Datasets:
uid stringlengths 6 10 | seq_fragment stringlengths 5 122 | annotation stringclasses 1
value | interpro_label int64 0 738 | correct_ipr stringclasses 733
values | correct_letter stringclasses 4
values | distractor_source stringclasses 1
value | option_a_ipr stringclasses 739
values | option_a_desc stringclasses 739
values | option_b_ipr stringclasses 739
values | option_b_desc stringclasses 739
values | option_c_ipr stringclasses 739
values | option_c_desc stringclasses 739
values | option_d_ipr stringclasses 739
values | option_d_desc stringclasses 739
values |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
P14681 | FSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNC | Evo | 88 | IPR003527 | A | pool | IPR003527 | Mitogen-activated protein (MAP) kinase, conserved site | IPR018268 | Small ribosomal subunit protein uS10, conserved site | IPR006105 | Cereal seed allergen/trypsin and alpha-amylase inhibitor, conserved site | IPR018493 | Gas vesicle protein A-like, conserved site |
A0AEM1 | GKRRLAYEIN | Evo | 541 | IPR020815 | C | pool | IPR017983 | GPCR, family 2, secretin-like, conserved site | IPR020119 | Pseudouridine synthase TruD, conserved site | IPR020815 | Small ribosomal subunit protein bS6, conserved site | IPR018237 | Myelin proteolipid protein PLP, conserved site |
P27133 | AVTSSGDFLVKTWDV | Evo | 440 | IPR019775 | C | pool | IPR018314 | RsmB/NOL1/NOP2-like, conserved site | IPR018313 | Solute-binding protein family 3, conserved site | IPR019775 | WD40 repeat, conserved site | IPR018293 | 43kDa postsynaptic, conserved site |
Q5J1R3 | MIGVTRRSGLALAVLVSSAACAGAEPVAPPPAPA | Evo | 132 | IPR006311 | C | pool | IPR021184 | Tumour necrosis factor, conserved site | IPR030659 | SecY conserved site | IPR006311 | Twin-arginine translocation pathway, signal sequence | IPR006216 | Photosystem II cytochrome b559, conserved site |
Q6GLD9 | CHHTYCLACI | Evo | 204 | IPR017907 | B | pool | IPR049946 | Large ribosomal subunit protein bL20, conserved site | IPR017907 | Zinc finger, RING-type, conserved site | IPR030391 | RNA methyltransferase TrmA, conserved site | IPR018240 | Clathrin adaptor, mu subunit, conserved site |
Q5KQL9 | RQIGNAVAVPVGRALGYAL | Evo | 669 | IPR031303 | B | pool | IPR020903 | Epithelial sodium channel, conserved site | IPR031303 | DNA methylase, C-5 cytosine-specific, conserved site | IPR002364 | Quinone oxidoreductase/zeta-crystallin, conserved site | IPR018078 | DNA-binding, RecF, conserved site |
Q8IZF3 | RAQCVGWHSKKRRWDEKACQMMLDIRNEVKCRCNYTSVVMSFSILMSSKSM | Evo | 6 | IPR000203 | D | pool | IPR023772 | DNA-binding HTH domain, TetR-type, conserved site | IPR027302 | Glutamine synthetase, N-terminal conserved site | IPR019767 | Erythropoietin/thrombopoeitin, conserved site | IPR000203 | GPS motif |
Q54J23 | KLAKIGTVRKAIARV | Evo | 327 | IPR018254 | B | pool | IPR018043 | Sodium:galactoside symporter, conserved site | IPR018254 | Large ribosomal subunit protein uL29, conserved site | IPR000059 | NUDIX hydrolase, NudL, conserved site | IPR020728 | Apoptosis regulator, Bcl-2, BH3 motif, conserved site |
A7HBP6 | IVTTTPKAKELKRFADKVITLAK | Evo | 707 | IPR047859 | A | pool | IPR047859 | Large ribosomal subunit protein bL17, conserved site | IPR019771 | F-actin capping protein, beta subunit, conserved site | IPR012323 | Cyclotide, bracelet, conserved site | IPR000203 | GPS motif |
B4EUF2 | LDMFPQTGHLE | Evo | 648 | IPR030391 | D | pool | IPR015875 | IMP dehydrogenase / GMP reductase, conserved site | IPR001014 | Large ribosomal subunit protein uL23, conserved site | IPR005829 | Sugar transporter, conserved site | IPR030391 | RNA methyltransferase TrmA, conserved site |
Q9KS67 | TGIPLVDACMRCL | Evo | 387 | IPR018394 | A | pool | IPR018394 | Cryptochrome/DNA photolyase class 1, conserved site, C-terminal | IPR018238 | Glycoside hydrolase, family 14, conserved site | IPR000838 | RNA polymerase sigma factor 70, ECF, conserved site | IPR020717 | Apoptosis regulator, Bcl-2, BH1 motif, conserved site |
Q21455 | SGPGSDFLGRKKIIIGAS | Evo | 110 | IPR005829 | A | pool | IPR005829 | Sugar transporter, conserved site | IPR020423 | Interleukin-10, conserved site | IPR017865 | F-actin capping protein, alpha subunit, conserved site | IPR004037 | Large ribosomal subunit protein eL8-like, conserved site |
Q21455 | LLGLAIGFASMIVPIYVSEASPSHIR | Evo | 110 | IPR005829 | A | pool | IPR005829 | Sugar transporter, conserved site | IPR020423 | Interleukin-10, conserved site | IPR017865 | F-actin capping protein, alpha subunit, conserved site | IPR004037 | Large ribosomal subunit protein eL8-like, conserved site |
Q983J7 | GHEFVGTVADFGAAV | Evo | 77 | IPR002328 | B | pool | IPR017985 | DNA methylase, N-4 cytosine-specific, conserved site | IPR002328 | Alcohol dehydrogenase, zinc-type, conserved site | IPR030473 | Interleukin-6/GCSF/MGF, conserved site | IPR022353 | Insulin, conserved site |
P54688 | EVGTMNIFLFWKNEEGDMELITPPLHRGLILPGVTR | Evo | 358 | IPR018300 | B | pool | IPR002194 | Chaperonin TCP-1, conserved site | IPR018300 | Aminotransferase, class IV, conserved site | IPR018232 | Glycoside hydrolase, family 37, conserved site | IPR001562 | Zinc finger, Btk motif |
A0A396ISC0 | SGGGTADRCIRFWNT | Evo | 440 | IPR019775 | A | pool | IPR019775 | WD40 repeat, conserved site | IPR000629 | ATP-dependent RNA helicase DEAD-box, conserved site | IPR021164 | Tyrosine hydroxylase, conserved site | IPR018066 | Tubby, C-terminal, conserved site |
A0A396ISC0 | IVTGAGDETLRFWNV | Evo | 440 | IPR019775 | A | pool | IPR019775 | WD40 repeat, conserved site | IPR000629 | ATP-dependent RNA helicase DEAD-box, conserved site | IPR021164 | Tyrosine hydroxylase, conserved site | IPR018066 | Tubby, C-terminal, conserved site |
P48353 | FKVINRAFEVLSNEEKRSIY | Evo | 326 | IPR018253 | C | pool | IPR018526 | Glycoside hydrolase, family 29, conserved site | IPR049555 | GDT1-like, conserved site | IPR018253 | DnaJ domain, conserved site | IPR022631 | S-adenosylmethionine synthetase, conserved site |
O34720 | CVSCGHCSTVCP | Evo | 203 | IPR017900 | C | pool | IPR019844 | Cold-shock domain, conserved site | IPR003903 | Ubiquitin interacting motif | IPR017900 | 4Fe-4S ferredoxin, iron-sulphur binding, conserved site | IPR018253 | DnaJ domain, conserved site |
P69834 | VCIHDSAR | Evo | 354 | IPR018294 | B | pool | IPR003006 | Immunoglobulin/major histocompatibility complex, conserved site | IPR018294 | 4-diphosphocytidyl-2C-methyl-D-erythritol synthase, conserved site | IPR000957 | Sulphate/thiosulphate-binding, conserved site | IPR018071 | Omega-atracotoxin, conserved site |
A0RQU8 | MRDLLECGVHFG | Evo | 283 | IPR018130 | C | pool | IPR022658 | XPA, conserved site | IPR030476 | Pentaxin, conserved site | IPR018130 | Small ribosomal subunit protein uS2, conserved site | IPR023151 | PEP-utilising enzyme, conserved site |
A0RQU8 | PDMVFVIDTVKEKIAVAEANKLRMP | Evo | 283 | IPR018130 | C | pool | IPR022658 | XPA, conserved site | IPR030476 | Pentaxin, conserved site | IPR018130 | Small ribosomal subunit protein uS2, conserved site | IPR023151 | PEP-utilising enzyme, conserved site |
A0AK45 | ELVLVKDIRFSSMCEHH | Evo | 315 | IPR018234 | D | pool | IPR018257 | Large ribosomal subunit protein bL19, conserved site | IPR018072 | Conotoxin, alpha-type, conserved site | IPR018255 | Large ribosomal subunit protein uL16, conserved site, eukaryota/archaea | IPR018234 | GTP cyclohydrolase I, conserved site |
A0AK45 | SKRPQLQERIT | Evo | 315 | IPR018234 | D | pool | IPR018257 | Large ribosomal subunit protein bL19, conserved site | IPR018072 | Conotoxin, alpha-type, conserved site | IPR018255 | Large ribosomal subunit protein uL16, conserved site, eukaryota/archaea | IPR018234 | GTP cyclohydrolase I, conserved site |
B3LVW5 | HDLDHRGTNNAF | Evo | 598 | IPR023174 | A | pool | IPR023174 | 3'5'-cyclic nucleotide phosphodiesterase, conserved site | IPR018103 | Translationally controlled tumour protein, conserved site | IPR030491 | TATA-box binding protein, conserved site | IPR018062 | HTH domain AraC-type, conserved site |
P15281 | RTIKIGKYIVETKKTVRVIAKEFGVSKSTVHKDL | Evo | 370 | IPR018356 | A | pool | IPR018356 | Transcription regulator, HTH DeoR-type, conserved site | IPR031157 | Tr-type G domain, conserved site | IPR020538 | Hydrogenase nickel incorporation protein HypA/HybF, conserved site | IPR001468 | Indole-3-glycerol phosphate synthase, conserved site |
A0A2I4HXH5 | LTILHTNDVHARL | Evo | 125 | IPR006146 | B | pool | IPR018237 | Myelin proteolipid protein PLP, conserved site | IPR006146 | 5'-Nucleotidase, conserved site | IPR017866 | Succinyl-CoA synthetase, beta subunit, conserved site | IPR047861 | Small ribosomal subunit protein eS7, conserved site |
A0A2I4HXH5 | YDAMALGNHEFD | Evo | 125 | IPR006146 | B | pool | IPR018237 | Myelin proteolipid protein PLP, conserved site | IPR006146 | 5'-Nucleotidase, conserved site | IPR017866 | Succinyl-CoA synthetase, beta subunit, conserved site | IPR047861 | Small ribosomal subunit protein eS7, conserved site |
Q13I12 | LSQGQRRRVALARLM | Evo | 199 | IPR017871 | C | pool | IPR000291 | D-alanine--D-alanine ligase/VANA/B/C, conserved site | IPR000486 | Extradiol ring-cleavage dioxygenase, class I /II | IPR017871 | ABC transporter-like, conserved site | IPR023187 | Transcriptional regulator MarR-type, conserved site |
Q74MJ5 | ITGGSDIAGFPM | Evo | 351 | IPR018282 | A | pool | IPR018282 | Small ribosomal subunit protein eS6, conserved site | IPR018359 | Bromodomain, conserved site | IPR018467 | CO/COL/TOC1, conserved site | IPR018483 | Carbohydrate kinase, FGGY, conserved site |
Q7UU71 | RDREEAALMEVSRRPQHVIALGGGTI | Evo | 592 | IPR023000 | C | pool | IPR023409 | 14-3-3 protein, conserved site | IPR002359 | Large ribosomal subunit protein uL6, conserved site-2 | IPR023000 | Shikimate kinase, conserved site | IPR023997 | TonB-dependent outer membrane protein SusC/RagA, conserved site |
O95931 | PPWTPALPSSEVTVTDITANSITVTFREAQA | Evo | 686 | IPR033773 | C | pool | IPR002365 | Terpene synthase, conserved site | IPR027302 | Glutamine synthetase, N-terminal conserved site | IPR033773 | CBX family C-terminal motif | IPR019790 | Xylulose 5-phosphate/Fructose 6-phosphate phosphoketolase, conserved site |
Q8RGD9 | INLEIKIDKDILGGGIIKIG | Evo | 534 | IPR020781 | D | pool | IPR019778 | Class I Hydrophobin, conserved site | IPR055265 | Photosynthetic reaction centre, L/M, conserved site | IPR019846 | Nerve growth factor conserved site | IPR020781 | ATPase, OSCP/delta subunit, conserved site |
Q975I3 | KKAYVKLKKEFNASDI | Evo | 30 | IPR001014 | D | pool | IPR019813 | Translation initiation factor 3, conserved site | IPR030472 | Tissue factor, conserved site | IPR028626 | Ribosomal protein eS28 conserved site | IPR001014 | Large ribosomal subunit protein uL23, conserved site |
Q50HM6 | MNDAAPQNPGQDEAKGTGEKDNGGSMSPRSALRTTAGVAGAGLGLSALGTGTASA | Evo | 132 | IPR006311 | C | pool | IPR019744 | Amyloidogenic glycoprotein, copper-binding domain conserved site | IPR018314 | RsmB/NOL1/NOP2-like, conserved site | IPR006311 | Twin-arginine translocation pathway, signal sequence | IPR035090 | Phosphorylase pyridoxal-phosphate attachment site |
Q9TLV1 | IRSFQTSGLQIISIKDITSVPFN | Evo | 271 | IPR018102 | C | pool | IPR023772 | DNA-binding HTH domain, TetR-type, conserved site | IPR049024 | AIR2-like, CCHC-type 1 zinc finger 4 | IPR018102 | Small ribosomal subunit protein uS11, conserved site | IPR018048 | CXC chemokine, conserved site |
O27880 | CRGCSVCLQICP | Evo | 203 | IPR017900 | C | pool | IPR014034 | Ferritin, conserved site | IPR011062 | Contryphan, conserved site | IPR017900 | 4Fe-4S ferredoxin, iron-sulphur binding, conserved site | IPR018269 | Small ribosomal subunit protein uS13, conserved site |
P05545 | LNFNRPFMLVI | Evo | 622 | IPR023795 | A | pool | IPR023795 | Serpin, conserved site | IPR022353 | Insulin, conserved site | IPR008284 | Molybdenum cofactor biosynthesis, conserved site | IPR020084 | NUDIX hydrolase, conserved site |
A0A2P1BSS8 | GCAVTCPKPKKDETFQCCLKN | Evo | 369 | IPR018354 | C | pool | IPR019808 | Histidine triad, conserved site | IPR018366 | Carbohydrate-binding type-2, conserved site | IPR018354 | Snake toxin, conserved site | IPR018267 | Large ribosomal subunit protein eL37, conserved site |
Q7VQJ0 | KYGTPTMGGIIIL | Evo | 392 | IPR018480 | B | pool | IPR020937 | SecA conserved site | IPR018480 | Phospho-N-acetylmuramoyl-pentapeptide transferase, conserved site | IPR006686 | Mechanosensitive ion channel MscS, conserved site | IPR017860 | Peptidase M22, conserved site |
Q7VQJ0 | NSVNLSDGLDGL | Evo | 392 | IPR018480 | B | pool | IPR020937 | SecA conserved site | IPR018480 | Phospho-N-acetylmuramoyl-pentapeptide transferase, conserved site | IPR006686 | Mechanosensitive ion channel MscS, conserved site | IPR017860 | Peptidase M22, conserved site |
O88573 | LVVKITLDLLTRIPQ | Evo | 696 | IPR043639 | D | pool | IPR004001 | Actin, conserved site | IPR006074 | GTP1/OBG, conserved site | IPR013373 | Flagellin/pilin, N-terminal site, archaea | IPR043639 | AF4 interaction motif |
O52485 | AETGGMNA | Evo | 642 | IPR029510 | C | pool | IPR006105 | Cereal seed allergen/trypsin and alpha-amylase inhibitor, conserved site | IPR018072 | Conotoxin, alpha-type, conserved site | IPR029510 | Aldehyde dehydrogenase, glutamic acid active site | IPR032831 | LPS-assembly lipoprotein LptM, conserved region |
A1B031 | NGQKHIPVSVTEEMIGQKFGEYSPT | Evo | 561 | IPR020934 | D | pool | IPR018267 | Large ribosomal subunit protein eL37, conserved site | IPR015912 | Phosphofructokinase, conserved site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 | IPR020934 | Small ribosomal subunit protein uS19, conserved site |
A0A1D8PPS1 | KKAYIRLTSDYDALDI | Evo | 30 | IPR001014 | D | pool | IPR018357 | Hexapeptide transferase, conserved site | IPR018371 | Chitin-binding, type 1, conserved site | IPR048254 | CDP-alcohol phosphatidyltransferase, conserved site | IPR001014 | Large ribosomal subunit protein uL23, conserved site |
P02876 | CPNNLCCSQYGYCGMGGDYC | Evo | 383 | IPR018371 | C | pool | IPR019821 | Kinesin motor domain, conserved site | IPR000111 | Glycoside hydrolase family 27/36, conserved site | IPR018371 | Chitin-binding, type 1, conserved site | IPR019845 | Squalene/phytoene synthase, conserved site |
P02876 | CPNNHCCSQYGHCGFGAEYC | Evo | 383 | IPR018371 | C | pool | IPR019821 | Kinesin motor domain, conserved site | IPR000111 | Glycoside hydrolase family 27/36, conserved site | IPR018371 | Chitin-binding, type 1, conserved site | IPR019845 | Squalene/phytoene synthase, conserved site |
P02876 | CPNNLCCSQWGFCGLGSEFC | Evo | 383 | IPR018371 | C | pool | IPR019821 | Kinesin motor domain, conserved site | IPR000111 | Glycoside hydrolase family 27/36, conserved site | IPR018371 | Chitin-binding, type 1, conserved site | IPR019845 | Squalene/phytoene synthase, conserved site |
P02876 | CTNNYCCSKWGSCGIGPGYC | Evo | 383 | IPR018371 | C | pool | IPR019821 | Kinesin motor domain, conserved site | IPR000111 | Glycoside hydrolase family 27/36, conserved site | IPR018371 | Chitin-binding, type 1, conserved site | IPR019845 | Squalene/phytoene synthase, conserved site |
A0KIP8 | GANIEVVDVGGGLG | Evo | 584 | IPR022657 | C | pool | IPR030934 | Intein C-terminal splicing region | IPR018073 | Proteinase inhibitor I25, cystatin, conserved site | IPR022657 | Orn/DAP/Arg decarboxylase 2, conserved site | IPR030513 | Dehydrin, conserved site |
A7YT82 | EINFLCVHK | Evo | 589 | IPR022678 | A | pool | IPR022678 | Glycylpeptide N-tetradecanoyltransferase, conserved site | IPR017872 | Pyrimidine-nucleoside phosphorylase, conserved site | IPR019744 | Amyloidogenic glycoprotein, copper-binding domain conserved site | IPR030491 | TATA-box binding protein, conserved site |
A7YT82 | KFGIGDG | Evo | 589 | IPR022678 | A | pool | IPR022678 | Glycylpeptide N-tetradecanoyltransferase, conserved site | IPR017872 | Pyrimidine-nucleoside phosphorylase, conserved site | IPR019744 | Amyloidogenic glycoprotein, copper-binding domain conserved site | IPR030491 | TATA-box binding protein, conserved site |
Q21CV6 | LSAGQRRRLSLARLT | Evo | 199 | IPR017871 | A | pool | IPR017871 | ABC transporter-like, conserved site | IPR018268 | Small ribosomal subunit protein uS10, conserved site | IPR030489 | Transcription regulator Rrf2-type, conserved site | IPR017970 | Homeobox, conserved site |
B2UP25 | RCLVSGRRRAFIRRFKLSRISFR | Evo | 343 | IPR018271 | B | pool | IPR018483 | Carbohydrate kinase, FGGY, conserved site | IPR018271 | Small ribosomal subunit protein uS14, conserved site | IPR033136 | NAD-dependent DNA ligase, conserved site | IPR018186 | Transcription factor, T-box, conserved site |
Q95PX3 | LWSTFLECGTEMIITKKGRR | Evo | 295 | IPR018186 | D | pool | IPR001014 | Large ribosomal subunit protein uL23, conserved site | IPR016160 | Aldehyde dehydrogenase, cysteine active site | IPR001479 | Quinoprotein dehydrogenase, conserved site | IPR018186 | Transcription factor, T-box, conserved site |
Q95PX3 | VHPQSPRSGEWWMTDGVDF | Evo | 295 | IPR018186 | D | pool | IPR001014 | Large ribosomal subunit protein uL23, conserved site | IPR016160 | Aldehyde dehydrogenase, cysteine active site | IPR001479 | Quinoprotein dehydrogenase, conserved site | IPR018186 | Transcription factor, T-box, conserved site |
P0A0L9 | KKNVTLQELDIKIRKILSDKYKIY | Evo | 123 | IPR006126 | B | pool | IPR031372 | CAMSAP, spectrin and Ca2+/calmodulin-binding region | IPR006126 | Staphylococcal enterotoxin/Streptococcal pyrogenic exotoxin, conserved site | IPR019830 | Malate synthase, conserved site | IPR003532 | Short hematopoietin receptor, family 2, conserved site |
A0R610 | SAAGERVRRSNFVYGSTKAGLDGFYLGLG | Evo | 558 | IPR020904 | A | pool | IPR020904 | Short-chain dehydrogenase/reductase, conserved site | IPR017977 | Zona pellucida domain, conserved site | IPR001989 | Radical-activating enzyme, conserved site | IPR018102 | Small ribosomal subunit protein uS11, conserved site |
A3CWL5 | MIPLEVIVRNVAAGS | Evo | 317 | IPR018236 | B | pool | IPR002328 | Alcohol dehydrogenase, zinc-type, conserved site | IPR018236 | SAICAR synthetase, conserved site | IPR023058 | Peptidyl-prolyl cis-trans isomerase, PpiC-type, conserved site | IPR019802 | Glycoside hydrolase, family 4, conserved site |
Q93YP7 | NDLLDQDIDTKVDRTKLRPIASG | Evo | 652 | IPR030470 | B | pool | IPR018300 | Aminotransferase, class IV, conserved site | IPR030470 | UbiA prenyltransferase conserved site | IPR005918 | Conantokin, conserved site | IPR018212 | Sodium/solute symporter, conserved site |
A0AK12 | EIIELHHDNKLDAPSGTA | Evo | 587 | IPR022664 | B | pool | IPR045668 | FHF complex subunit HOOK-interacting protein, KELAA motif | IPR022664 | Dihydrodipicolinate reductase, conserved site | IPR014762 | DNA mismatch repair, conserved site | IPR018321 | Glucosamine-6-phosphate isomerase, conserved site |
A1RWQ3 | MPLVGRVLGKYLGPRGKMPQ | Evo | 618 | IPR023673 | B | pool | IPR018267 | Large ribosomal subunit protein eL37, conserved site | IPR023673 | Large ribosomal subunit protein uL1, conserved site | IPR018258 | Large ribosomal subunit protein bL21, conserved site | IPR004001 | Actin, conserved site |
Q4VBI7 | LLDEVRQIEGKVVEISRLQEIFSEKVLQQETEIDSIHQLVV | Evo | 115 | IPR006012 | C | pool | IPR001484 | Pyrokinin, conserved site | IPR018181 | Heat shock protein 70, conserved site | IPR006012 | Syntaxin/epimorphin, conserved site | IPR022664 | Dihydrodipicolinate reductase, conserved site |
Q94AI4 | ILVDPPW | Evo | 70 | IPR002052 | D | pool | IPR012322 | Conotoxin, delta-type, conserved site | IPR018264 | Large ribosomal subunit protein bL33, conserved site | IPR022678 | Glycylpeptide N-tetradecanoyltransferase, conserved site | IPR002052 | DNA methylase, N-6 adenine-specific, conserved site |
Q63556 | VWFNRPFLIAV | Evo | 622 | IPR023795 | B | pool | IPR017891 | Insulin-like growth factor binding protein, N-terminal, Cys-rich conserved site | IPR023795 | Serpin, conserved site | IPR021197 | Cross-wall-targeting lipoprotein motif | IPR001949 | NADH:ubiquinone oxidoreductase, 51kDa subunit, conserved site |
P51123 | VSPFLFPVSAKKVPDYYRVVTKPMDLQTMREYIRQRRYTSREMFLEDLKQIVDNSLIY | Evo | 373 | IPR018359 | D | pool | IPR018483 | Carbohydrate kinase, FGGY, conserved site | IPR047860 | Small ribosomal subunit protein eS12, conserved site | IPR018078 | DNA-binding, RecF, conserved site | IPR018359 | Bromodomain, conserved site |
P51123 | SWPFLKPVNKKQVKDYYTVIKRPMDLETIGKNIEAHRYHSRAEYLADIELIATNCEQY | Evo | 373 | IPR018359 | D | pool | IPR018483 | Carbohydrate kinase, FGGY, conserved site | IPR047860 | Small ribosomal subunit protein eS12, conserved site | IPR018078 | DNA-binding, RecF, conserved site | IPR018359 | Bromodomain, conserved site |
Q97L49 | CGVELVGTEVKSI | Evo | 487 | IPR020081 | D | pool | IPR018493 | Gas vesicle protein A-like, conserved site | IPR018066 | Tubby, C-terminal, conserved site | IPR013139 | Omega-atracotoxin, conserved site-2 | IPR020081 | SsrA-binding protein, conserved site |
A9L937 | EYPWMK | Evo | 60 | IPR001827 | A | pool | IPR001827 | Homeobox protein, antennapedia type, conserved site | IPR020808 | Bacterial microcompartments protein, conserved site | IPR018254 | Large ribosomal subunit protein uL29, conserved site | IPR017703 | YgfZ/CAF17, C-terminal |
P44923 | GLNQLSMLKLAKEANVAAGTIYLYFKNKDELL | Evo | 620 | IPR023772 | D | pool | IPR020877 | Interleukin-1 conserved site | IPR048254 | CDP-alcohol phosphatidyltransferase, conserved site | IPR018073 | Proteinase inhibitor I25, cystatin, conserved site | IPR023772 | DNA-binding HTH domain, TetR-type, conserved site |
Q2S235 | VVRRGAVNRSKLSYLR | Evo | 330 | IPR018257 | B | pool | IPR018255 | Large ribosomal subunit protein uL16, conserved site, eukaryota/archaea | IPR018257 | Large ribosomal subunit protein bL19, conserved site | IPR020717 | Apoptosis regulator, Bcl-2, BH1 motif, conserved site | IPR018101 | Translation elongation factor Ts, conserved site |
P45954 | CLSEAGAGSDSFA | Evo | 119 | IPR006089 | B | pool | IPR018099 | Purine phosphorylase, family 2, conserved site | IPR006089 | Acyl-CoA dehydrogenase, conserved site | IPR010133 | Bacteriocin-type signal sequence | IPR000614 | Free Met sulfoxide reductase conserved site |
P45954 | EWMGGVGYTKDYPVEKYFRD | Evo | 119 | IPR006089 | B | pool | IPR018099 | Purine phosphorylase, family 2, conserved site | IPR006089 | Acyl-CoA dehydrogenase, conserved site | IPR010133 | Bacteriocin-type signal sequence | IPR000614 | Free Met sulfoxide reductase conserved site |
Q4JAN1 | IIPIFVFDGKPPEKK | Evo | 480 | IPR019974 | B | pool | IPR018266 | Large ribosomal subunit protein eL33, conserved site | IPR019974 | XPG conserved site | IPR029162 | TRP-interacting helix, InaF motif | IPR018067 | Protein phosphatase 2A regulatory subunit PR55, conserved site |
P26231 | KALKPEVDKLNIMAAKRQQEL | Evo | 18 | IPR000633 | B | pool | IPR018294 | 4-diphosphocytidyl-2C-methyl-D-erythritol synthase, conserved site | IPR000633 | Vinculin, conserved site | IPR014762 | DNA mismatch repair, conserved site | IPR017967 | HMG box A DNA-binding domain, conserved site |
Q8VYM6 | VDRVLLDAPCSG | Evo | 362 | IPR018314 | A | pool | IPR018314 | RsmB/NOL1/NOP2-like, conserved site | IPR005486 | Glucokinase regulatory protein, conserved site | IPR020605 | Octanoyltransferase, conserved site | IPR018297 | Adenylyl cyclase class-4/guanylyl cyclase, conserved site |
P07245 | EFEVLRYVDQLNEDPHTHGIIVQLPL | Evo | 549 | IPR020867 | D | pool | IPR022966 | Ribonuclease II/R, conserved site | IPR016059 | DNA ligase, ATP-dependent, conserved site | IPR018251 | Crustacean neurohormone, conserved site | IPR020867 | Tetrahydrofolate dehydrogenase/cyclohydrolase, conserved site |
A8YVQ6 | MRHLLGQTLTVYKVPELIFKRD | Evo | 483 | IPR020053 | C | pool | IPR003527 | Mitogen-activated protein (MAP) kinase, conserved site | IPR002173 | Carbohydrate/purine kinase, PfkB, conserved site | IPR020053 | Ribosome-binding factor A, conserved site | IPR005829 | Sugar transporter, conserved site |
Q86A17 | ASAALNRTSGMIAYGATKAATHHIIKDLA | Evo | 558 | IPR020904 | D | pool | IPR001589 | Actinin-type actin-binding domain, conserved site | IPR033986 | Clusterin, conserved site | IPR008143 | Alanine dehydrogenase/pyridine nucleotide transhydrogenase, conserved site-2 | IPR020904 | Short-chain dehydrogenase/reductase, conserved site |
O94039 | RGLSVDAVSAANSGHPGAPLG | Evo | 721 | IPR049557 | A | pool | IPR049557 | Transketolase conserved site | IPR049056 | NAD-glutamate dehydrogenase, helical motif 3 | IPR020834 | Lipoxygenase, conserved site | IPR028626 | Ribosomal protein eS28 conserved site |
O00198 | TAARLKALGDELHQR | Evo | 532 | IPR020728 | C | pool | IPR018321 | Glucosamine-6-phosphate isomerase, conserved site | IPR020895 | Frataxin conserved site | IPR020728 | Apoptosis regulator, Bcl-2, BH3 motif, conserved site | IPR046966 | Glucoamylase, active site |
A5IIK7 | IAEKFNRSHPVVLDSVKRV | Evo | 360 | IPR018312 | D | pool | IPR014029 | NADH:ubiquinone oxidoreductase, 49kDa subunit, conserved site | IPR027310 | Profilin conserved site | IPR013852 | Translation elongation factor P/YeiP, conserved site | IPR018312 | Chromosomal replication control, initiator DnaA, conserved site |
A0KJD4 | QEELLALIDKLNEDADVDGILVQLPL | Evo | 549 | IPR020867 | B | pool | IPR018186 | Transcription factor, T-box, conserved site | IPR020867 | Tetrahydrofolate dehydrogenase/cyclohydrolase, conserved site | IPR023486 | Transcription factor TFIIB, conserved site | IPR023581 | Platelet-derived growth factor, conserved site |
P47618 | PTGRIHLGHV | Evo | 42 | IPR001412 | C | pool | IPR018161 | Wnt protein, conserved site | IPR018230 | BUD31/G10-related, conserved site | IPR001412 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR047864 | Ribosomal protein eS26, conserved site |
A4FV93 | CRNGGQCQDDQGFALNFTCRCLAGF | Evo | 163 | IPR013032 | A | pool | IPR013032 | EGF-like, conserved site | IPR028322 | Proline-rich nuclear receptor coactivator-like, proline rich region | IPR018258 | Large ribosomal subunit protein bL21, conserved site | IPR018192 | Small ribosomal subunit protein uS5, N-terminal, conserved site |
A1JIN7 | MLDLYADWCVACKEFEKYT | Evo | 208 | IPR017937 | B | pool | IPR021164 | Tyrosine hydroxylase, conserved site | IPR017937 | Thioredoxin, conserved site | IPR047346 | DNA repair protein REV1, ubiquitin-binding motif 1/2 | IPR018314 | RsmB/NOL1/NOP2-like, conserved site |
P36621 | ILKRLEAATSRLE | Evo | 274 | IPR018106 | C | pool | IPR017870 | FeS cluster insertion, C-terminal, conserved site | IPR020574 | Small ribosomal subunit protein uS9, conserved site | IPR018106 | CAP, conserved site, N-terminal | IPR018300 | Aminotransferase, class IV, conserved site |
Q6S004 | GKFSFIDLAGSE | Evo | 463 | IPR019821 | B | pool | IPR000059 | NUDIX hydrolase, NudL, conserved site | IPR019821 | Kinesin motor domain, conserved site | IPR023151 | PEP-utilising enzyme, conserved site | IPR019808 | Histidine triad, conserved site |
Q9Y822 | RMGKGKGAFEYW | Evo | 536 | IPR020798 | C | pool | IPR043518 | 2-5-oligoadenylate synthetase, N-terminal conserved site | IPR032310 | Ninja/AFP-like, putative nuclear localisation signal | IPR020798 | Large ribosomal subunit protein uL16, conserved site | IPR043639 | AF4 interaction motif |
Q3IRZ5 | DIHVHFNSP | Evo | 75 | IPR002195 | C | pool | IPR023368 | Uncharacterised protein family UPF0066, conserved site | IPR008284 | Molybdenum cofactor biosynthesis, conserved site | IPR002195 | Dihydroorotase, conserved site | IPR016157 | Cullin, conserved site |
O70454 | LCCLRCIQTRDTNFGTNCICRVP | Evo | 312 | IPR018230 | C | pool | IPR030459 | Glycosyl hydrolases family 31, conserved site | IPR000614 | Free Met sulfoxide reductase conserved site | IPR018230 | BUD31/G10-related, conserved site | IPR019546 | Twin-arginine translocation pathway, signal sequence, bacterial/archaeal |
O70454 | CTHCGCRGCS | Evo | 312 | IPR018230 | C | pool | IPR030459 | Glycosyl hydrolases family 31, conserved site | IPR000614 | Free Met sulfoxide reductase conserved site | IPR018230 | BUD31/G10-related, conserved site | IPR019546 | Twin-arginine translocation pathway, signal sequence, bacterial/archaeal |
A4YGN2 | GETVLVTGASGGVGIHALQVAK | Evo | 82 | IPR002364 | A | pool | IPR002364 | Quinone oxidoreductase/zeta-crystallin, conserved site | IPR020809 | Enolase, conserved site | IPR035595 | UDP-glycosyltransferase family, conserved site | IPR032458 | Histone H2A conserved site |
O19884 | ITVFKMQAKKGTKKKKGYKTVLT | Evo | 331 | IPR018258 | A | pool | IPR018258 | Large ribosomal subunit protein bL21, conserved site | IPR020053 | Ribosome-binding factor A, conserved site | IPR018054 | Chromogranin, conserved site | IPR020895 | Frataxin conserved site |
Q55BY1 | ILKMLACQTHLG | Evo | 283 | IPR018130 | D | pool | IPR017866 | Succinyl-CoA synthetase, beta subunit, conserved site | IPR023795 | Serpin, conserved site | IPR031312 | Sodium/sulphate symporter, conserved site | IPR018130 | Small ribosomal subunit protein uS2, conserved site |
Q55BY1 | PRLLIVADPLLDKQPLMEASYVNIP | Evo | 283 | IPR018130 | D | pool | IPR017866 | Succinyl-CoA synthetase, beta subunit, conserved site | IPR023795 | Serpin, conserved site | IPR031312 | Sodium/sulphate symporter, conserved site | IPR018130 | Small ribosomal subunit protein uS2, conserved site |
P37900 | VLLVGGMTRVPKVQQ | Evo | 293 | IPR018181 | D | pool | IPR020569 | Uncharacterised protein family UPF0029, Impact, conserved site | IPR018375 | Coproporphyrinogen III oxidase, conserved site | IPR018378 | C-type lectin, conserved site | IPR018181 | Heat shock protein 70, conserved site |
A8IZG4 | LATASFDATVAVWEL | Evo | 440 | IPR019775 | D | pool | IPR016157 | Cullin, conserved site | IPR047346 | DNA repair protein REV1, ubiquitin-binding motif 1/2 | IPR030373 | Polyamine biosynthesis domain, conserved site | IPR019775 | WD40 repeat, conserved site |
A0A0H2VG78 | SGPLADKLGRRRLVMLIA | Evo | 110 | IPR005829 | A | pool | IPR005829 | Sugar transporter, conserved site | IPR017870 | FeS cluster insertion, C-terminal, conserved site | IPR020891 | Uncharacterised protein family UPF0758, conserved site | IPR001589 | Actinin-type actin-binding domain, conserved site |
A0A0H2VG78 | IIGLAVGGSMSTVPVYLSEMAPTEYR | Evo | 110 | IPR005829 | A | pool | IPR005829 | Sugar transporter, conserved site | IPR017870 | FeS cluster insertion, C-terminal, conserved site | IPR020891 | Uncharacterised protein family UPF0758, conserved site | IPR001589 | Actinin-type actin-binding domain, conserved site |
VenusX Fragment MCQ — Evo (MF50)
4-choice multiple-choice question reformulation of the VenusX Fragment-level Evo sub-task from the paper VenusX: Unlocking Fine-Grained Functional Understanding of Proteins (ICLR 2026).
This fork adapts the original N-way classification task into a 4-choice MCQ so that zero-shot LLMs can be evaluated fairly. The original task required the model to output one of 739 InterPro class labels—infeasible for a CausalLM that cannot know which IPR IDs are in the benchmark's label subspace.
Schema
Each sample is one multiple-choice question with exactly one correct answer.
| Field | Type | Description |
|---|---|---|
uid |
str | Original VenusX sample UID |
seq_fragment |
str | The protein fragment amino acid sequence |
annotation |
str | "Evo" (sub-task name) |
interpro_label |
int | Original VenusX integer label (preserved for compatibility) |
correct_ipr |
str | The correct InterPro accession (e.g. IPR000169) |
correct_letter |
str | "A" / "B" / "C" / "D" — the letter whose option matches correct_ipr |
option_{a,b,c,d}_ipr |
str | InterPro accession for each option |
option_{a,b,c,d}_desc |
str | Human-readable description from InterPro entry.list |
distractor_source |
str | How the 3 distractors were picked: hierarchy, mixed, or pool (see below) |
How the MCQ is constructed
For each sample, we start with one golden InterPro ID (the original label) and pick 3 distractors via a 2-tier fallback:
- Tier 1 — InterPro hierarchy siblings: If the golden IPR is in the InterPro hierarchy tree, take true siblings (same parent, not the golden itself, not any ancestor/descendant of the golden). We use up to 3.
- Tier 2 — Same sub-task label pool (random): Fill the remaining slots by random sampling from the full label pool of the same sub-task, excluding the golden, all its ancestors/descendants, and any Tier 1 picks.
All 4 options (1 golden + 3 distractors) are then shuffled to randomize
letter positions (A/B/C/D), using a deterministic per-sample seed derived
from {annotation}:{split}:{uid}:{golden} so every dataset build is
bit-identical and reviewers can independently verify each MCQ.
The distractor_source column records which strategy was used:
hierarchy— all 3 distractors are InterPro siblingsmixed— some are siblings, some are random pool samplespool— all 3 are random pool samples (most common forActive_site/Binding_site/Conserved_sitetypes, which have no InterPro hierarchy per EBI convention)
Why descriptions are included
The original free-text task expected the LLM to directly output an IPR ID like
IPR019757. This is unfair because the LLM has no way to know which specific
IPRs are in the benchmark's small label subspace. Our MCQ format exposes the
4 candidate options with human-readable names (e.g.
IPR019757 — Peptidase S26A, signal peptidase I, lysine active site) so that
the LLM can use its biological knowledge to match the fragment's features
against the candidate functional descriptions.
Example
Fragment: IHCIAGLGRTP
A) IPR033694 — Pyroglutamyl peptidase I, Cys active site
B) IPR023411 — Ribonuclease A, active site
C) IPR016130 — Protein-tyrosine phosphatase, active site ← correct
D) IPR000169 — Cysteine peptidase, cysteine active site
[ANSWER]C[/ANSWER]
Build Reproducibility
This dataset is fully reproducible from the included build scripts and reference files:
scripts/
parse_interpro.py # Parses InterPro flat files into a queryable cache
build_mcq.py # Builds MCQ samples with 2-tier distractor fallback
reference/
entry.list # InterPro entries dump (downloaded 2026-04-09)
ParentChildTreeFile.txt # InterPro hierarchy tree (downloaded 2026-04-09)
label_pool.json # Union label pool across all 5 sub-tasks
To rebuild:
# 1. Refresh InterPro flat files (optional — pinned versions included)
curl -O https://ftp.ebi.ac.uk/pub/databases/interpro/current_release/entry.list
curl -O https://ftp.ebi.ac.uk/pub/databases/interpro/current_release/ParentChildTreeFile.txt
# 2. Parse into cache
python scripts/parse_interpro.py
# 3. Build MCQ (loads original VenusX Fragment datasets from AI4Protein/*)
python scripts/build_mcq.py
Known Limitations
Distractors are automatically generated, not peer-reviewed. Unlike MMLU or MedMCQA whose distractors are human-written by exam boards, our distractors come from random sampling / hierarchy traversal. Some may be too easy (e.g. a completely unrelated domain for a specific active site), inflating accuracy.
InterPro hierarchy coverage is low for
Active_site,Binding_site,Conserved_site, andRepeatentry types — EBI does not arrange these into hierarchies. As a result, Tier 1 (sibling-based) distractors only apply to a minority of samples (seedistractor_sourcecolumn for each sample's strategy).Random baseline is 25% (not 1/N of the original label space). Accuracy numbers from this MCQ benchmark should be interpreted against this 25% baseline, not the paper's full-label-space accuracy.
interpro_labelfield is preserved for traceability but not used in MCQ scoring. MCQ scoring comparespred_lettertocorrect_letter.Not comparable to VenusX paper Table 4 numbers. The paper reports ESM2 probe accuracy on the full label space; we report LLM accuracy on a 4-way MCQ. Same metric name (ACC), different semantics.
Citation
If you use this MCQ-reformulated dataset, please cite both the original VenusX paper and this fork:
@inproceedings{venusx2026,
title={VenusX: Unlocking Fine-Grained Functional Understanding of Proteins},
author={Tan, Yang and others},
booktitle={ICLR},
year={2026},
url={https://arxiv.org/abs/2505.11812}
}
References
The MCQ reformulation methodology draws from the following literature:
- Hendrycks et al., Measuring Massive Multitask Language Understanding (MMLU), ICLR 2021
- Pal et al., MedMCQA: A Large-scale Multi-Subject Multi-Choice Dataset for Medical domain Question Answering, CHIL 2022. https://arxiv.org/abs/2203.14371
- El-Sanyoury et al., Automatic distractor generation in multiple-choice questions: a systematic literature review, PeerJ Computer Science 2024. https://pmc.ncbi.nlm.nih.gov/articles/PMC11623049/
- Susanti, Iida & Tokunaga, Automatic Generation of English Vocabulary Tests (WordNet-based distractor), CSEDU 2015
- Gene Ontology sibling negatives: Frontiers in Genetics 2020, BMC Bioinformatics 2009
License
Derived from VenusX (AI4Protein). InterPro data is licensed CC-BY-4.0 from EMBL-EBI. This fork is released under CC-BY-4.0.
Contact
Built by hauser7733 as part of the SiEval evaluation framework. Questions or issues: open an issue at the SiEval repo.
- Downloads last month
- 15