uid stringlengths 6 10 | seq_fragment stringlengths 4 100 | annotation stringclasses 1
value | interpro_label int64 0 75 | correct_ipr stringclasses 76
values | correct_letter stringclasses 4
values | distractor_source stringclasses 1
value | option_a_ipr stringclasses 76
values | option_a_desc stringclasses 76
values | option_b_ipr stringclasses 76
values | option_b_desc stringclasses 76
values | option_c_ipr stringclasses 76
values | option_c_desc stringclasses 76
values | option_d_ipr stringclasses 76
values | option_d_desc stringclasses 76
values |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
P49621 | DTDGNGFLDSSEL | BindI | 35 | IPR018247 | D | pool | IPR013516 | Phytochrome chromophore binding site | IPR015887 | DNA glycosylase/AP lyase, zinc finger domain, DNA-binding site | IPR018194 | Nickel-dependent hydrogenase, large subunit, nickel binding site | IPR018247 | EF-Hand 1, calcium-binding site |
P49621 | DYDRDGTVSLEEW | BindI | 35 | IPR018247 | D | pool | IPR013516 | Phytochrome chromophore binding site | IPR015887 | DNA glycosylase/AP lyase, zinc finger domain, DNA-binding site | IPR018194 | Nickel-dependent hydrogenase, large subunit, nickel binding site | IPR018247 | EF-Hand 1, calcium-binding site |
Q90YK7 | DQDQSDFIEEEEL | BindI | 35 | IPR018247 | D | pool | IPR018246 | AP endonuclease 2, zinc binding site | IPR018527 | Rubredoxin, iron-binding site | IPR001216 | Cysteine synthase/cystathionine beta-synthase, pyridoxal-phosphate attachment site | IPR018247 | EF-Hand 1, calcium-binding site |
F4J0W4 | DLDNDGALQPAEL | BindI | 35 | IPR018247 | D | pool | IPR028871 | Blue (type 1) copper protein, binding site | IPR018220 | Adenylosuccinate synthase, GTP-binding site | IPR019843 | DNA polymerase family X, binding site | IPR018247 | EF-Hand 1, calcium-binding site |
O42376 | VGTGAYGTVCYALDRRTGAKVAIKK | BindI | 25 | IPR017441 | D | pool | IPR016131 | Haemerythrin, iron-binding site | IPR004035 | Endonuclease III, iron-sulphur binding site | IPR019807 | Hexokinase, binding site | IPR017441 | Protein kinase, ATP binding site |
Q8RMH6 | AGTYLYICTVPGHYPLMQ | BindI | 73 | IPR028871 | D | pool | IPR023418 | Transthyretin, thyroxine binding site | IPR025735 | RIP homotypic interaction motif | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR028871 | Blue (type 1) copper protein, binding site |
Q94C40 | LGEGNSAKVKFAIDTLTGESFAIK | BindI | 25 | IPR017441 | D | pool | IPR018064 | Metallothionein, vertebrate, metal binding site | IPR000048 | IQ motif, EF-hand binding site | IPR015887 | DNA glycosylase/AP lyase, zinc finger domain, DNA-binding site | IPR017441 | Protein kinase, ATP binding site |
P31178 | PRCNVPRA | BindI | 62 | IPR021158 | D | pool | IPR020847 | AP endonuclease 1, binding site | IPR020537 | ATP synthase, F0 complex, subunit C, DCCD-binding site | IPR019824 | Leghaemoglobin, iron-binding site | IPR021158 | Peptidase M10A, cysteine switch, zinc binding site |
A8XJQ6 | IGKGTFGRVELARDKISGAHYALK | BindI | 25 | IPR017441 | C | pool | IPR019793 | Peroxidases heam-ligand binding site | IPR027467 | Molybdopterin oxidoreductase, molybdopterin cofactor binding site | IPR017441 | Protein kinase, ATP binding site | IPR015887 | DNA glycosylase/AP lyase, zinc finger domain, DNA-binding site |
B7GHW7 | TFSKALGAYG | BindI | 7 | IPR001917 | B | pool | IPR022407 | Oxidoreductase, molybdopterin binding site | IPR001917 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR027430 | Visual pigments (opsins) retinal binding site |
A0KHU1 | GTGGAAKEQVQHMVTHLLKLSATPQADAADALGVA | BindI | 51 | IPR020563 | D | pool | IPR001917 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR006093 | Oxygen oxidoreductase covalent FAD-binding site | IPR004163 | Coenzyme A transferase binding site | IPR020563 | Crossover junction endodeoxyribonuclease RuvC, magnesium-binding site |
E7EZG2 | EVLSRIVYLQRRFRALLERKNFL | BindI | 0 | IPR000048 | D | pool | IPR020833 | Lipoxygenase, iron binding site | IPR013516 | Phytochrome chromophore binding site | IPR034408 | Sulphate/thiosulphate-binding site | IPR000048 | IQ motif, EF-hand binding site |
E7EZG2 | VQEGAVVCIQSAWRGFRERRRLL | BindI | 0 | IPR000048 | D | pool | IPR020833 | Lipoxygenase, iron binding site | IPR013516 | Phytochrome chromophore binding site | IPR034408 | Sulphate/thiosulphate-binding site | IPR000048 | IQ motif, EF-hand binding site |
E7EZG2 | RQRRAALQIQTAWRRHRARELFL | BindI | 0 | IPR000048 | D | pool | IPR020833 | Lipoxygenase, iron binding site | IPR013516 | Phytochrome chromophore binding site | IPR034408 | Sulphate/thiosulphate-binding site | IPR000048 | IQ motif, EF-hand binding site |
E7EZG2 | RQRDATIRLQAVGRGYLARQRFR | BindI | 0 | IPR000048 | D | pool | IPR020833 | Lipoxygenase, iron binding site | IPR013516 | Phytochrome chromophore binding site | IPR034408 | Sulphate/thiosulphate-binding site | IPR000048 | IQ motif, EF-hand binding site |
Q98F05 | GVVKANGYGLG | BindI | 54 | IPR020622 | D | pool | IPR027467 | Molybdopterin oxidoreductase, molybdopterin cofactor binding site | IPR018064 | Metallothionein, vertebrate, metal binding site | IPR028871 | Blue (type 1) copper protein, binding site | IPR020622 | Alanine racemase, pyridoxal-phosphate attachment site |
Q4WLG9 | EIVALAGGHTL | BindI | 43 | IPR019793 | B | pool | IPR001431 | Peptidase M16, zinc-binding site | IPR019793 | Peroxidases heam-ligand binding site | IPR020622 | Alanine racemase, pyridoxal-phosphate attachment site | IPR020826 | Transketolase binding site |
P86986 | DKNRDNEISSWEF | BindI | 35 | IPR018247 | C | pool | IPR019824 | Leghaemoglobin, iron-binding site | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR017947 | Aryldialkylphosphatase, zinc-binding site |
A6LMP4 | TLSKAFGVLG | BindI | 7 | IPR001917 | B | pool | IPR018301 | Aromatic amino acid hydroxylase, iron/copper binding site | IPR001917 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR018527 | Rubredoxin, iron-binding site | IPR021158 | Peptidase M10A, cysteine switch, zinc binding site |
P60704 | HAEVCFLYWFHDKVLKVLSPREEFKITWYMSWSPCFECAEQI | BindI | 24 | IPR016192 | D | pool | IPR025943 | Sigma-54 interaction domain, ATP-binding site 2 | IPR028871 | Blue (type 1) copper protein, binding site | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR016192 | APOBEC/CMP deaminase, zinc-binding |
P60704 | HAEILFLDKIRSMELSQVTITCYLTWSPCPNCAWRL | BindI | 24 | IPR016192 | D | pool | IPR025943 | Sigma-54 interaction domain, ATP-binding site 2 | IPR028871 | Blue (type 1) copper protein, binding site | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR016192 | APOBEC/CMP deaminase, zinc-binding |
P53351 | LGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAK | BindI | 25 | IPR017441 | B | pool | IPR018349 | Peptidase M24A, methionine aminopeptidase, subfamily 2, binding site | IPR017441 | Protein kinase, ATP binding site | IPR016192 | APOBEC/CMP deaminase, zinc-binding | IPR001882 | Biotin-binding site |
P29602 | GMHYFVCTVGTHCSNGQ | BindI | 73 | IPR028871 | B | pool | IPR025735 | RIP homotypic interaction motif | IPR028871 | Blue (type 1) copper protein, binding site | IPR020789 | RNA polymerases, subunit N, zinc binding site | IPR016131 | Haemerythrin, iron-binding site |
Q95YL5 | DVDKSGQIDFYEY | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR001882 | Biotin-binding site | IPR029754 | Urease nickel binding site | IPR018527 | Rubredoxin, iron-binding site |
Q95YL5 | DRNRSGTIDAQEI | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR001882 | Biotin-binding site | IPR029754 | Urease nickel binding site | IPR018527 | Rubredoxin, iron-binding site |
Q9U616 | GTELKQDDECGALESVKAASEVYSPVSGKV | BindI | 10 | IPR003016 | A | pool | IPR003016 | 2-oxo acid dehydrogenase, lipoyl-binding site | IPR017441 | Protein kinase, ATP binding site | IPR023418 | Transthyretin, thyroxine binding site | IPR021115 | Pyridoxal-phosphate binding site |
J3S9D9 | DKDGDGRVSWEEY | BindI | 35 | IPR018247 | C | pool | IPR020826 | Transketolase binding site | IPR020833 | Lipoxygenase, iron binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR018246 | AP endonuclease 2, zinc binding site |
J3S9D9 | DKDGDGFVSLQEF | BindI | 35 | IPR018247 | C | pool | IPR020826 | Transketolase binding site | IPR020833 | Lipoxygenase, iron binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR018246 | AP endonuclease 2, zinc binding site |
J3S9D9 | DKDKDGKLSPKEL | BindI | 35 | IPR018247 | C | pool | IPR020826 | Transketolase binding site | IPR020833 | Lipoxygenase, iron binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR018246 | AP endonuclease 2, zinc binding site |
J3S9D9 | DLDGDRRLSANEI | BindI | 35 | IPR018247 | C | pool | IPR020826 | Transketolase binding site | IPR020833 | Lipoxygenase, iron binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR018246 | AP endonuclease 2, zinc binding site |
Q0A5W2 | TLGKAVGSFG | BindI | 7 | IPR001917 | C | pool | IPR020583 | Inositol monophosphatase, metal-binding site | IPR003952 | Fumarate reductase/succinate dehydrogenase, FAD-binding site | IPR001917 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR004035 | Endonuclease III, iron-sulphur binding site |
P02615 | DRDKSGYIEEDEL | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR018194 | Nickel-dependent hydrogenase, large subunit, nickel binding site | IPR020969 | Ankyrin-G binding site | IPR022419 | Porphobilinogen deaminase, dipyrromethane cofactor binding site |
P02615 | DTDGDGKIGVEEF | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR018194 | Nickel-dependent hydrogenase, large subunit, nickel binding site | IPR020969 | Ankyrin-G binding site | IPR022419 | Porphobilinogen deaminase, dipyrromethane cofactor binding site |
P00236 | CQAGACSTC | BindI | 15 | IPR006058 | A | pool | IPR006058 | 2Fe-2S ferredoxin, iron-sulphur binding site | IPR018152 | Superoxide dismutase, copper/zinc, binding site | IPR015887 | DNA glycosylase/AP lyase, zinc finger domain, DNA-binding site | IPR025662 | Sigma-54 interaction domain, ATP-binding site 1 |
Q74KV0 | DADADGDVTSSDL | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR021158 | Peptidase M10A, cysteine switch, zinc binding site | IPR018349 | Peptidase M24A, methionine aminopeptidase, subfamily 2, binding site | IPR001505 | Copper centre Cu(A) |
Q75JK0 | IGEGQYGRVIKCRKKNGFILNEQVDYVAIK | BindI | 25 | IPR017441 | A | pool | IPR017441 | Protein kinase, ATP binding site | IPR018152 | Superoxide dismutase, copper/zinc, binding site | IPR018195 | Transferrin family, iron binding site | IPR015881 | Aromatic-ring-hydroxylating dioxygenase ARHD, Rieske 2Fe-2S-binding site |
P39863 | YLSGHPGG | BindI | 39 | IPR018506 | C | pool | IPR025943 | Sigma-54 interaction domain, ATP-binding site 2 | IPR019824 | Leghaemoglobin, iron-binding site | IPR018506 | Cytochrome b5, heme-binding site | IPR006066 | Nitrite/sulphite reductase iron-sulphur/sirohaem-binding site |
Q9M199 | VKNAYAIKIQAAFRGYMARRSFR | BindI | 0 | IPR000048 | C | pool | IPR018229 | Rhodopsin, retinal binding site | IPR020563 | Crossover junction endodeoxyribonuclease RuvC, magnesium-binding site | IPR000048 | IQ motif, EF-hand binding site | IPR004838 | Aminotransferases, class-I, pyridoxal-phosphate-binding site |
Q5JH93 | VVVDPLDGSYNFS | BindI | 53 | IPR020583 | C | pool | IPR017441 | Protein kinase, ATP binding site | IPR004163 | Coenzyme A transferase binding site | IPR020583 | Inositol monophosphatase, metal-binding site | IPR020833 | Lipoxygenase, iron binding site |
Q9UUE1 | GDIIAVLSAMKMEIVISA | BindI | 6 | IPR001882 | B | pool | IPR025662 | Sigma-54 interaction domain, ATP-binding site 1 | IPR001882 | Biotin-binding site | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR020833 | Lipoxygenase, iron binding site |
Q04HB7 | LAVKSNAYGHG | BindI | 54 | IPR020622 | A | pool | IPR020622 | Alanine racemase, pyridoxal-phosphate attachment site | IPR001505 | Copper centre Cu(A) | IPR001917 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR018246 | AP endonuclease 2, zinc binding site |
Q9W058 | DGAQILFGGFGICGIP | BindI | 13 | IPR004163 | C | pool | IPR015887 | DNA glycosylase/AP lyase, zinc finger domain, DNA-binding site | IPR016192 | APOBEC/CMP deaminase, zinc-binding | IPR004163 | Coenzyme A transferase binding site | IPR019824 | Leghaemoglobin, iron-binding site |
E9RBR0 | HCHMTTHLQSGM | BindI | 9 | IPR002355 | A | pool | IPR002355 | Multicopper oxidase, copper-binding site | IPR027430 | Visual pigments (opsins) retinal binding site | IPR018136 | Aconitase family, 4Fe-4S cluster binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site |
Q68XW3 | AAVKANGYGIG | BindI | 54 | IPR020622 | A | pool | IPR020622 | Alanine racemase, pyridoxal-phosphate attachment site | IPR004035 | Endonuclease III, iron-sulphur binding site | IPR018194 | Nickel-dependent hydrogenase, large subunit, nickel binding site | IPR019807 | Hexokinase, binding site |
O95843 | DTNKDGFVDFLEF | BindI | 35 | IPR018247 | D | pool | IPR018064 | Metallothionein, vertebrate, metal binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR020537 | ATP synthase, F0 complex, subunit C, DCCD-binding site | IPR018247 | EF-Hand 1, calcium-binding site |
O95843 | DADGNGSIDKNEL | BindI | 35 | IPR018247 | D | pool | IPR018064 | Metallothionein, vertebrate, metal binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR020537 | ATP synthase, F0 complex, subunit C, DCCD-binding site | IPR018247 | EF-Hand 1, calcium-binding site |
O95843 | DINNDGELTLEEF | BindI | 35 | IPR018247 | D | pool | IPR018064 | Metallothionein, vertebrate, metal binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR020537 | ATP synthase, F0 complex, subunit C, DCCD-binding site | IPR018247 | EF-Hand 1, calcium-binding site |
G5EBZ8 | LGQGEFGSVWQAGWKNSAGSDVIQVAVK | BindI | 25 | IPR017441 | D | pool | IPR006093 | Oxygen oxidoreductase covalent FAD-binding site | IPR020855 | Ureohydrolase, manganese-binding site | IPR018349 | Peptidase M24A, methionine aminopeptidase, subfamily 2, binding site | IPR017441 | Protein kinase, ATP binding site |
O48538 | DKNEDGRITEEEV | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR001917 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR018220 | Adenylosuccinate synthase, GTP-binding site | IPR018229 | Rhodopsin, retinal binding site |
A1RVH3 | GCVVTYGTCGPCLG | BindI | 28 | IPR018136 | A | pool | IPR018136 | Aconitase family, 4Fe-4S cluster binding site | IPR018152 | Superoxide dismutase, copper/zinc, binding site | IPR019798 | Serine hydroxymethyltransferase, pyridoxal phosphate binding site | IPR020537 | ATP synthase, F0 complex, subunit C, DCCD-binding site |
A0A0A2JW88 | RMFAYPDAQ | BindI | 8 | IPR002226 | A | pool | IPR002226 | Catalase haem-binding site | IPR019789 | Xylulose 5-phosphate/Fructose 6-phosphate phosphoketolase, thiamine diphosphate binding site | IPR025662 | Sigma-54 interaction domain, ATP-binding site 1 | IPR016131 | Haemerythrin, iron-binding site |
A2ZNT5 | HCHILDHEDNAM | BindI | 9 | IPR002355 | B | pool | IPR003952 | Fumarate reductase/succinate dehydrogenase, FAD-binding site | IPR002355 | Multicopper oxidase, copper-binding site | IPR015881 | Aromatic-ring-hydroxylating dioxygenase ARHD, Rieske 2Fe-2S-binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site |
Q9SD11 | REEIAAVKIQAFFRGHLARRAFK | BindI | 0 | IPR000048 | A | pool | IPR000048 | IQ motif, EF-hand binding site | IPR018349 | Peptidase M24A, methionine aminopeptidase, subfamily 2, binding site | IPR019825 | Legume lectin, beta chain, Mn/Ca-binding site | IPR001882 | Biotin-binding site |
Q9SD11 | ALKSLVKLQAVARGVLVRRQAR | BindI | 0 | IPR000048 | A | pool | IPR000048 | IQ motif, EF-hand binding site | IPR018349 | Peptidase M24A, methionine aminopeptidase, subfamily 2, binding site | IPR019825 | Legume lectin, beta chain, Mn/Ca-binding site | IPR001882 | Biotin-binding site |
Q2R1Z5 | DKNNDGCISREEL | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR015881 | Aromatic-ring-hydroxylating dioxygenase ARHD, Rieske 2Fe-2S-binding site | IPR019807 | Hexokinase, binding site | IPR027467 | Molybdopterin oxidoreductase, molybdopterin cofactor binding site |
Q2R1Z5 | DEDGNGTIEFDEF | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR015881 | Aromatic-ring-hydroxylating dioxygenase ARHD, Rieske 2Fe-2S-binding site | IPR019807 | Hexokinase, binding site | IPR027467 | Molybdopterin oxidoreductase, molybdopterin cofactor binding site |
Q2R1Z5 | DKDDNGFISRNEL | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR015881 | Aromatic-ring-hydroxylating dioxygenase ARHD, Rieske 2Fe-2S-binding site | IPR019807 | Hexokinase, binding site | IPR027467 | Molybdopterin oxidoreductase, molybdopterin cofactor binding site |
Q2R1Z5 | DSNNDGQVDYEEF | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR015881 | Aromatic-ring-hydroxylating dioxygenase ARHD, Rieske 2Fe-2S-binding site | IPR019807 | Hexokinase, binding site | IPR027467 | Molybdopterin oxidoreductase, molybdopterin cofactor binding site |
B5EP95 | AAVKANAYGHG | BindI | 54 | IPR020622 | D | pool | IPR001431 | Peptidase M16, zinc-binding site | IPR002226 | Catalase haem-binding site | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR020622 | Alanine racemase, pyridoxal-phosphate attachment site |
F4JIU4 | YVLRGILGLQKQFRGYQTREYFH | BindI | 0 | IPR000048 | A | pool | IPR000048 | IQ motif, EF-hand binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR020826 | Transketolase binding site | IPR020789 | RNA polymerases, subunit N, zinc binding site |
F4JIU4 | NMRNAAVILQSYIRGENARRNYI | BindI | 0 | IPR000048 | A | pool | IPR000048 | IQ motif, EF-hand binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR020826 | Transketolase binding site | IPR020789 | RNA polymerases, subunit N, zinc binding site |
F4JIU4 | KELDAAIHLQYMVRKWLARKLLN | BindI | 0 | IPR000048 | A | pool | IPR000048 | IQ motif, EF-hand binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR020826 | Transketolase binding site | IPR020789 | RNA polymerases, subunit N, zinc binding site |
Q55C62 | DTDCNGILDFKEF | BindI | 35 | IPR018247 | C | pool | IPR019825 | Legume lectin, beta chain, Mn/Ca-binding site | IPR020969 | Ankyrin-G binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR021115 | Pyridoxal-phosphate binding site |
Q55C62 | DKDQSGHLEVDEV | BindI | 35 | IPR018247 | C | pool | IPR019825 | Legume lectin, beta chain, Mn/Ca-binding site | IPR020969 | Ankyrin-G binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR021115 | Pyridoxal-phosphate binding site |
O18842 | CTCAGSCKCKECKCTSCKK | BindI | 27 | IPR018064 | C | pool | IPR017947 | Aryldialkylphosphatase, zinc-binding site | IPR002226 | Catalase haem-binding site | IPR018064 | Metallothionein, vertebrate, metal binding site | IPR006184 | 6-phosphogluconate-binding site |
P21637 | SGCAKGCARPKPSELTL | BindI | 16 | IPR006066 | D | pool | IPR002226 | Catalase haem-binding site | IPR027467 | Molybdopterin oxidoreductase, molybdopterin cofactor binding site | IPR020826 | Transketolase binding site | IPR006066 | Nitrite/sulphite reductase iron-sulphur/sirohaem-binding site |
Q9LF55 | DKNKDGKISWDEF | BindI | 35 | IPR018247 | B | pool | IPR020563 | Crossover junction endodeoxyribonuclease RuvC, magnesium-binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR000048 | IQ motif, EF-hand binding site | IPR006093 | Oxygen oxidoreductase covalent FAD-binding site |
Q9LF55 | DVDGDNQIDVAEY | BindI | 35 | IPR018247 | B | pool | IPR020563 | Crossover junction endodeoxyribonuclease RuvC, magnesium-binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR000048 | IQ motif, EF-hand binding site | IPR006093 | Oxygen oxidoreductase covalent FAD-binding site |
Q9LF55 | DIDGDGKISASEI | BindI | 35 | IPR018247 | B | pool | IPR020563 | Crossover junction endodeoxyribonuclease RuvC, magnesium-binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR000048 | IQ motif, EF-hand binding site | IPR006093 | Oxygen oxidoreductase covalent FAD-binding site |
Q9LF55 | DADGDGFVSFEEF | BindI | 35 | IPR018247 | B | pool | IPR020563 | Crossover junction endodeoxyribonuclease RuvC, magnesium-binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR000048 | IQ motif, EF-hand binding site | IPR006093 | Oxygen oxidoreductase covalent FAD-binding site |
A0A125YZN2 | DTDGSGMIDPKEL | BindI | 35 | IPR018247 | B | pool | IPR025943 | Sigma-54 interaction domain, ATP-binding site 2 | IPR018247 | EF-Hand 1, calcium-binding site | IPR020855 | Ureohydrolase, manganese-binding site | IPR025662 | Sigma-54 interaction domain, ATP-binding site 1 |
A0A125YZN2 | DSNGDGEISFEDF | BindI | 35 | IPR018247 | B | pool | IPR025943 | Sigma-54 interaction domain, ATP-binding site 2 | IPR018247 | EF-Hand 1, calcium-binding site | IPR020855 | Ureohydrolase, manganese-binding site | IPR025662 | Sigma-54 interaction domain, ATP-binding site 1 |
P23120 | IHMLSLSGHKLHRKGVGVL | BindI | 52 | IPR020578 | A | pool | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR000048 | IQ motif, EF-hand binding site | IPR018229 | Rhodopsin, retinal binding site | IPR019833 | Manganese/iron superoxide dismutase, binding site |
P48351 | RSFAYADTQ | BindI | 8 | IPR002226 | B | pool | IPR020847 | AP endonuclease 1, binding site | IPR002226 | Catalase haem-binding site | IPR023418 | Transthyretin, thyroxine binding site | IPR003016 | 2-oxo acid dehydrogenase, lipoyl-binding site |
P00272 | IPEDWCCPDCA | BindI | 40 | IPR018527 | A | pool | IPR018527 | Rubredoxin, iron-binding site | IPR020622 | Alanine racemase, pyridoxal-phosphate attachment site | IPR002226 | Catalase haem-binding site | IPR001882 | Biotin-binding site |
P00272 | IPDDWCCPDCG | BindI | 40 | IPR018527 | A | pool | IPR018527 | Rubredoxin, iron-binding site | IPR020622 | Alanine racemase, pyridoxal-phosphate attachment site | IPR002226 | Catalase haem-binding site | IPR001882 | Biotin-binding site |
P40807 | YAVKCNDDPMVVRLLAQLG | BindI | 65 | IPR022653 | B | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR015887 | DNA glycosylase/AP lyase, zinc finger domain, DNA-binding site | IPR021158 | Peptidase M10A, cysteine switch, zinc binding site |
O35887 | DDDKDGFVTVDEL | BindI | 35 | IPR018247 | D | pool | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR000634 | Serine/threonine dehydratase, pyridoxal-phosphate-binding site | IPR018247 | EF-Hand 1, calcium-binding site |
O35887 | DLNEDGLVSWEEY | BindI | 35 | IPR018247 | D | pool | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR000634 | Serine/threonine dehydratase, pyridoxal-phosphate-binding site | IPR018247 | EF-Hand 1, calcium-binding site |
O35887 | DKNADGFIDLEEY | BindI | 35 | IPR018247 | D | pool | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR000634 | Serine/threonine dehydratase, pyridoxal-phosphate-binding site | IPR018247 | EF-Hand 1, calcium-binding site |
O35887 | DQNKDGKLTKEEI | BindI | 35 | IPR018247 | D | pool | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR000634 | Serine/threonine dehydratase, pyridoxal-phosphate-binding site | IPR018247 | EF-Hand 1, calcium-binding site |
A2BX41 | GSGKASKKEVIEAVMFNLNLNYAPKPDDSADALAIA | BindI | 51 | IPR020563 | A | pool | IPR020563 | Crossover junction endodeoxyribonuclease RuvC, magnesium-binding site | IPR018195 | Transferrin family, iron binding site | IPR006058 | 2Fe-2S ferredoxin, iron-sulphur binding site | IPR021158 | Peptidase M10A, cysteine switch, zinc binding site |
P30265 | RLFGYKDAE | BindI | 8 | IPR002226 | B | pool | IPR001431 | Peptidase M16, zinc-binding site | IPR002226 | Catalase haem-binding site | IPR025662 | Sigma-54 interaction domain, ATP-binding site 1 | IPR006184 | 6-phosphogluconate-binding site |
O01775 | VGRGAFGVCWLCRGKNDASHQKVIIK | BindI | 25 | IPR017441 | A | pool | IPR017441 | Protein kinase, ATP binding site | IPR025735 | RIP homotypic interaction motif | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR020826 | Transketolase binding site |
A4IF97 | DQNRDGFIDKEDL | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR002226 | Catalase haem-binding site |
A5EW54 | VVLKADAYGHG | BindI | 54 | IPR020622 | C | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR020622 | Alanine racemase, pyridoxal-phosphate attachment site | IPR018506 | Cytochrome b5, heme-binding site |
P35489 | GDKVKEGETLVIVETDKVNAELPSPVDGTI | BindI | 10 | IPR003016 | B | pool | IPR023418 | Transthyretin, thyroxine binding site | IPR003016 | 2-oxo acid dehydrogenase, lipoyl-binding site | IPR004838 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR019843 | DNA polymerase family X, binding site |
P35489 | GDKVKEGETLVVVETDKVNAELPSPVDGTI | BindI | 10 | IPR003016 | B | pool | IPR023418 | Transthyretin, thyroxine binding site | IPR003016 | 2-oxo acid dehydrogenase, lipoyl-binding site | IPR004838 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR019843 | DNA polymerase family X, binding site |
P11542 | ETVWLLSAHSI | BindI | 43 | IPR019793 | B | pool | IPR016192 | APOBEC/CMP deaminase, zinc-binding | IPR019793 | Peroxidases heam-ligand binding site | IPR027467 | Molybdopterin oxidoreductase, molybdopterin cofactor binding site | IPR019780 | Germin, manganese binding site |
Q9DD78 | DASANNFICSCEF | BindI | 35 | IPR018247 | B | pool | IPR015887 | DNA glycosylase/AP lyase, zinc finger domain, DNA-binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR019843 | DNA polymerase family X, binding site | IPR020847 | AP endonuclease 1, binding site |
Q2W3L2 | TFSKGLGSFG | BindI | 7 | IPR001917 | C | pool | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR001917 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR020537 | ATP synthase, F0 complex, subunit C, DCCD-binding site |
Q54QT9 | DLNKDGSVTSFDI | BindI | 35 | IPR018247 | C | pool | IPR006058 | 2Fe-2S ferredoxin, iron-sulphur binding site | IPR019798 | Serine hydroxymethyltransferase, pyridoxal phosphate binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR018064 | Metallothionein, vertebrate, metal binding site |
Q54QT9 | DKDKDKKLTKTEF | BindI | 35 | IPR018247 | C | pool | IPR006058 | 2Fe-2S ferredoxin, iron-sulphur binding site | IPR019798 | Serine hydroxymethyltransferase, pyridoxal phosphate binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR018064 | Metallothionein, vertebrate, metal binding site |
B5ER47 | TRQPEMRPQLLVNTFIFAGLME | BindI | 50 | IPR020537 | D | pool | IPR018064 | Metallothionein, vertebrate, metal binding site | IPR019843 | DNA polymerase family X, binding site | IPR020789 | RNA polymerases, subunit N, zinc binding site | IPR020537 | ATP synthase, F0 complex, subunit C, DCCD-binding site |
Q75K28 | DIDGNGYITRSEM | BindI | 35 | IPR018247 | C | pool | IPR002355 | Multicopper oxidase, copper-binding site | IPR001505 | Copper centre Cu(A) | IPR018247 | EF-Hand 1, calcium-binding site | IPR019807 | Hexokinase, binding site |
Q75K28 | DDDGDGYISLEEY | BindI | 35 | IPR018247 | C | pool | IPR002355 | Multicopper oxidase, copper-binding site | IPR001505 | Copper centre Cu(A) | IPR018247 | EF-Hand 1, calcium-binding site | IPR019807 | Hexokinase, binding site |
O36021 | DRDEEGEIDEDEV | BindI | 35 | IPR018247 | D | pool | IPR006093 | Oxygen oxidoreductase covalent FAD-binding site | IPR018136 | Aconitase family, 4Fe-4S cluster binding site | IPR020833 | Lipoxygenase, iron binding site | IPR018247 | EF-Hand 1, calcium-binding site |
P11053 | CHSGSCSSC | BindI | 15 | IPR006058 | B | pool | IPR018195 | Transferrin family, iron binding site | IPR006058 | 2Fe-2S ferredoxin, iron-sulphur binding site | IPR034408 | Sulphate/thiosulphate-binding site | IPR019780 | Germin, manganese binding site |
Q03002 | LGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIK | BindI | 25 | IPR017441 | C | pool | IPR000048 | IQ motif, EF-hand binding site | IPR019843 | DNA polymerase family X, binding site | IPR017441 | Protein kinase, ATP binding site | IPR017947 | Aryldialkylphosphatase, zinc-binding site |
A0JVG9 | GPDGASHHGMWDMAMVQ | BindI | 56 | IPR020826 | A | pool | IPR020826 | Transketolase binding site | IPR000048 | IQ motif, EF-hand binding site | IPR004163 | Coenzyme A transferase binding site | IPR018301 | Aromatic amino acid hydroxylase, iron/copper binding site |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.