uid stringlengths 6 10 | seq_fragment stringlengths 4 100 | annotation stringclasses 1
value | interpro_label int64 0 75 | correct_ipr stringclasses 76
values | correct_letter stringclasses 4
values | distractor_source stringclasses 1
value | option_a_ipr stringclasses 76
values | option_a_desc stringclasses 76
values | option_b_ipr stringclasses 76
values | option_b_desc stringclasses 76
values | option_c_ipr stringclasses 76
values | option_c_desc stringclasses 76
values | option_d_ipr stringclasses 76
values | option_d_desc stringclasses 76
values |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
P49621 | DTDGNGFLDSSEL | BindI | 35 | IPR018247 | D | pool | IPR013516 | Phytochrome chromophore binding site | IPR015887 | DNA glycosylase/AP lyase, zinc finger domain, DNA-binding site | IPR018194 | Nickel-dependent hydrogenase, large subunit, nickel binding site | IPR018247 | EF-Hand 1, calcium-binding site |
P49621 | DYDRDGTVSLEEW | BindI | 35 | IPR018247 | D | pool | IPR013516 | Phytochrome chromophore binding site | IPR015887 | DNA glycosylase/AP lyase, zinc finger domain, DNA-binding site | IPR018194 | Nickel-dependent hydrogenase, large subunit, nickel binding site | IPR018247 | EF-Hand 1, calcium-binding site |
Q90YK7 | DQDQSDFIEEEEL | BindI | 35 | IPR018247 | D | pool | IPR018246 | AP endonuclease 2, zinc binding site | IPR018527 | Rubredoxin, iron-binding site | IPR001216 | Cysteine synthase/cystathionine beta-synthase, pyridoxal-phosphate attachment site | IPR018247 | EF-Hand 1, calcium-binding site |
F4J0W4 | DLDNDGALQPAEL | BindI | 35 | IPR018247 | D | pool | IPR028871 | Blue (type 1) copper protein, binding site | IPR018220 | Adenylosuccinate synthase, GTP-binding site | IPR019843 | DNA polymerase family X, binding site | IPR018247 | EF-Hand 1, calcium-binding site |
O42376 | VGTGAYGTVCYALDRRTGAKVAIKK | BindI | 25 | IPR017441 | D | pool | IPR016131 | Haemerythrin, iron-binding site | IPR004035 | Endonuclease III, iron-sulphur binding site | IPR019807 | Hexokinase, binding site | IPR017441 | Protein kinase, ATP binding site |
Q8RMH6 | AGTYLYICTVPGHYPLMQ | BindI | 73 | IPR028871 | D | pool | IPR023418 | Transthyretin, thyroxine binding site | IPR025735 | RIP homotypic interaction motif | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR028871 | Blue (type 1) copper protein, binding site |
Q94C40 | LGEGNSAKVKFAIDTLTGESFAIK | BindI | 25 | IPR017441 | D | pool | IPR018064 | Metallothionein, vertebrate, metal binding site | IPR000048 | IQ motif, EF-hand binding site | IPR015887 | DNA glycosylase/AP lyase, zinc finger domain, DNA-binding site | IPR017441 | Protein kinase, ATP binding site |
P31178 | PRCNVPRA | BindI | 62 | IPR021158 | D | pool | IPR020847 | AP endonuclease 1, binding site | IPR020537 | ATP synthase, F0 complex, subunit C, DCCD-binding site | IPR019824 | Leghaemoglobin, iron-binding site | IPR021158 | Peptidase M10A, cysteine switch, zinc binding site |
A8XJQ6 | IGKGTFGRVELARDKISGAHYALK | BindI | 25 | IPR017441 | C | pool | IPR019793 | Peroxidases heam-ligand binding site | IPR027467 | Molybdopterin oxidoreductase, molybdopterin cofactor binding site | IPR017441 | Protein kinase, ATP binding site | IPR015887 | DNA glycosylase/AP lyase, zinc finger domain, DNA-binding site |
B7GHW7 | TFSKALGAYG | BindI | 7 | IPR001917 | B | pool | IPR022407 | Oxidoreductase, molybdopterin binding site | IPR001917 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR027430 | Visual pigments (opsins) retinal binding site |
A0KHU1 | GTGGAAKEQVQHMVTHLLKLSATPQADAADALGVA | BindI | 51 | IPR020563 | D | pool | IPR001917 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR006093 | Oxygen oxidoreductase covalent FAD-binding site | IPR004163 | Coenzyme A transferase binding site | IPR020563 | Crossover junction endodeoxyribonuclease RuvC, magnesium-binding site |
E7EZG2 | EVLSRIVYLQRRFRALLERKNFL | BindI | 0 | IPR000048 | D | pool | IPR020833 | Lipoxygenase, iron binding site | IPR013516 | Phytochrome chromophore binding site | IPR034408 | Sulphate/thiosulphate-binding site | IPR000048 | IQ motif, EF-hand binding site |
E7EZG2 | VQEGAVVCIQSAWRGFRERRRLL | BindI | 0 | IPR000048 | D | pool | IPR020833 | Lipoxygenase, iron binding site | IPR013516 | Phytochrome chromophore binding site | IPR034408 | Sulphate/thiosulphate-binding site | IPR000048 | IQ motif, EF-hand binding site |
E7EZG2 | RQRRAALQIQTAWRRHRARELFL | BindI | 0 | IPR000048 | D | pool | IPR020833 | Lipoxygenase, iron binding site | IPR013516 | Phytochrome chromophore binding site | IPR034408 | Sulphate/thiosulphate-binding site | IPR000048 | IQ motif, EF-hand binding site |
E7EZG2 | RQRDATIRLQAVGRGYLARQRFR | BindI | 0 | IPR000048 | D | pool | IPR020833 | Lipoxygenase, iron binding site | IPR013516 | Phytochrome chromophore binding site | IPR034408 | Sulphate/thiosulphate-binding site | IPR000048 | IQ motif, EF-hand binding site |
Q98F05 | GVVKANGYGLG | BindI | 54 | IPR020622 | D | pool | IPR027467 | Molybdopterin oxidoreductase, molybdopterin cofactor binding site | IPR018064 | Metallothionein, vertebrate, metal binding site | IPR028871 | Blue (type 1) copper protein, binding site | IPR020622 | Alanine racemase, pyridoxal-phosphate attachment site |
Q4WLG9 | EIVALAGGHTL | BindI | 43 | IPR019793 | B | pool | IPR001431 | Peptidase M16, zinc-binding site | IPR019793 | Peroxidases heam-ligand binding site | IPR020622 | Alanine racemase, pyridoxal-phosphate attachment site | IPR020826 | Transketolase binding site |
P86986 | DKNRDNEISSWEF | BindI | 35 | IPR018247 | C | pool | IPR019824 | Leghaemoglobin, iron-binding site | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR017947 | Aryldialkylphosphatase, zinc-binding site |
A6LMP4 | TLSKAFGVLG | BindI | 7 | IPR001917 | B | pool | IPR018301 | Aromatic amino acid hydroxylase, iron/copper binding site | IPR001917 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR018527 | Rubredoxin, iron-binding site | IPR021158 | Peptidase M10A, cysteine switch, zinc binding site |
P60704 | HAEVCFLYWFHDKVLKVLSPREEFKITWYMSWSPCFECAEQI | BindI | 24 | IPR016192 | D | pool | IPR025943 | Sigma-54 interaction domain, ATP-binding site 2 | IPR028871 | Blue (type 1) copper protein, binding site | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR016192 | APOBEC/CMP deaminase, zinc-binding |
P60704 | HAEILFLDKIRSMELSQVTITCYLTWSPCPNCAWRL | BindI | 24 | IPR016192 | D | pool | IPR025943 | Sigma-54 interaction domain, ATP-binding site 2 | IPR028871 | Blue (type 1) copper protein, binding site | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR016192 | APOBEC/CMP deaminase, zinc-binding |
P53351 | LGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAK | BindI | 25 | IPR017441 | B | pool | IPR018349 | Peptidase M24A, methionine aminopeptidase, subfamily 2, binding site | IPR017441 | Protein kinase, ATP binding site | IPR016192 | APOBEC/CMP deaminase, zinc-binding | IPR001882 | Biotin-binding site |
P29602 | GMHYFVCTVGTHCSNGQ | BindI | 73 | IPR028871 | B | pool | IPR025735 | RIP homotypic interaction motif | IPR028871 | Blue (type 1) copper protein, binding site | IPR020789 | RNA polymerases, subunit N, zinc binding site | IPR016131 | Haemerythrin, iron-binding site |
Q95YL5 | DVDKSGQIDFYEY | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR001882 | Biotin-binding site | IPR029754 | Urease nickel binding site | IPR018527 | Rubredoxin, iron-binding site |
Q95YL5 | DRNRSGTIDAQEI | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR001882 | Biotin-binding site | IPR029754 | Urease nickel binding site | IPR018527 | Rubredoxin, iron-binding site |
Q9U616 | GTELKQDDECGALESVKAASEVYSPVSGKV | BindI | 10 | IPR003016 | A | pool | IPR003016 | 2-oxo acid dehydrogenase, lipoyl-binding site | IPR017441 | Protein kinase, ATP binding site | IPR023418 | Transthyretin, thyroxine binding site | IPR021115 | Pyridoxal-phosphate binding site |
J3S9D9 | DKDGDGRVSWEEY | BindI | 35 | IPR018247 | C | pool | IPR020826 | Transketolase binding site | IPR020833 | Lipoxygenase, iron binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR018246 | AP endonuclease 2, zinc binding site |
J3S9D9 | DKDGDGFVSLQEF | BindI | 35 | IPR018247 | C | pool | IPR020826 | Transketolase binding site | IPR020833 | Lipoxygenase, iron binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR018246 | AP endonuclease 2, zinc binding site |
J3S9D9 | DKDKDGKLSPKEL | BindI | 35 | IPR018247 | C | pool | IPR020826 | Transketolase binding site | IPR020833 | Lipoxygenase, iron binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR018246 | AP endonuclease 2, zinc binding site |
J3S9D9 | DLDGDRRLSANEI | BindI | 35 | IPR018247 | C | pool | IPR020826 | Transketolase binding site | IPR020833 | Lipoxygenase, iron binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR018246 | AP endonuclease 2, zinc binding site |
Q0A5W2 | TLGKAVGSFG | BindI | 7 | IPR001917 | C | pool | IPR020583 | Inositol monophosphatase, metal-binding site | IPR003952 | Fumarate reductase/succinate dehydrogenase, FAD-binding site | IPR001917 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR004035 | Endonuclease III, iron-sulphur binding site |
P02615 | DRDKSGYIEEDEL | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR018194 | Nickel-dependent hydrogenase, large subunit, nickel binding site | IPR020969 | Ankyrin-G binding site | IPR022419 | Porphobilinogen deaminase, dipyrromethane cofactor binding site |
P02615 | DTDGDGKIGVEEF | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR018194 | Nickel-dependent hydrogenase, large subunit, nickel binding site | IPR020969 | Ankyrin-G binding site | IPR022419 | Porphobilinogen deaminase, dipyrromethane cofactor binding site |
P00236 | CQAGACSTC | BindI | 15 | IPR006058 | A | pool | IPR006058 | 2Fe-2S ferredoxin, iron-sulphur binding site | IPR018152 | Superoxide dismutase, copper/zinc, binding site | IPR015887 | DNA glycosylase/AP lyase, zinc finger domain, DNA-binding site | IPR025662 | Sigma-54 interaction domain, ATP-binding site 1 |
Q74KV0 | DADADGDVTSSDL | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR021158 | Peptidase M10A, cysteine switch, zinc binding site | IPR018349 | Peptidase M24A, methionine aminopeptidase, subfamily 2, binding site | IPR001505 | Copper centre Cu(A) |
Q75JK0 | IGEGQYGRVIKCRKKNGFILNEQVDYVAIK | BindI | 25 | IPR017441 | A | pool | IPR017441 | Protein kinase, ATP binding site | IPR018152 | Superoxide dismutase, copper/zinc, binding site | IPR018195 | Transferrin family, iron binding site | IPR015881 | Aromatic-ring-hydroxylating dioxygenase ARHD, Rieske 2Fe-2S-binding site |
P39863 | YLSGHPGG | BindI | 39 | IPR018506 | C | pool | IPR025943 | Sigma-54 interaction domain, ATP-binding site 2 | IPR019824 | Leghaemoglobin, iron-binding site | IPR018506 | Cytochrome b5, heme-binding site | IPR006066 | Nitrite/sulphite reductase iron-sulphur/sirohaem-binding site |
Q9M199 | VKNAYAIKIQAAFRGYMARRSFR | BindI | 0 | IPR000048 | C | pool | IPR018229 | Rhodopsin, retinal binding site | IPR020563 | Crossover junction endodeoxyribonuclease RuvC, magnesium-binding site | IPR000048 | IQ motif, EF-hand binding site | IPR004838 | Aminotransferases, class-I, pyridoxal-phosphate-binding site |
Q5JH93 | VVVDPLDGSYNFS | BindI | 53 | IPR020583 | C | pool | IPR017441 | Protein kinase, ATP binding site | IPR004163 | Coenzyme A transferase binding site | IPR020583 | Inositol monophosphatase, metal-binding site | IPR020833 | Lipoxygenase, iron binding site |
Q9UUE1 | GDIIAVLSAMKMEIVISA | BindI | 6 | IPR001882 | B | pool | IPR025662 | Sigma-54 interaction domain, ATP-binding site 1 | IPR001882 | Biotin-binding site | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR020833 | Lipoxygenase, iron binding site |
Q04HB7 | LAVKSNAYGHG | BindI | 54 | IPR020622 | A | pool | IPR020622 | Alanine racemase, pyridoxal-phosphate attachment site | IPR001505 | Copper centre Cu(A) | IPR001917 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR018246 | AP endonuclease 2, zinc binding site |
Q9W058 | DGAQILFGGFGICGIP | BindI | 13 | IPR004163 | C | pool | IPR015887 | DNA glycosylase/AP lyase, zinc finger domain, DNA-binding site | IPR016192 | APOBEC/CMP deaminase, zinc-binding | IPR004163 | Coenzyme A transferase binding site | IPR019824 | Leghaemoglobin, iron-binding site |
E9RBR0 | HCHMTTHLQSGM | BindI | 9 | IPR002355 | A | pool | IPR002355 | Multicopper oxidase, copper-binding site | IPR027430 | Visual pigments (opsins) retinal binding site | IPR018136 | Aconitase family, 4Fe-4S cluster binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site |
Q68XW3 | AAVKANGYGIG | BindI | 54 | IPR020622 | A | pool | IPR020622 | Alanine racemase, pyridoxal-phosphate attachment site | IPR004035 | Endonuclease III, iron-sulphur binding site | IPR018194 | Nickel-dependent hydrogenase, large subunit, nickel binding site | IPR019807 | Hexokinase, binding site |
O95843 | DTNKDGFVDFLEF | BindI | 35 | IPR018247 | D | pool | IPR018064 | Metallothionein, vertebrate, metal binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR020537 | ATP synthase, F0 complex, subunit C, DCCD-binding site | IPR018247 | EF-Hand 1, calcium-binding site |
O95843 | DADGNGSIDKNEL | BindI | 35 | IPR018247 | D | pool | IPR018064 | Metallothionein, vertebrate, metal binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR020537 | ATP synthase, F0 complex, subunit C, DCCD-binding site | IPR018247 | EF-Hand 1, calcium-binding site |
O95843 | DINNDGELTLEEF | BindI | 35 | IPR018247 | D | pool | IPR018064 | Metallothionein, vertebrate, metal binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR020537 | ATP synthase, F0 complex, subunit C, DCCD-binding site | IPR018247 | EF-Hand 1, calcium-binding site |
G5EBZ8 | LGQGEFGSVWQAGWKNSAGSDVIQVAVK | BindI | 25 | IPR017441 | D | pool | IPR006093 | Oxygen oxidoreductase covalent FAD-binding site | IPR020855 | Ureohydrolase, manganese-binding site | IPR018349 | Peptidase M24A, methionine aminopeptidase, subfamily 2, binding site | IPR017441 | Protein kinase, ATP binding site |
O48538 | DKNEDGRITEEEV | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR001917 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR018220 | Adenylosuccinate synthase, GTP-binding site | IPR018229 | Rhodopsin, retinal binding site |
A1RVH3 | GCVVTYGTCGPCLG | BindI | 28 | IPR018136 | A | pool | IPR018136 | Aconitase family, 4Fe-4S cluster binding site | IPR018152 | Superoxide dismutase, copper/zinc, binding site | IPR019798 | Serine hydroxymethyltransferase, pyridoxal phosphate binding site | IPR020537 | ATP synthase, F0 complex, subunit C, DCCD-binding site |
A0A0A2JW88 | RMFAYPDAQ | BindI | 8 | IPR002226 | A | pool | IPR002226 | Catalase haem-binding site | IPR019789 | Xylulose 5-phosphate/Fructose 6-phosphate phosphoketolase, thiamine diphosphate binding site | IPR025662 | Sigma-54 interaction domain, ATP-binding site 1 | IPR016131 | Haemerythrin, iron-binding site |
A2ZNT5 | HCHILDHEDNAM | BindI | 9 | IPR002355 | B | pool | IPR003952 | Fumarate reductase/succinate dehydrogenase, FAD-binding site | IPR002355 | Multicopper oxidase, copper-binding site | IPR015881 | Aromatic-ring-hydroxylating dioxygenase ARHD, Rieske 2Fe-2S-binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site |
Q9SD11 | REEIAAVKIQAFFRGHLARRAFK | BindI | 0 | IPR000048 | A | pool | IPR000048 | IQ motif, EF-hand binding site | IPR018349 | Peptidase M24A, methionine aminopeptidase, subfamily 2, binding site | IPR019825 | Legume lectin, beta chain, Mn/Ca-binding site | IPR001882 | Biotin-binding site |
Q9SD11 | ALKSLVKLQAVARGVLVRRQAR | BindI | 0 | IPR000048 | A | pool | IPR000048 | IQ motif, EF-hand binding site | IPR018349 | Peptidase M24A, methionine aminopeptidase, subfamily 2, binding site | IPR019825 | Legume lectin, beta chain, Mn/Ca-binding site | IPR001882 | Biotin-binding site |
Q2R1Z5 | DKNNDGCISREEL | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR015881 | Aromatic-ring-hydroxylating dioxygenase ARHD, Rieske 2Fe-2S-binding site | IPR019807 | Hexokinase, binding site | IPR027467 | Molybdopterin oxidoreductase, molybdopterin cofactor binding site |
Q2R1Z5 | DEDGNGTIEFDEF | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR015881 | Aromatic-ring-hydroxylating dioxygenase ARHD, Rieske 2Fe-2S-binding site | IPR019807 | Hexokinase, binding site | IPR027467 | Molybdopterin oxidoreductase, molybdopterin cofactor binding site |
Q2R1Z5 | DKDDNGFISRNEL | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR015881 | Aromatic-ring-hydroxylating dioxygenase ARHD, Rieske 2Fe-2S-binding site | IPR019807 | Hexokinase, binding site | IPR027467 | Molybdopterin oxidoreductase, molybdopterin cofactor binding site |
Q2R1Z5 | DSNNDGQVDYEEF | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR015881 | Aromatic-ring-hydroxylating dioxygenase ARHD, Rieske 2Fe-2S-binding site | IPR019807 | Hexokinase, binding site | IPR027467 | Molybdopterin oxidoreductase, molybdopterin cofactor binding site |
B5EP95 | AAVKANAYGHG | BindI | 54 | IPR020622 | D | pool | IPR001431 | Peptidase M16, zinc-binding site | IPR002226 | Catalase haem-binding site | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR020622 | Alanine racemase, pyridoxal-phosphate attachment site |
F4JIU4 | YVLRGILGLQKQFRGYQTREYFH | BindI | 0 | IPR000048 | A | pool | IPR000048 | IQ motif, EF-hand binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR020826 | Transketolase binding site | IPR020789 | RNA polymerases, subunit N, zinc binding site |
F4JIU4 | NMRNAAVILQSYIRGENARRNYI | BindI | 0 | IPR000048 | A | pool | IPR000048 | IQ motif, EF-hand binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR020826 | Transketolase binding site | IPR020789 | RNA polymerases, subunit N, zinc binding site |
F4JIU4 | KELDAAIHLQYMVRKWLARKLLN | BindI | 0 | IPR000048 | A | pool | IPR000048 | IQ motif, EF-hand binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR020826 | Transketolase binding site | IPR020789 | RNA polymerases, subunit N, zinc binding site |
Q55C62 | DTDCNGILDFKEF | BindI | 35 | IPR018247 | C | pool | IPR019825 | Legume lectin, beta chain, Mn/Ca-binding site | IPR020969 | Ankyrin-G binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR021115 | Pyridoxal-phosphate binding site |
Q55C62 | DKDQSGHLEVDEV | BindI | 35 | IPR018247 | C | pool | IPR019825 | Legume lectin, beta chain, Mn/Ca-binding site | IPR020969 | Ankyrin-G binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR021115 | Pyridoxal-phosphate binding site |
O18842 | CTCAGSCKCKECKCTSCKK | BindI | 27 | IPR018064 | C | pool | IPR017947 | Aryldialkylphosphatase, zinc-binding site | IPR002226 | Catalase haem-binding site | IPR018064 | Metallothionein, vertebrate, metal binding site | IPR006184 | 6-phosphogluconate-binding site |
P21637 | SGCAKGCARPKPSELTL | BindI | 16 | IPR006066 | D | pool | IPR002226 | Catalase haem-binding site | IPR027467 | Molybdopterin oxidoreductase, molybdopterin cofactor binding site | IPR020826 | Transketolase binding site | IPR006066 | Nitrite/sulphite reductase iron-sulphur/sirohaem-binding site |
Q9LF55 | DKNKDGKISWDEF | BindI | 35 | IPR018247 | B | pool | IPR020563 | Crossover junction endodeoxyribonuclease RuvC, magnesium-binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR000048 | IQ motif, EF-hand binding site | IPR006093 | Oxygen oxidoreductase covalent FAD-binding site |
Q9LF55 | DVDGDNQIDVAEY | BindI | 35 | IPR018247 | B | pool | IPR020563 | Crossover junction endodeoxyribonuclease RuvC, magnesium-binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR000048 | IQ motif, EF-hand binding site | IPR006093 | Oxygen oxidoreductase covalent FAD-binding site |
Q9LF55 | DIDGDGKISASEI | BindI | 35 | IPR018247 | B | pool | IPR020563 | Crossover junction endodeoxyribonuclease RuvC, magnesium-binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR000048 | IQ motif, EF-hand binding site | IPR006093 | Oxygen oxidoreductase covalent FAD-binding site |
Q9LF55 | DADGDGFVSFEEF | BindI | 35 | IPR018247 | B | pool | IPR020563 | Crossover junction endodeoxyribonuclease RuvC, magnesium-binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR000048 | IQ motif, EF-hand binding site | IPR006093 | Oxygen oxidoreductase covalent FAD-binding site |
A0A125YZN2 | DTDGSGMIDPKEL | BindI | 35 | IPR018247 | B | pool | IPR025943 | Sigma-54 interaction domain, ATP-binding site 2 | IPR018247 | EF-Hand 1, calcium-binding site | IPR020855 | Ureohydrolase, manganese-binding site | IPR025662 | Sigma-54 interaction domain, ATP-binding site 1 |
A0A125YZN2 | DSNGDGEISFEDF | BindI | 35 | IPR018247 | B | pool | IPR025943 | Sigma-54 interaction domain, ATP-binding site 2 | IPR018247 | EF-Hand 1, calcium-binding site | IPR020855 | Ureohydrolase, manganese-binding site | IPR025662 | Sigma-54 interaction domain, ATP-binding site 1 |
P23120 | IHMLSLSGHKLHRKGVGVL | BindI | 52 | IPR020578 | A | pool | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR000048 | IQ motif, EF-hand binding site | IPR018229 | Rhodopsin, retinal binding site | IPR019833 | Manganese/iron superoxide dismutase, binding site |
P48351 | RSFAYADTQ | BindI | 8 | IPR002226 | B | pool | IPR020847 | AP endonuclease 1, binding site | IPR002226 | Catalase haem-binding site | IPR023418 | Transthyretin, thyroxine binding site | IPR003016 | 2-oxo acid dehydrogenase, lipoyl-binding site |
P00272 | IPEDWCCPDCA | BindI | 40 | IPR018527 | A | pool | IPR018527 | Rubredoxin, iron-binding site | IPR020622 | Alanine racemase, pyridoxal-phosphate attachment site | IPR002226 | Catalase haem-binding site | IPR001882 | Biotin-binding site |
P00272 | IPDDWCCPDCG | BindI | 40 | IPR018527 | A | pool | IPR018527 | Rubredoxin, iron-binding site | IPR020622 | Alanine racemase, pyridoxal-phosphate attachment site | IPR002226 | Catalase haem-binding site | IPR001882 | Biotin-binding site |
P40807 | YAVKCNDDPMVVRLLAQLG | BindI | 65 | IPR022653 | B | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR015887 | DNA glycosylase/AP lyase, zinc finger domain, DNA-binding site | IPR021158 | Peptidase M10A, cysteine switch, zinc binding site |
O35887 | DDDKDGFVTVDEL | BindI | 35 | IPR018247 | D | pool | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR000634 | Serine/threonine dehydratase, pyridoxal-phosphate-binding site | IPR018247 | EF-Hand 1, calcium-binding site |
O35887 | DLNEDGLVSWEEY | BindI | 35 | IPR018247 | D | pool | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR000634 | Serine/threonine dehydratase, pyridoxal-phosphate-binding site | IPR018247 | EF-Hand 1, calcium-binding site |
O35887 | DKNADGFIDLEEY | BindI | 35 | IPR018247 | D | pool | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR000634 | Serine/threonine dehydratase, pyridoxal-phosphate-binding site | IPR018247 | EF-Hand 1, calcium-binding site |
O35887 | DQNKDGKLTKEEI | BindI | 35 | IPR018247 | D | pool | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR000634 | Serine/threonine dehydratase, pyridoxal-phosphate-binding site | IPR018247 | EF-Hand 1, calcium-binding site |
A2BX41 | GSGKASKKEVIEAVMFNLNLNYAPKPDDSADALAIA | BindI | 51 | IPR020563 | A | pool | IPR020563 | Crossover junction endodeoxyribonuclease RuvC, magnesium-binding site | IPR018195 | Transferrin family, iron binding site | IPR006058 | 2Fe-2S ferredoxin, iron-sulphur binding site | IPR021158 | Peptidase M10A, cysteine switch, zinc binding site |
P30265 | RLFGYKDAE | BindI | 8 | IPR002226 | B | pool | IPR001431 | Peptidase M16, zinc-binding site | IPR002226 | Catalase haem-binding site | IPR025662 | Sigma-54 interaction domain, ATP-binding site 1 | IPR006184 | 6-phosphogluconate-binding site |
O01775 | VGRGAFGVCWLCRGKNDASHQKVIIK | BindI | 25 | IPR017441 | A | pool | IPR017441 | Protein kinase, ATP binding site | IPR025735 | RIP homotypic interaction motif | IPR022653 | Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site | IPR020826 | Transketolase binding site |
A4IF97 | DQNRDGFIDKEDL | BindI | 35 | IPR018247 | A | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR002226 | Catalase haem-binding site |
A5EW54 | VVLKADAYGHG | BindI | 54 | IPR020622 | C | pool | IPR018247 | EF-Hand 1, calcium-binding site | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR020622 | Alanine racemase, pyridoxal-phosphate attachment site | IPR018506 | Cytochrome b5, heme-binding site |
P35489 | GDKVKEGETLVIVETDKVNAELPSPVDGTI | BindI | 10 | IPR003016 | B | pool | IPR023418 | Transthyretin, thyroxine binding site | IPR003016 | 2-oxo acid dehydrogenase, lipoyl-binding site | IPR004838 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR019843 | DNA polymerase family X, binding site |
P35489 | GDKVKEGETLVVVETDKVNAELPSPVDGTI | BindI | 10 | IPR003016 | B | pool | IPR023418 | Transthyretin, thyroxine binding site | IPR003016 | 2-oxo acid dehydrogenase, lipoyl-binding site | IPR004838 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR019843 | DNA polymerase family X, binding site |
P11542 | ETVWLLSAHSI | BindI | 43 | IPR019793 | B | pool | IPR016192 | APOBEC/CMP deaminase, zinc-binding | IPR019793 | Peroxidases heam-ligand binding site | IPR027467 | Molybdopterin oxidoreductase, molybdopterin cofactor binding site | IPR019780 | Germin, manganese binding site |
Q9DD78 | DASANNFICSCEF | BindI | 35 | IPR018247 | B | pool | IPR015887 | DNA glycosylase/AP lyase, zinc finger domain, DNA-binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR019843 | DNA polymerase family X, binding site | IPR020847 | AP endonuclease 1, binding site |
Q2W3L2 | TFSKGLGSFG | BindI | 7 | IPR001917 | C | pool | IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site | IPR018298 | Adrenodoxin, iron-sulphur binding site | IPR001917 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR020537 | ATP synthase, F0 complex, subunit C, DCCD-binding site |
Q54QT9 | DLNKDGSVTSFDI | BindI | 35 | IPR018247 | C | pool | IPR006058 | 2Fe-2S ferredoxin, iron-sulphur binding site | IPR019798 | Serine hydroxymethyltransferase, pyridoxal phosphate binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR018064 | Metallothionein, vertebrate, metal binding site |
Q54QT9 | DKDKDKKLTKTEF | BindI | 35 | IPR018247 | C | pool | IPR006058 | 2Fe-2S ferredoxin, iron-sulphur binding site | IPR019798 | Serine hydroxymethyltransferase, pyridoxal phosphate binding site | IPR018247 | EF-Hand 1, calcium-binding site | IPR018064 | Metallothionein, vertebrate, metal binding site |
B5ER47 | TRQPEMRPQLLVNTFIFAGLME | BindI | 50 | IPR020537 | D | pool | IPR018064 | Metallothionein, vertebrate, metal binding site | IPR019843 | DNA polymerase family X, binding site | IPR020789 | RNA polymerases, subunit N, zinc binding site | IPR020537 | ATP synthase, F0 complex, subunit C, DCCD-binding site |
Q75K28 | DIDGNGYITRSEM | BindI | 35 | IPR018247 | C | pool | IPR002355 | Multicopper oxidase, copper-binding site | IPR001505 | Copper centre Cu(A) | IPR018247 | EF-Hand 1, calcium-binding site | IPR019807 | Hexokinase, binding site |
Q75K28 | DDDGDGYISLEEY | BindI | 35 | IPR018247 | C | pool | IPR002355 | Multicopper oxidase, copper-binding site | IPR001505 | Copper centre Cu(A) | IPR018247 | EF-Hand 1, calcium-binding site | IPR019807 | Hexokinase, binding site |
O36021 | DRDEEGEIDEDEV | BindI | 35 | IPR018247 | D | pool | IPR006093 | Oxygen oxidoreductase covalent FAD-binding site | IPR018136 | Aconitase family, 4Fe-4S cluster binding site | IPR020833 | Lipoxygenase, iron binding site | IPR018247 | EF-Hand 1, calcium-binding site |
P11053 | CHSGSCSSC | BindI | 15 | IPR006058 | B | pool | IPR018195 | Transferrin family, iron binding site | IPR006058 | 2Fe-2S ferredoxin, iron-sulphur binding site | IPR034408 | Sulphate/thiosulphate-binding site | IPR019780 | Germin, manganese binding site |
Q03002 | LGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIK | BindI | 25 | IPR017441 | C | pool | IPR000048 | IQ motif, EF-hand binding site | IPR019843 | DNA polymerase family X, binding site | IPR017441 | Protein kinase, ATP binding site | IPR017947 | Aryldialkylphosphatase, zinc-binding site |
A0JVG9 | GPDGASHHGMWDMAMVQ | BindI | 56 | IPR020826 | A | pool | IPR020826 | Transketolase binding site | IPR000048 | IQ motif, EF-hand binding site | IPR004163 | Coenzyme A transferase binding site | IPR018301 | Aromatic amino acid hydroxylase, iron/copper binding site |
VenusX Fragment MCQ — BindI (MF50)
4-choice multiple-choice question reformulation of the VenusX Fragment-level BindI sub-task from the paper VenusX: Unlocking Fine-Grained Functional Understanding of Proteins (ICLR 2026).
This fork adapts the original N-way classification task into a 4-choice MCQ so that zero-shot LLMs can be evaluated fairly. The original task required the model to output one of 76 InterPro class labels—infeasible for a CausalLM that cannot know which IPR IDs are in the benchmark's label subspace.
Schema
Each sample is one multiple-choice question with exactly one correct answer.
| Field | Type | Description |
|---|---|---|
uid |
str | Original VenusX sample UID |
seq_fragment |
str | The protein fragment amino acid sequence |
annotation |
str | "BindI" (sub-task name) |
interpro_label |
int | Original VenusX integer label (preserved for compatibility) |
correct_ipr |
str | The correct InterPro accession (e.g. IPR000169) |
correct_letter |
str | "A" / "B" / "C" / "D" — the letter whose option matches correct_ipr |
option_{a,b,c,d}_ipr |
str | InterPro accession for each option |
option_{a,b,c,d}_desc |
str | Human-readable description from InterPro entry.list |
distractor_source |
str | How the 3 distractors were picked: hierarchy, mixed, or pool (see below) |
How the MCQ is constructed
For each sample, we start with one golden InterPro ID (the original label) and pick 3 distractors via a 2-tier fallback:
- Tier 1 — InterPro hierarchy siblings: If the golden IPR is in the InterPro hierarchy tree, take true siblings (same parent, not the golden itself, not any ancestor/descendant of the golden). We use up to 3.
- Tier 2 — Same sub-task label pool (random): Fill the remaining slots by random sampling from the full label pool of the same sub-task, excluding the golden, all its ancestors/descendants, and any Tier 1 picks.
All 4 options (1 golden + 3 distractors) are then shuffled to randomize
letter positions (A/B/C/D), using a deterministic per-sample seed derived
from {annotation}:{split}:{uid}:{golden} so every dataset build is
bit-identical and reviewers can independently verify each MCQ.
The distractor_source column records which strategy was used:
hierarchy— all 3 distractors are InterPro siblingsmixed— some are siblings, some are random pool samplespool— all 3 are random pool samples (most common forActive_site/Binding_site/Conserved_sitetypes, which have no InterPro hierarchy per EBI convention)
Why descriptions are included
The original free-text task expected the LLM to directly output an IPR ID like
IPR019757. This is unfair because the LLM has no way to know which specific
IPRs are in the benchmark's small label subspace. Our MCQ format exposes the
4 candidate options with human-readable names (e.g.
IPR019757 — Peptidase S26A, signal peptidase I, lysine active site) so that
the LLM can use its biological knowledge to match the fragment's features
against the candidate functional descriptions.
Example
Fragment: IHCIAGLGRTP
A) IPR033694 — Pyroglutamyl peptidase I, Cys active site
B) IPR023411 — Ribonuclease A, active site
C) IPR016130 — Protein-tyrosine phosphatase, active site ← correct
D) IPR000169 — Cysteine peptidase, cysteine active site
[ANSWER]C[/ANSWER]
Build Reproducibility
This dataset is fully reproducible from the included build scripts and reference files:
scripts/
parse_interpro.py # Parses InterPro flat files into a queryable cache
build_mcq.py # Builds MCQ samples with 2-tier distractor fallback
reference/
entry.list # InterPro entries dump (downloaded 2026-04-09)
ParentChildTreeFile.txt # InterPro hierarchy tree (downloaded 2026-04-09)
label_pool.json # Union label pool across all 5 sub-tasks
To rebuild:
# 1. Refresh InterPro flat files (optional — pinned versions included)
curl -O https://ftp.ebi.ac.uk/pub/databases/interpro/current_release/entry.list
curl -O https://ftp.ebi.ac.uk/pub/databases/interpro/current_release/ParentChildTreeFile.txt
# 2. Parse into cache
python scripts/parse_interpro.py
# 3. Build MCQ (loads original VenusX Fragment datasets from AI4Protein/*)
python scripts/build_mcq.py
Known Limitations
Distractors are automatically generated, not peer-reviewed. Unlike MMLU or MedMCQA whose distractors are human-written by exam boards, our distractors come from random sampling / hierarchy traversal. Some may be too easy (e.g. a completely unrelated domain for a specific active site), inflating accuracy.
InterPro hierarchy coverage is low for
Active_site,Binding_site,Conserved_site, andRepeatentry types — EBI does not arrange these into hierarchies. As a result, Tier 1 (sibling-based) distractors only apply to a minority of samples (seedistractor_sourcecolumn for each sample's strategy).Random baseline is 25% (not 1/N of the original label space). Accuracy numbers from this MCQ benchmark should be interpreted against this 25% baseline, not the paper's full-label-space accuracy.
interpro_labelfield is preserved for traceability but not used in MCQ scoring. MCQ scoring comparespred_lettertocorrect_letter.Not comparable to VenusX paper Table 4 numbers. The paper reports ESM2 probe accuracy on the full label space; we report LLM accuracy on a 4-way MCQ. Same metric name (ACC), different semantics.
Citation
If you use this MCQ-reformulated dataset, please cite both the original VenusX paper and this fork:
@inproceedings{venusx2026,
title={VenusX: Unlocking Fine-Grained Functional Understanding of Proteins},
author={Tan, Yang and others},
booktitle={ICLR},
year={2026},
url={https://arxiv.org/abs/2505.11812}
}
References
The MCQ reformulation methodology draws from the following literature:
- Hendrycks et al., Measuring Massive Multitask Language Understanding (MMLU), ICLR 2021
- Pal et al., MedMCQA: A Large-scale Multi-Subject Multi-Choice Dataset for Medical domain Question Answering, CHIL 2022. https://arxiv.org/abs/2203.14371
- El-Sanyoury et al., Automatic distractor generation in multiple-choice questions: a systematic literature review, PeerJ Computer Science 2024. https://pmc.ncbi.nlm.nih.gov/articles/PMC11623049/
- Susanti, Iida & Tokunaga, Automatic Generation of English Vocabulary Tests (WordNet-based distractor), CSEDU 2015
- Gene Ontology sibling negatives: Frontiers in Genetics 2020, BMC Bioinformatics 2009
License
Derived from VenusX (AI4Protein). InterPro data is licensed CC-BY-4.0 from EMBL-EBI. This fork is released under CC-BY-4.0.
Contact
Built by hauser7733 as part of the SiEval evaluation framework. Questions or issues: open an issue at the SiEval repo.
- Downloads last month
- 9