoisomerase, type IA, active site | IPR019826 | Carboxylesterase type B, active site | IPR033139 | Peptidase family C14A, cysteine active site | IPR018221 | Glycoside hydrolase family 9, His active site |
G8BAW7 | GPIKTPVGACATAVESV | Act | 49 | IPR018201 | A | pool | IPR018201 | Beta-ketoacyl synthase, active site | IPR016129 | Peptidase family C14A, His active site | IPR017440 | ATP-citrate lyase/succinyl-CoA ligase, active site | IPR018521 | DNA topoisomerase IB, active site |
A0A060S684 | FGGDKNRVTLFGQSAG | Act | 73 | IPR019826 | A | pool | IPR019826 | Carboxylesterase type B, active site | IPR033128 | Adenylosuccinate synthase, active site | IPR020878 | Ribulose bisphosphate carboxylase, large chain, active site | IPR001555 | Phosphoribosylglycinamide formyltransferase, active site |
P9WGC6 | GFTAPEGKTMGHAG | Act | 33 | IPR017440 | B | pool | IPR018208 | Glycoside hydrolase family 11, active site 1 | IPR017440 | ATP-citrate lyase/succinyl-CoA ligase, active site | IPR008259 | FMN-dependent alpha-hydroxy acid dehydrogenase, active site | IPR018202 | Serine carboxypeptidase, serine active site |
Q01109 | LLYLHGGSYALGSPQSH | Act | 15 | IPR002168 | A | pool | IPR002168 | Lipase, GDXG, putative histidine active site | IPR018239 | NAD-dependent DNA ligase, active site | IPR033127 | Ubiquitin-activating enzyme E1, Cys active site | IPR020861 | Triosephosphate isomerase, active site |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.