blob_id
string
repo_name
string
path
string
length_bytes
int64
score
float64
int_score
int64
text
string
cbb2fde8488094dc64bec7d85d9d7190fd40ade8
Haroldov/holbertonschool-higher_level_programming
/0x01-python-if_else_loops_functions/100-print_tebahpla.py
128
3.6875
4
#!/usr/bin/python3 for i in range(25, -1, -1): if (i % 2 == 0): i -= 32 print("{}".format(chr(i + 97)), end="")
55226d9380b4ba5cd0443751989462c98b7746ab
amirsaleem1990/python-practice-and-assignments
/area calculator.py
937
4.09375
4
# area calculator a = True while a: print('\n***************************\nWelcome to Area Calculator\n***************************') b = input('\nwhich shape you want to calulate? \n[sq]:\t for square\n[rec]:\t for rectriangle\n[cir]:\t for circle\n') if b == 'sq': d = int(input('\nEnter one side length: ')) print('\nyour square has area of '+str(d * d)+' '+ c+'s') elif b == 'rec': e = input('\nEnter lenght and hight seperated by space eg: 22 77 ') g = e[:e.find(' ')]; h = e[e.find(' ') +1 :] print('\nyour rectriange has area of '+str(int(g)*int(h))) #elif b == 'cir': #f = input('\nEnter daya meter for your sircle: ') #pppppppppppppppppppppppppppppppppppppppppppppp #print('sorry.. yet not circle ready') else: continue i = input('\nAre you want to calculate once more? \n[y/n] ') if i == 'y': a = True else: a = False
06c68836ebe35c6d909bbebd97c41887fb8d950e
CraneJen/Python-Learning
/Sort/InsertSort.py
385
3.90625
4
def insertsort(seq): n = len(seq) count = 0 for i in range(1, n): key = seq[i] j = i - 1 while j >= 0 and key < seq[j]: seq[j + 1] = seq[j] j -= 1 count += 1 seq[j + 1] = key print(count) return seq if __name__ == '__main__': seq = [9, 8, 7, 6, 5, 4, 3, 2, 1] print(insertsort(seq))
4ffdd4f05f9fb9b7d9b0bd018b7a96cd99a73474
PatrikoPy/MIW
/wprowadzenie02/cw5.py
997
3.90625
4
__all__ = ['Calculator'] class Calculator: def add(self, *args): current = 0 try: for num in args: current += float(num) return current except: print("error") def difference(self, a=0, b=0): try: return float(a) - float(b) except: print("error") def multiply(self, *args): current = 1 try: for num in args: current *= float(num) return current except: print("error") def divide(self, a=1, b=1): try: return float(a) / float(b) except(ZeroDivisionError): print("nie dziel przez zero...") return 0 except: print("error") if __name__ == "__main__": calc = Calculator() print(calc.divide(8, 0)) print(calc.add(5, 7, 6, 9, 8, 5, 4, 7)) print(calc.multiply(8, 3, 6)) print(calc.difference(8, 9))
bd7dae154e92bb54eabec1528b9042bda5260241
vijaykanth1729/python_material
/decorators/generators/gen.py
264
3.921875
4
def my_gen(): n=1 print("This is printed first:") yield n n+=1 print("This is printed second") yield n n+=1 print("This is printed third: ") yield n it = my_gen() print(next(it)) print(next(it)) print(next(it)) print(next(it))
40086ce76a749680f8a203ea6bac439cca0c0fbf
Voolodimer/DevOps3_python
/hw5.py
855
3.796875
4
#!/usr/bin/python3 # 1. После запуска предлагает пользователю ввести неотрицательные целые числа, # разделенные через пробел и ожидает ввода от пользователя. # 2. Находит наименьшее положительное число, не входящее в данный пользователем # список чисел и печатает его. def hw5(): print('Введите список чисел: ') input_list = sorted((int(x) for x in input().split())) i = 0 # print(input_list) min_num = input_list[0] if min_num > 1: return min_num - 1 while i <= len(input_list): if min_num not in input_list: return min_num i += 1 min_num += 1 print(hw5())
20ce0ba6316450e7aee1e4a972f9e37787b4c5f7
dr-dos-ok/Code_Jam_Webscraper
/solutions_python/Problem_199/1373.py
1,241
3.5
4
# -*- coding: utf-8 -*- import sys import os import math #input_text_path = __file__.replace('.py', '.txt') #fd = os.open(input_text_path, os.O_RDONLY) #os.dup2(fd, sys.stdin.fileno()) def flip(A, start_i, K): for i in range(start_i, start_i + K): if A[i] == '+': A[i] = '-' else: A[i] = '+' def solve(cakes, K): flip_num = 0 # 左から+にしていく index = 0 while True: #print(cakes) if cakes[index] == '+': index += 1 else: # ひっくり返す flip(cakes, index, K) flip_num += 1 index += 1 # 終端 if index > len(cakes) - K: break if cakes.count('+') == len(cakes): return True, flip_num else: return False, None f = open('submit.txt', 'w') N = int(input()) for i in range(N): lst = input().split() cakes_str = lst[0] cakes = list(cakes_str) K = int(lst[1]) #print('Input', cakes_str, K) solvable, num = solve(cakes, K) if solvable: s = 'Case #{}: {}\n'.format(i + 1, num) f.write(s) else: s = 'Case #{}: {}\n'.format(i + 1, 'IMPOSSIBLE') f.write(s) f.close()
ac0c3b1deb09163b99b68c7d57940fcd93feac29
Biorrith/Software-Teknologi
/Older versions/Python server/client.py
1,002
3.828125
4
# Import socket module import socket # Create a socket object s = socket.socket() # Define the port on which you want to connect port = 25 # connect to the server on local computer s.connect(('127.0.0.1', port)) # receive data from the server print (s.recv(1024)) send_bytes = 'I see this as an absoloute success!\r\n' send_bytes = send_bytes.encode() s.sendall(send_bytes) """ print (s.recv(1024)) send_bytes = 'mail This is a test\r\n' send_bytes = send_bytes.encode() s.sendall(send_bytes) print (s.recv(1024)) send_bytes = 'rcpt Daniel\r\n' send_bytes = send_bytes.encode() s.sendall(send_bytes) # print (s.recv(1024)) # send_bytes = 'data idk what to type here \r\n' # send_bytes = send_bytes.encode() # s.sendall(send_bytes) print (s.recv(1024)) send_bytes = 'quit\r\n' send_bytes = send_bytes.encode() s.sendall(send_bytes) print (s.recv(1024)) """ # close the connection s.close() #TODO: Make an actual client, man...
de1aafdb2d37bff0630db9e539bcf80508756640
raulmercadox/curso_python
/longestRun.py
1,081
3.625
4
# -*- coding: utf-8 -*- """ Created on Fri Oct 25 12:57:23 2019 @author: ezmerra """ def longestRun(L): ancho = len(L) if ancho == 0 or ancho == 1: return ancho anterior = None contador = 0 maximo_ancho = 0 for i in L: if anterior == None: anterior = i contador += 1 else: if i >= anterior: contador += 1 else: if contador > maximo_ancho: maximo_ancho = contador contador = 1 anterior = i if contador > maximo_ancho: maximo_ancho = contador return maximo_ancho """ assert longestRun([])==0 assert longestRun([2])==1 assert longestRun([1,2])==2 assert longestRun([2,1])==1 assert longestRun([1,2,1,2])==2 assert longestRun([1,2,3,1,2])==3 assert longestRun([1,2,2,3,1,2])==4 assert longestRun([1,2,1,2,2,3])==4 assert longestRun([1,2,1,2,2,3,6,7])==6 assert longestRun([1,2,1,2,2,3,1,7,8,8,9])==5 assert longestRun([1,2,1,2,2,3,5,1,7,8,8,9])==5 """
635e7fb013185aa53b44b6e8d16d63b91b97e858
jogubaba/PythonScripts
/22sed.py
594
3.6875
4
file = open('/home/jogubaba/Downloads/My List', 'r') f_contents = file.readlines() sn = open('/home/jogubaba/Downloads/servervmname', 'r') contents = sn.readlines() for f_contents in contents: print(contents) else: print("Not in List") #another keywords = input("Please Enter keywords path as c:/example/ \n :") keys = open((keywords), "r").readlines() keys = keys.split(',') # separates key strings with open("/home/jogubaba/Downloads/file2.txt") as f: for line in f: for key in keys: if key.strip() in line: print(line) # another
8aa6c344747ebffdde38cdfe610a30d0075cc0d7
TareqHasa/python_stack
/_python/python_fundamentals/functions_basic_II.py
825
3.8125
4
def count_down (num): x=list() for i in range(num,-1,-1): x.append(i) return x print(count_down(5)) # 1 def print_and_return (arr): print (arr[0]) return arr[1] print_and_return([1,2]) def first_plus_length(arr): return arr[0]+len(arr) print (first_plus_length([1,2,3,4,5])) def values_greater_than_second (arr): print(len(arr)) count=0 newarr=list() if len(arr)<2: return False for i in range (0,len(arr)-1,1): if arr[i]>arr[i+1]: count+=1 newarr.append(arr[i]) print(count) return newarr print(values_greater_than_second([5,2,3,2,1,4])) def length_and_value(size,value): x=[] for i in range (0,size): x.append(value) return x print(length_and_value(4,7)) print(length_and_value(6,2))
35891cca608d2ad6cd6da859fdc245163c20cfc9
StraMil/Sorting-Algorithm-Visualization
/visualization.py
5,267
3.65625
4
import pygame import sys import random import time WIDTH = 1280 HEIGHT = 400 BLACK = pygame.Color(0, 0, 0) num_bars = 20 bar_witdh = 800/num_bars space = 400/num_bars sorting = False array = [] bars = [] cycles = 0 BLUE = (0, 0, 255) # Initialize the pygame pygame.init() font = pygame.font.SysFont("Arial", 30) clock = pygame.time.Clock() # Create the screen SCREEN = pygame.display.set_mode((WIDTH,HEIGHT)) # Set Background color SCREEN.fill((255,255,255)) pygame.display.update() def bubbleSort(bars): sorting = False cycles = 0 for i in range(len(bars)-1): for j in range(0, len(bars)-1-i): if bars[j] < bars[j + 1]: bars[j], bars[j + 1] = bars[j + 1], bars[j] #print(bars) SCREEN.fill((255,255,255)) for k in range(len(bars)): x = (k * bar_witdh) + (k * space) + (WIDTH - (num_bars * bar_witdh + num_bars * space))/2 if bars[k] is bars[j]: red = 255 green = 130 blue = 80 last = k else: red = 0 blue = bars[k] * (-1) green = 255 - blue pygame.draw.rect(SCREEN, ((red, green, blue)), (x, 365, bar_witdh, bars[k]), 0, 6) buttonSort("Sort", 105 + 30, 30, 75, 50, (230, 230, 230), (200, 200, 200)) buttonNewArray("New", 30, 30, 75, 50, (230, 230, 230), (200, 200, 200)) resetArray("Reset", 210 + 30, 30, 75, 50, (230, 230, 230), (200, 200, 200)) showNumOfCycles(cycles) pygame.display.update() #time.sleep(1) cycles = cycles + 1 red = 0 blue = bars[last] * (-1) green = 255 - blue x = (last * bar_witdh) + (last * space) + (WIDTH - (num_bars * bar_witdh + num_bars * space))/2 pygame.draw.rect(SCREEN, ((red, green, blue)), (x, 365, bar_witdh, bars[last]), 0, 6) pygame.display.update() #print(last) def getHeight(num_bars): if num_bars <= 10: return 25 if num_bars <= 25: return 10 if num_bars <= 50: return 5 if num_bars <= 100: return 2.5 if num_bars <= 200: return 1.25 else: return 1 def buttonSort(msg, x, y, w, h, ic, ac): mouse = pygame.mouse.get_pos() click = pygame.mouse.get_pressed() global sorting if x+w > mouse[0] > x and y+h > mouse[1] > y: pygame.draw.rect(SCREEN, ac, (x,y,w,h), 0) if click[0] == 1: sorting = True else: pygame.draw.rect(SCREEN, ic, (x, y, w, h), 0) text = font.render(msg, True, (0, 0, 0)) SCREEN.blit(text, (x + 10, y + 10)) def buttonNewArray(msg, x, y, w, h, ic, ac): mouse = pygame.mouse.get_pos() click = pygame.mouse.get_pressed() if x+w > mouse[0] > x and y+h > mouse[1] > y: pygame.draw.rect(SCREEN, ac, (x,y,w,h), 0) if click[0] == 1: cycles = 0 SCREEN.fill((255,255,255)) bars.clear() array.clear() mulitplayer = getHeight(num_bars) #print(mulitplayer) for i in range(num_bars): height = random.randint(-num_bars*mulitplayer, -1) array.append(height) #print(height) x = (i * bar_witdh) + (i * space) + (WIDTH - (num_bars * bar_witdh + num_bars * space))/2 drawBar(x,height) print("New", bars) else: pygame.draw.rect(SCREEN, ic, (x, y, w, h), 0) text = font.render(msg, True, (0, 0, 0)) SCREEN.blit(text, (x + 10, y + 10)) def resetArray(msg, x, y, w, h, ic, ac): mouse = pygame.mouse.get_pos() click = pygame.mouse.get_pressed() bars = [] sorting = False if x+w > mouse[0] > x and y+h > mouse[1] > y: pygame.draw.rect(SCREEN, ac, (x,y,w,h), 0) bars = [] sorting = False if click[0] == 1: SCREEN.fill((255,255,255)) for i in range(num_bars): x = (i * bar_witdh) + (i * space) + (WIDTH - (num_bars * bar_witdh + num_bars * space))/2 drawBar(x,array[i]) print("Reset", bars) else: pygame.draw.rect(SCREEN, ic, (x, y, w, h), 0) text = font.render(msg, True, (0, 0, 0)) SCREEN.blit(text, (x + 10, y + 10)) def showNumOfCycles(cicles): cicle = font.render("Cycles: " + str(cicles), True, (0,0,0)) SCREEN.blit(cicle, (1100, 30)) def drawBar(x,height): blue = height * (-1) green = 255-blue pygame.draw.rect(SCREEN, (0,green,blue), (x, 365, bar_witdh, height), 0, 6) if not sorting: bars.append(height) # Loop while True: buttonSort("Sort", 105 + 30, 30, 75, 50, (230, 230, 230), (200, 200, 200)) buttonNewArray("New", 30, 30, 75, 50, (230, 230, 230), (200, 200, 200)) resetArray("Reset", 210 + 30, 30, 75, 50, (230, 230, 230), (200, 200, 200)) pygame.display.update() if sorting: bubbleSort(bars) sorting = False for event in pygame.event.get(): if event.type == pygame.QUIT: pygame.quit() sys.exit()
ae123cd90ab8496f41452da98a30a0d935870ba9
jgartsu12/my_python_learning
/python_data_structures/lists/sorted_fn.py
490
4.1875
4
# Guide to the sorted Function in Python # using sorted() method #sorted() allows u to store that new value in a new variable that stores that list and keeps original list stored sale_prices = [ 100, 83, 220, 40, 100, 400, 10, 1, 3 ] sorted_list = sorted(sale_prices, reverse=True) # sorted(argument_list, reverse order) print(sorted_list) # prints [400, 220, 100, 100, 83, 40, 10, 3, 1] # can set sorted() with reverse in descending integer order
90fc5450b0c74dd0e006aad3dedb900e396a2ee6
ivo-bass/SoftUni-Solutions
/programming_fundamentals/mid_exam_preparation/3_last_stop.py
1,424
3.71875
4
class Gallery: def __init__(self, seq): self.sequence = seq def change(self, old, new): if old in self.sequence: index = self.sequence.index(old) self.sequence[index] = new def hide(self, num): if num in self.sequence: self.sequence.remove(num) def switch(self, num1, num2): if num1 in self.sequence and num2 in self.sequence: index1, index2 = self.sequence.index(num1), self.sequence.index(num2) self.sequence[index1], self.sequence[index2] = self.sequence[index2], self.sequence[index1] def insert_p(self, index, num): if index in range(len(self.sequence)): self.sequence.insert(index + 1, num) def reverse(self): self.sequence = self.sequence[::-1] def print_gallery(self): print(" ".join(self.sequence)) def main(): gallery = Gallery(input().split()) data = input() while not data == "END": command = data.split() action = command[0] if action == "Change": current_num, changed_num = command[1], command[2] gallery.change(current_num, changed_num) elif action == "Hide": num = command[1] gallery.hide(num) elif action == "Switch": num1, num2 = command[1], command[2] gallery.switch(num1, num2) elif action == "Insert": index, num = command[1], command[2] index = int(index) gallery.insert_p(index, num) elif action == "Reverse": gallery.reverse() data = input() gallery.print_gallery() if __name__ == '__main__': main()
b2423910fd63360cbebbbbe88fa157a3567f2c16
HIT-GH/EPN-CEC-Python
/Lab01-v03-20210625.py
1,308
3.890625
4
# -*- coding: utf-8 -*- """ Created on Thu Jun 24 00:04:03 2021 @author: HendersonIturralde Crear un código en el editor que asigna un valor flotante, lo coloca en una variable llamada "x", e imprime el valor de la variable llamada "y". Su tarea es completar el código para evaluar la siguiente expresión: 3x3 - 2x2 + 3x - 1 El resultado debe ser asignado a "y". Datos de Muestra: x = 0 x = 1 x = -1 Salida Esperada: y = -1.0 y = 3.0 y = -9.0 """ print("\n"*1, "EPN-CEC - Python Essentials") print(" Laboratorio 01-v03") print(" Evaluar Expresión", "\n"*1) w = [0, 1, -1] print(":"*15, "Opt 1",":"*15) print(":"*4, "y = 3*x*3 - 2*x*2 + 3*x - 1",":"*4,"\n") for n in w: x = float(n) print(f" x = {x}") print(f" x Type = {type(x)}") if x!=1: y = float(3*x*3 - 2*x*2 + 3*x - 1) print(f" y = {y}", "\n"*1) else: n = 3 y = float(n) print(f" y = {y}", "\n"*1) print(":"*15, "Opt 2",":"*15) print(":"*3, "y = 3*x**3 - 2*x**2 + 3*x - 1",":"*3,"\n") for n in w: x = float(n) print(f" x = {x}") print(f" x Type = {type(x)}") y = float(3*x**3 - 2*x**2 + 3*x - 1) print(f" y = {y}", "\n"*1)
c632c57f8fe4fcd0502bd65119b6150c88550a74
ScarletMcLearn/student_data_facebook
/collocation.py
1,155
3.8125
4
import nltk from nltk.collocations import * #count single word frequency f = open('aamir.txt') raw = f.read() tokens = nltk.word_tokenize(raw) #Create your bigrams #bgs = nltk.bigrams(tokens) #compute frequency distribution for all the words in the text fdist = nltk.FreqDist(tokens) for k,v in fdist.items(): if v>=3: print(k,v) print('\n') #bigram and trigram count bigram_measures = nltk.collocations.BigramAssocMeasures() trigram_measures = nltk.collocations.TrigramAssocMeasures() # change this to read in your data finder = BigramCollocationFinder.from_words( nltk.corpus.genesis.words('aamir.txt')) finder1 = TrigramCollocationFinder.from_words(nltk.corpus.genesis.words('aamir.txt')) # only bigrams that appear 3+ times finder.apply_freq_filter(2) finder1.apply_freq_filter(1) # return the 10 n-grams with the highest PMI token = finder.nbest(bigram_measures.pmi, 10) token1 = finder1.nbest(trigram_measures.pmi, 10) #print(finder.ngram_fd.viewitems()) for item in token: print(item) #print(token.count(item)) #for k,v in finder.ngram_fd.items(): #print(k,v) print('\n') for item in token1: print(item) #print(token2)
eb977e6ec1c57016fd533839d883bb50bd624c34
WeslySantos07/QUEST-ES-OBI
/areadacircuferencia.py
79
4
4
r = float(input()) pi = 3.1416 res = (r**2)*pi print("{:.2f}".format(res))
3a60dfbf0c81af500067303ca10e4306eb7d1556
LiamTyler/AStarTesting
/src/AStar.py
3,592
3.703125
4
import math class Cell: def __init__(self, r = 0, c = 0): self.f = 0 self.g = 0 self.h = 0 self.row = r self.col = c self.parent = None def __eq__(self, other): return self.row == other.row and self.col == other.col def __str__(self): return "Cell: f = " + str(self.f) + ", r = " + \ str(self.row) + ", c = " + str(self.col) def __repr__(self): return self.__str__() # Manhattan heuristic def heuristic(start, goal): return abs(goal.row - start.row) + abs(goal.col - start.col) # Shitty linear search to fin the lowest F cost cell def getLowestCost(olist): lowestIndex = 0 for i in range(1, len(olist)): if olist[i].f < olist[lowestIndex].f: lowestIndex = i return lowestIndex def isValidAndNotAWall(node, grid): w = len(grid[0]) h = len(grid) if 0 <= node.col and node.col < w: if 0 <= node.row and node.row < h: if grid[node.row][node.col] != 'W': return True return False def getNeighbors(node, grid): r = node.row c = node.col potential = [Cell(r-1,c),Cell(r+1,c),Cell(r,c-1),Cell(r,c+1)] neighbors = [cell for cell in potential if isValidAndNotAWall(cell, grid)] for n in neighbors: n.g = node.g + .5*grid[node.row][node.col] + .5*grid[n.row][n.col] n.parent = node return neighbors def construct_path(node): path = [node] while node.parent: node = node.parent path = [node] + path return path def print_path(path): for x in path: print(x.row, " ", x.col) def AStar(start, goal, grid): open_list = [start] closed_list = [] start.g = 0 start.f = start.g + heuristic(start, goal) while open_list != []: index = getLowestCost(open_list) current = open_list[index] if current == goal: return current open_list = open_list[:index] + open_list[index+1:] closed_list.append(current) neighbors = getNeighbors(current, grid) #print("neighbors: ", neighbors) #input() for neighbor in neighbors: if neighbor not in closed_list: neighbor.f = neighbor.g + heuristic(neighbor, goal) if neighbor not in open_list: open_list.append(neighbor) else: open_neighbor = open_list[open_list.index(neighbor)] if neighbor.g < open_neighbor.g: open_neighbor.g = neighbor.g open_neighbor.parent = neighbor.parent return None def gridVal(char): if char == 'S': return 'S' elif char == 'F': return 'F' elif char == 'W': return 'W' else: return int(char) fname = "../maps/map2.txt" w = 0 h = 0 grid = None start = None finish = None with open(fname) as fp: w, h = [int(x) for x in next(fp).strip().split()] grid = [[gridVal(x) for x in line.strip()] for line in fp] for r in range(h): for c in range(w): if grid[r][c] == 'S': start = Cell(r, c) grid[r][c] = 1 elif grid[r][c] == 'F': finish = Cell(r, c) grid[r][c] = 1 for r in range(h): for c in range(w): print(grid[r][c], end=' ') print() ret = AStar(start, finish, grid) if ret: print("path found") path = construct_path(ret) print_path(path) else: print("no possible path")
547380b3a0fdf94205010cbd5325c091db82e0e6
Vampirskiy/helloworld
/venv/Scripts/Урок3/step2_input.py
1,215
3.703125
4
import random number = random.randint(1, 100) #print(number) user_number = None levels = {1 : 10, 2 : 5, 3 : 3} level = int(input('Введите уровень сложности от 1 до 3')) count = 0 max_count = levels[level] user_count = int(input('Введите количество пользователей')) users = [] for i in range(user_count): user_name = input(f'Введите имя пользователя {i+1}') users.append(user_name) is_vinner = False vinner_name = None while not is_vinner: count += 1 if count > max_count: print('Вы дибилы!') break print(f'Попытка номер {count}') for user in users: print(f'Ход пользователя {user}: ') user_number = int(input('Введите число от 1 до 100')) if user_number == number: is_vinner = True vinner_name = user break elif number < user_number: print('Введенное число больше загаданного') else: print('Введенное число меньше загаданного') else: print(f'Победитель {vinner_name}')
70a9a1f6d75cbf949fccb3054ba5a912b58fcd33
juriansluiman/AdventOfCode2019
/3.py
1,760
3.703125
4
#!/usr/bin/env python # -*- coding: utf-8 -*- ### Advent of Code 2019, Day 3 f = open('3.txt', 'r') c = f.readlines() wire1 = c[0].rstrip('\n').split(',') wire2 = c[1].split(',') def createPath(wire): path = [] pos = (0,0) for i in wire: direction = i[0] steps = int(i[1:]) if direction == 'U': for j in range(steps): pos = (pos[0], pos[1]+1) path.append(pos) elif direction == 'D': for j in range(steps): pos = (pos[0], pos[1]-1) path.append(pos) elif direction == 'L': for j in range(steps): pos = (pos[0]-1, pos[1]) path.append(pos) elif direction == 'R': for j in range(steps): pos = (pos[0]+1, pos[1]) path.append(pos) return path def intersection(lst1, lst2): return list(set(lst1) & set(lst2)) def getClosestCross(crosses): minDist = 0 minCross = 0 for cross in crosses: dist = abs(cross[0]) + abs(cross[1]) if minDist == 0 or dist < minDist: minDist = dist minCross = cross return (minDist, minCross) path1 = createPath(wire1) path2 = createPath(wire2) crosses = intersection(path1, path2) minimal = getClosestCross(crosses) print('Part 1', minimal[0]) # 352 def findPathLengths(crosses, path1, path2): minimum = 0 for cross in crosses: steps1 = path1.index(cross) + 1 steps2 = path2.index(cross) + 1 steps = steps1 + steps2 if minimum == 0 or steps < minimum: minimum = steps return minimum minimum = findPathLengths(crosses, path1, path2) print('Part 2', minimum) # 43848
033f42f6352769d21c80e20d5f9bbd6f7557b146
SensenLiu123/Lintcode
/223.py
1,313
4.03125
4
#!/usr/bin/env python3 # -*- coding: utf-8 -*- """ @author: sensenliu """ """ Definition of ListNode class ListNode(object): def __init__(self, val, next=None): self.val = val self.next = next """ class Solution: """ @param head: A ListNode. @return: A boolean. """ def isPalindrome(self, head): if head is None: return True mid = self.find_middle(head) # middle 重新指针到链表尾巴,逆链表! mid.next = self.reverse(mid.next) node1, node2 = head, mid.next while node2: if node1.val != node2.val: return False node1 = node1.next node2 = node2.next return True def find_middle(self, head): slow, fast = head, head.next while fast and fast.next: fast = fast.next.next slow = slow.next return slow def reverse(self, head): prev = None node = head while node: future = node.next node.next = prev prev = node node = future return prev
e33dfb6488fbd637355a5308b2ed2c04bb280329
mattryanharris/CIS7---Discrete-Structures
/Assignments/Due 09-25-2017/Assignment 8 Answers.py
1,071
4.03125
4
import math def squareChecker(number): status = False simplifiedN = math.sqrt(number) if (number % simplifiedN) == 0 : return True else: return False def guessGame(number): test = 0 for x in xrange(1, number + 1): if squareChecker(x) == True: test = test + 1 return test def guessPrompt(number): while True: attempt = raw_input("\nHow many prime numbers are between 1 and " + str(number) + ": ") try: if attempt == 'q': print("\nProgram Ended\n") exit() number = int(attempt) return number break except ValueError: print("\nThat's not a valid option! Enter a number!\n") def main(): number = input("\nEnter a number: ") result = guessGame(number) userPrompt = guessPrompt(number) if(userPrompt > result): print("\nYou chose a number too high!\n") elif(userPrompt < result): print("\nYou chose a number too low!\n") elif(userPrompt == result): print("\nCongrats! You chose the right number!\n") print("There are " + str(result) + " prime numbers in between 1 and " + str(number) + "\n") main()
a696d12cb940545d3348ed2bd9ac74cc7006776d
sunfinite/siri
/getwords.py
3,221
3.578125
4
#!/usr/bin/python #Filename:check.py from BeautifulSoup import BeautifulSoup import codecs from strip import gettext import HTMLParser import os import pickle #Function for cases where the punctuations and the words are not separated by spaces. def checkpunct(string): if(len(string)!=0): j=-1#for punctuations at the end of the word...eg:what???? temp=string[j] while(not(repr(temp)>="u'\u0c82'" and repr(temp)<="u'\u0cef'")): j-=1 if(j==-(len(string)+1)): return temp=string[j] j+=1#slicing does not include the last character k=0 temp=string[k] while(not(repr(temp)>="u'\u0c82'" and repr(temp)<="u'\u0cef'") ): #for punctuations at the beginning ....kindalikethis k+=1 temp=string[k] if(j==0): string=string[k:]#Slicing out the punctuation marks else: string=string[k:j] j=0 temp=string[j]#But,punctuations can be in the middle without spaces,can't they? while(repr(temp)>="u'\u0c82'" and repr(temp)<="u'\u0cef'"): j+=1#Keep going till you find the first punctuation if(j==len(string)): break temp=string[j] str1=string[:j] #Slice till the first punctuation wordfrequency(str1) #Put the first slice in the dictionary str2=string[(j+1):]#The second slice may still contain punctuations Eg:F.R.I.E.N.D.S. checkpunct(str2)#Recursively call for the second slice #Function to build dictionary def wordfrequency(temp): if not wordlist.has_key(temp):#Simple dictionary operations wordlist[temp]=1 else: wordlist[temp]+=1 wordlist={} wordcount=0 flag=False proceed=False urltable=[] wordtable=[] freqtable=[] path='dataset/' #fout1=codecs.open("urltable","w","UTF-8") #fout2=codecs.open("wordtable","w","UTF-8") #fout3=codecs.open("freqtable","w","UTF-8") fout1=file("urltable","w") fout2=file("wordtable","w") fout3=file("freqtable","w") sites=os.listdir(path) for site in sites: sitepath=os.path.join(path,site) urls=os.listdir(sitepath) for url in urls: if url not in urltable: urltable.append(url) urlpath=os.path.join(sitepath,url) soup=BeautifulSoup(file(urlpath)) string=gettext(soup) h=HTMLParser.HTMLParser() string=h.unescape(string)#Convert all HTML entities to Unicode. words=string.split() for word in words: for char in word: if(repr(char)>="u'\u0cac'" and repr(char)<="u'\u0cef'"): proceed=True if proceed==True: proceed=False if(not word.isalnum() and len(word)>1): for char in word: if((not(repr(char)>="u'\u0c82'" and repr(char)<="u'\u0cef'")) and (not char.isalnum())): flag=True if flag==True: checkpunct(word) flag=False else: wordfrequency(word) else: wordfrequency(word) for word,frequency in wordlist.items(): if word not in wordtable: print word wordtable.append(word) temp=[] temp.append(wordtable.index(word)) temp.append(urltable.index(url)) temp.append(frequency) freqtable.append(temp)
0f1ef240e3e58a530379029e4adfb6ec977bc594
Luis-Otavio-Araujo/Curso-de-Python
/PhythonExercicios/ex031.py
269
3.828125
4
distancia = float(input('São quantos Km de viagem? :')) if distancia <= 200: distancia = distancia * 0.50 print('Você deverá pagar R${:.2f}'.format(distancia)) else: distancia = distancia * 0.45 print('Você deverá pagar R${:.2f}'.format(distancia))
f45f52a39101e0446c0f32f8bc8ea9aac33efd47
nagkom/MathWithPython
/chapter3_statistics/readingdata/reading_csv_corr_scatter.py
1,767
3.546875
4
# data based on: # https://www.google.com/trends/correlate/search?e=summer&e=swimming+lessons&t=weekly&p=us import matplotlib.pyplot as plt import csv def read_csv(filename): with open(filename) as f: reader =csv.reader(f) next(reader) summer = [] highest_correlated = [] for row in reader: summer.append(float(row[1])) highest_correlated.append(float(row[2])) return summer, highest_correlated def find_corr_x_y(x, y): n = len(x) # Find the sum of the products prod = [] for xi, yi in zip(x, y): prod.append(xi * yi) sum_prod_x_y = sum(prod) sum_x = sum(x) sum_y = sum(y) squared_sum_x = sum_x ** 2 squared_sum_y = sum_y ** 2 x_square = [] for xi in x: x_square.append(xi ** 2) # Find the sum x_square_sum = sum(x_square) y_square = [] for yi in y: y_square.append(yi ** 2) # Find the sum y_square_sum = sum(y_square) # Use formula to calculate correlation numerator = n * sum_prod_x_y - sum_x * sum_y denominator_term1 = n * x_square_sum - squared_sum_x denominator_term2 = n * y_square_sum - squared_sum_y denominator = (denominator_term1 * denominator_term2) ** 0.5 correlation = numerator / denominator return correlation def scatter_plot(x,y): plt.scatter(x,y) plt.xlabel('summer') plt.ylabel('swimming lessons') plt.show() if __name__ == '__main__': summer, highest_correlated = read_csv('correlate-summer.csv') corr = find_corr_x_y(summer, highest_correlated) print('Highest correlation: {0}' .format(corr)) scatter_plot(summer, highest_correlated)
dbb1d47756bdd222cb8a056b0125c623bf0a545e
JMosqueraM/algoritmos_y_programacion
/taller_estructuras_de_control_selectivas/ejercicio_6.py
1,167
3.859375
4
# Segun el numero de 4 digitos (entero y positivo) conformado por A, B, C, y D (de la forma ABCD). # Redondee el numero a la centecima mas cercana A = int(input("digite el valor A: ")) B = int(input("digite el valor B: ")) C = int(input("digite el valor C: ")) D = int(input("digite el valor D: ")) # Redondear el valor de la variable de la unidad if D > 5: C += 1 # Redondear el valor de la variable de decima if C > 5: B += 1 # Redondear el valor de la variable de centecima if B > 5: A += 1 # Convertir los digitos de las variables en cadenas para crear el numero A = str(A) B = str(B) C = str(C) D = str(D) # Creacion del numero sumando los caracteres de las variables A, B, C, y D num = A + B + C + D # Redondeo final al numero si en el proceso anterior de redondeo el numero terminaba constando de mas de 4 digitos if len(num) > 4: B = str(int(B) * 0) C = str(int(C) * 0) D = str(int(D) * 0) num = A + B + C + D # Redondeo final al numero si en el proceso anterior de rendonde el numero terminaba constando mas de 3 digitos elif len(num) > 3: C = str(int(C) * 0) D = str(int(D) * 0) num = A + B + C + D print(num)
d643ebc986e97e453175ef14130356bc994f2003
CatharticPotatoz/python-projects
/mudd/functions/testpg3.py
1,639
3.609375
4
last_in = "" health = 20 fortitude = 5 intellect = 7 agillity = 7 charisma = 7 armor = 5 ########################################################################################## grassy_noll = ("your surouded by thickets of grass that stretch out as far as you can see in any direction. out in the distance you can see a house in the opposite direction you see a single tree. the rest of the field seems eirily empty.") ################################################################################################### def look_room(): global last_in if last_in == "look" or last_in == "look around": print(room) def stndrdprmt(): global last_in last_in = input("what would you like to do?") inventory = ["pocketlint", " a pocket", "nothing"] def check_constant(): if last_in == "stats": print(health + "" + fortitude + "" + intellect + "" + agillity + "" + charisma + "" + armor) elif last_in == "inventory": print(inventory) def chk_last_in(): return last_in == "stats" or last_in == "inventory" #def Master_temp(): while True: stndrdprmt() if chk_last_in(): check_constant() #else room = grassy_noll while True: stndrdprmt() if chk_last_in(): check_constant() else: print("you " + last_in + ". after " +last_in + "ing for hours you grow weary and decide to take a nap.") break print("you wake up from your nap feeling rejuvinated + 1 to health and + 1 to intellect") #health + 1 = health #intellect + 1 = intellect Master_temp()
4fd9d34c89cbbae4c5ee25fa0d9262644246805e
Sevendeadlys/leetcode
/321/maxNumber.py
2,322
4.1875
4
''' To create the max number from num1 and nums2 with k elements, we assume the final result combined by i numbers (denotes as left) from num1 and j numbers (denotes as right) from nums2, where i+j==k. Obviously, left and right must be the maximum possible number in num1 and num2 respectively. i.e. num1 = [6,5,7,1] and i == 2, then left must be [7,1]. The final result is the maximum possible merge of all left and right. So there're 3 steps: iterate i from 0 to k. find max number from num1, num2 by select i , k-i numbers, denotes as left, right find max merge of left, right function maxSingleNumber select i elements from num1 that is maximum. The idea find the max number one by one. i.e. assume nums [6,5,7,1,4,2], selects = 3. 1st digit: find max digit in [6,5,7,1], the last two digits [4, 2] can not be selected at this moment. 2nd digits: find max digit in [1,4], since we have already selects 7, we should consider elements after it, also, we should leave one element out. 3rd digits: only one left [2], we select it. and function output [7,4,2] function mergeMax find the maximum combination of left, and right. ''' class Solution(object): def maxNumber(self, nums1, nums2, k): """ :type nums1: List[int] :type nums2: List[int] :type k: int :rtype: List[int] """ n,m = len(nums1),len(nums2) ans = [] for i in range(k+1): j = k - i if i > n or j > m: continue str1 = self.maxSingleStr(nums1,i) str2 = self.maxSingleStr(nums2,j) ans = max(ans,self.mergeStr(str1,str2)) return ans @staticmethod def mergeStr(nums1,nums2): ret = [] while nums1 or nums2: if nums1 > nums2: ret.append(nums1[0]) nums1 = nums1[1:] else: ret.append(nums2[0]) nums2 = nums2[1:] return ret @staticmethod def maxSingleStr(nums,part): n = len(nums) ret = [-1] if part > n: return nums while part > 0: start = ret[-1] + 1 end = n - part + 1 ret.append(max(range(start,end),key=nums.__getitem__)) part -= 1 ret = [nums[i] for i in ret[1:]] return ret
a8e70ab881a45bbae1462cd26a0611bb6ceb2a26
AndyTian-Devops/PythonSample
/FunctionAndParameter.py
1,290
4
4
# Chapter Six: Function and parameter ##def lookup(data,lable,name): ## return data[lable].get(name) ## ##def store(data, full_name): ## names = full_name.split() ## if len(names) == 2: names.insert(1,'') ## labels = 'first', 'middle', 'last' ##for label, name in zip(labels, names): ## people = lookup(data, label,name) ## if people: ## people.append(full_name) ## else: ## data[label][name] = [full_name] def story(**kwds): return 'Once upon a time, there was a %(job)s called %(name)s' % kwds def power(x,y,*others): if others: print ('Received redundant parameters:',others) return pow(x,y) def interval(start, stop=None,step=1): 'Imitates range() for step > 0' if stop is None: start, stop = 0, start result = [] i = start while i < stop: result.append(i) i += step return result print (story(job='king', name = 'Gumby')) print (story(name='Sir Robin', job='brave knight')) params = {'job':'lanange', 'name':'Python'} print (story(**params)) del params['job'] print (story(job='stroke of genius', **params)) print (power(2,3)) print (power(3,2)) print (power(y=3,x=2)) powerparams = (5,)*2 print (power(*powerparams)) print(power(3,3,'Hello, World!')) print(interval(10))
28d96881b4accbce52f985ecb61a59b043cd656a
ebegeti/LeetCode-problems
/question1_7.py
812
3.875
4
#Write an algorithm such that if an element in an MxN matrix is 0, its entire row and column is set to 0. from chapter1_arrays_strings import AssortedMethods def setZeros(matrix): rows=[0 for i in range(0,len(matrix))] cols=[0 for i in range(0,len(matrix[0]))] for row in range(0,len(matrix)): for col in range(0,len(matrix[0])): if matrix[row][col]==0: rows[row]=1 cols[col]=1 for row in range(0,len(matrix)): for col in range(0,len(matrix[0])): if (rows[row]==1 or cols[col]==1): matrix[row][col]=0 return matrix # driver code if __name__ == "__main__": matrix=AssortedMethods.AssortedMethods() matrix=matrix.setRandomMatrix(10,4,5) print(matrix,'\n\n') print(setZeros(matrix))
582b8217362a026537300c472b6d451f6cc586a5
JiazaiWu/ForPython
/hello/object.py
1,120
3.5625
4
# hello.py # -*- coding: utf-8 -*- import types #stduent is extended from object class student(object): def __init__(self, name, score): #__member can not be seen out of class self.__name = name self.score = score def print_stu_score(self): print '%s get %s' %(self.__name, self.score) bart = student('jiazai', 90) bart.print_stu_score() #print bart.__name <---build break print bart.score class Animal(object): def run(self): print 'An animal is running!' class Cat(Animal): pass class Dog(Animal): def run(self): print 'A dog is running!' cat = Cat() cat.run() dog = Dog() dog.run() print isinstance(cat, Cat) def run_twice(animal): animal.run() animal.run() run_twice(dog) print type(123) == types.IntType print type(dog) == Dog #'type()' is strict type check print type(dog) == Animal#this is false!! #use isinstance to check extend relation ship print isinstance(dog, Animal)#this is true!! print hasattr(dog, 'y') setattr(dog, 'y', 19) print hasattr(dog, 'y') print 'dog y attr is', dog.y #yes!!! print hasattr(dog, 'run') print hasattr(dog.run, '__call__') print callable(dog.run)
4c7a3c5a134547e26998ad588eebf6d2470fa6ba
krytech/holbertonschool-higher_level_programming
/0x0A-python-inheritance/10-square.py
448
3.78125
4
#!/usr/bin/python3 """ A suqare class which inherits properties from the subclass rectangle and the parent class BaseGeometry """ Rectangle = __import__('9-rectangle').Rectangle class Square(Rectangle): """ New square class that inherits properties from Rectangle """ def __init__(self, size): """ initializes size """ self.integer_validator("size", size) super().__init__(size, size) self.__size = size
fdca639463e3d522bac478521cd633cb3a57dc28
Kalo7o/VUTP-Python
/exercise_02/08.Positive_negative_zero.py
177
4.21875
4
n = int(input('Enter a number: ')) if n > 0: print('The number is positive.') if n < 0: print('The number is negative.') if n == 0: print('The number is zero.')
138fffc8f6ac1f065a1799f45bb8bfbeed9b9ade
knightrohit/monthly_challenges
/leetcode_aug_2020/12_pascal_triangle.py
602
3.71875
4
""" Time/Space Complexity = O(K**2) """ # Dynamic Programming # Bottom Up Approach from functools import lru_cache class Solution: def getRow(self, rowIndex: int) -> List[int]: out = [1] if rowIndex == 0: return out @lru_cache(None) def search(row, col): if row == col or col == 0: return 1 return search(row - 1, col - 1) + search(row - 1, col) for i in range(1, rowIndex): out.append(search(rowIndex, i)) out.append(1) return out
df3f06459e1043e8cc5510005c20f4dd7cb3f799
sharondevs/DL
/Image_Denoising/image_denoising.py
4,134
3.625
4
## Denoising gray scale images using Auto Encoders import pandas as pd import tensorflow as tf import matplotlib.pyplot as plt import numpy as np import random import seaborn as snb """ The label translation is as follows: 0 - T-Shirt 1 - Trouser 2 - Pullover 3 - Dress 4 - Coat 5 - Sandal 6 - Shirt 7 - Sneaker 8 - bag 9 - Ankle boot """ ## We load the dataset for the images to be obtained in grey scale (X_train,y_train), (X_test,y_test) = tf.keras.datasets.fashion_mnist.load_data() # For sanity checking the image obtained,we plot the image plt.imshow(X_train[0], cmap='gray') ## Now to perform the visualization i = random.randint(1,60000) # Produces a random number between 1 and 60000 plt.imshow(X_train[i], cmap = 'gray') label = y_train[i] # To do mroe visualization, we need to view the images in a grid of 15x15 W_grid = 10 L_grid = 10 fig , axes = plt.subplots(L_grid, W_grid, figsize = (17,17)) # This gives the subplot for the images axes = axes.ravel() # This expands the 15x15 into 225 element list n_training = len(X_train) for i in np.arange(0, W_grid*L_grid): index = np.random.randint(0, n_training) # We initialize random interger for indexign out of the training set axes[i].imshow(X_train[index]) # the axes array of objects of the subplot class can be instantitated with the images axes[i].set_title(y_train[index],fontsize = 8) # We set the title for the figures of the subplot on each figure axes[i].axis('off') ## Data Preprocessing # We need to normaliza the data X_train = X_train/255 # Due to the grey scale images X_test = X_test/255 # Now, to add the noise noise_factor = 0.3 noise_dataset = [] for img in X_train: noisy_image = img + noise_factor * np.random.randn(*img.shape) noisy_image = np.clip(noisy_image, 0,1) noise_dataset.append(noisy_image) noise_dataset = np.array(noise_dataset) # So to test the image obtained plt.imshow(noise_dataset[22],cmap = 'gray') # Now to add the noise to the testing data noise_factor = 0.1 noise_test_dataset = [] for img in X_test: noisy_image = img + noise_factor * np.random.randn(*img.shape) noisy_image = np.clip(noisy_image, 0,1) noise_test_dataset.append(noisy_image) noise_test_dataset = np.array(noise_test_dataset) ## Building the Autoencoder autoencoder = tf.keras.Sequential() # Encoder autoencoder.add(tf.keras.layers.Conv2D(filters = 16, kernel_size=3,strides = 2,padding = 'same', input_shape=(28,28,1) )) autoencoder.add(tf.keras.layers.Conv2D(filters = 8, kernel_size=3,strides = 2,padding = 'same')) autoencoder.add(tf.keras.layers.Conv2D(filters = 8, kernel_size=3,strides = 1,padding = 'same')) # Decoder autoencoder.add(tf.keras.layers.Conv2DTranspose(filters = 16, kernel_size=3,strides = 2,padding = 'same')) autoencoder.add(tf.keras.layers.Conv2DTranspose(filters = 1, kernel_size=3,strides = 2,padding = 'same', activation = 'sigmoid')) autoencoder.compile(loss='binary_crossentropy', optimizer = tf.keras.optimizers.Adam(lr=0.001)) autoencoder.summary() ## Now to fit the data for training the model # I have trained the data for an epoch of 10 autoencoder.fit(noise_dataset.reshape(-1,28,28,1), X_train.reshape(-1,28,28,1), epochs = 100, batch_size = 200, validation_data = (noise_test_dataset.reshape(-1,28,28,1), X_test.reshape(-1,28,28,1)) ) ## Evaluating the model evaluation = autoencoder.evaluate(noise_test_dataset.reshape(-1,28,28,1),X_test.reshape(-1,28,28,1)) print('Test Accuracy : {:.3f}'.format(evaluation)) ## Prediction of images to generate clear images predicted = autoencoder.predict(noise_test_dataset[:10].reshape(-1,28,28,1)) ## Visualization of the Generated predicted images fig , axes = plt.subplots(2,10,sharex=True,sharey=True,figsize=(20,4)) for images,row in zip([noise_test_dataset[:10],predicted],axes): for img,ax in zip(images,row): ax.imshow(img.reshape((28,28)),cmap = 'Greys_r') ax.get_xaxis().set_visible(False) ax.get_xaxis().set_visible(False)
d58851b7f1a1a6c06f1af44c87dbc419171dbb5e
l33tdaima/l33tdaima
/p328m/odd_even_list.py
1,071
3.90625
4
# Definition for singly-linked list. # class ListNode: # def __init__(self, val=0, next=None): # self.val = val # self.next = next from typing import Optional from local_packages.list import ListNode class Solution: def oddEvenList(self, head: Optional[ListNode]) -> Optional[ListNode]: # produce two sub lists and concatnate them if not head: return None pod, pev, evhead = head, head.next, head.next while pod.next and pev.next: pod.next = pev.next pev.next = pod.next.next pod, pev = pod.next, pev.next pod.next = evhead return head # TESTS for array, expected in [ ([], []), ([1], [1]), ([1, 2], [1, 2]), ([1, 2, 3, 4, 5], [1, 3, 5, 2, 4]), ([1, 2, 3, 4, 5, 6], [1, 3, 5, 2, 4, 6]), ([2, 1, 3, 5, 6, 4, 7], [2, 3, 6, 7, 1, 5, 4]), ]: sol = Solution() actual = ListNode.to_array(sol.oddEvenList(ListNode.from_array(array))) print("Odd even linked list of", array, "->", actual) assert actual == expected
64cabb119e5afe63c6be42a59f8a3d547fb9ad4d
Nimisha-V-Arun/Interview-Prep
/Arrays/Python/countLetter.py
500
4.0625
4
def countLetter(string): count = list() cnt = 1 for x in range(len(string)): # if you reach the last char of the string or if the adj char are different if(x+1 == len(string) or string[x] != string[x+1]): count.append(string[x]) count.append(str(cnt)) cnt = 1 elif string[x] == string[x+1]: # if adj char are the same cnt += 1 print("".join(string),"".join(count)) countLetter(list("aaabccb"))
98f7f140cfdba8c10d8e34913afae995568c5a93
DominikaJastrzebska/Kurs_Python
/05_christmas_tree/zad_calendar.py
1,038
4.21875
4
''' https://stackoverflow.com/questions/33624221/make-a-yearly-calendar-without-importing-a-calendar ''' data = [ ('January', range(31)), ('February', range(28)), ('March', range(31)), ('April', range(30)), ('May', range(31)), ('June', range(30)), ('July', range(31)), ('August', range(31)), ('September', range(30)), ('October', range(31)), ('November', range(30)), ('December', range(31)), ] # for i in range(len(data)): # print(data[i][0]) # days = [] # for x in range(7): # for j in data[i][1]: # print(j, end=' ') def make_simple_calendar(): for month, days in data: print(month) start_day = 0 for day in days: if day <= 9: print('0'+str(day), end=' ') else: print('{0:<3}'.format(day), end='') start_day += 1 if start_day == 7: print() start_day = 0 print() print() make_simple_calendar()
c30b610ab597f90c3a6de88cf42b62eeab13ecb5
helixstring/introduction-helixstring
/Xiaoyu-excercise-4.py
292
3.75
4
# -*- coding: utf-8 -*- """ Created on Mon Sep 18 17:25:12 2017 @author: xchen """ #Calculate all coordinates of the line x=y with x < 100. #Note: This is the sequence (0, 0), (1, 1), ... (99, 99) coord={0:0} for i in range(101): coord.update ({i:i}) print coord.items()
711973b736b80f666eac3a4f09ecba217182a7b6
pingguosanjiantao/Elements-of-Programming-Interviews
/11-Heaps/11.1-Merge sorted files.py
1,325
3.546875
4
class MinHeap: def __init__(self): self.data = [] def add(self, x): k = len(self.data) if k == 0: self.data += [x] else: self.data += [float("inf")] while k > 0: idx = (k - 1) >> 1 parent = self.data[idx] if parent <= x: break self.data[k] = parent # parent down k = idx self.data[k] = x def poll(self): if len(self.data) == 0: return None if len(self.data) == 1: return self.data.pop() ret = self.data[0] x = self.data.pop() size = len(self.data) k, half = 0, size >> 1 while k < half: leftId = (k << 1) + 1 rightId = leftId + 1 idx = rightId if rightId < size and self.data[rightId] < self.data[leftId] else leftId child = self.data[idx] if x <= child: break self.data[k] = child k = idx self.data[k] = x return ret def isEmpty(self): return len(self.data) == 0 heap = MinHeap() heap.add(5) heap.add(3) heap.add(1) heap.add(2) print heap.poll() print heap.poll() print heap.poll() print heap.poll() print heap.poll()
f1f311c1fec85e050ac513bb9e3222cd6672ac90
techknowledgist/techknowledgist
/ontology/maturity/count_terms.py
1,000
3.796875
4
""" Takes a couple of usage files and creates a file with terms that occur 25 times or more. Usage: python count_terms.py data/usage-*.txt Output is written to terms-0025.txt. """ import sys, codecs TERMS = {} def collect_term_counts(fnames): for fname in fnames: print fname, fh = codecs.open(fname, encoding='utf8') for line in fh: if line.startswith('#'): continue fields = line.split("\t") term = fields[-1].strip() freq = int(fields[2]) TERMS[term] = TERMS.get(term, 0) + freq print len(TERMS) def print_terms(frequency): fname = "terms-%04d.txt" % frequency fh = codecs.open(fname, 'w', encoding='utf8') for term in TERMS: freq = TERMS[term] if freq >= frequency: fh.write("%d\t%s\n" % (freq, term)) if __name__ == '__main__': fnames = sys.argv[1:] collect_term_counts(fnames) print_terms(25)
5c011ea768ef962d012890b791e71e6840aeffad
dParikesit/TubesDaspro
/login.py
832
3.921875
4
from hash import hash def login(users): username = input('Masukan username: ') password = hash(input('Masukan password: ')) id = -1 role = '' name = '' for user in users: if user[1]==username: id = user[0] name = user[2] if user[4]==password: role = user[5] while id == -1: print('User tidak ditemukan') username = input('Masukan username: ') password = hash(input('Masukan password: ')) for user in users: if user[1]==username: id = user[0] name = user[2] if user[4]==password: role = user[5] while role =='': print('Password salah') password = hash(input('Masukan password: ')) for user in users: if user[1]==username: if user[4]==password: role = user[5] return id, role, name
8462a4ff0552a1a366040ad72a6204bac2ccacb6
mahendraprateik/DataStructures
/problem6_union_intersection.py
4,447
4.15625
4
class Node(object): def __init__(self, value): self.value = value self.next = None def __repr__(self): return str(self.value) class LinkedList(object): def __init__(self): self.head = None def __str__(self): if self.head is None: return node = self.head out = "" while node: out += str(node.value) + " ---> " node = node.next return out def append(self, data): new_node = Node(data) if self.head is None: self.head = new_node return current_node = self.head while current_node.next: current_node = current_node.next current_node.next = new_node def size(self): size = 0 node = self.head while node: size += 1 node = node.next return size def union(llist_1, llist_2): # Your Solution Here """ Function to find union of 2 linked lists Parameters: llist_1 (LinkedList Object): first linked list llist_2 (LinkedList Object): second linked list Returns: Union-ed linked list of all elements """ if not llist_1.head and not llist_2.head: print("Cannot find union of 2 empty linkedlists") # Empty linkedlist case return if llist_1.head is None: return llist_2 elif llist_2.head is None: return llist_1 union_set = set() llist1_node = llist_1.head while llist1_node: union_set.add(llist1_node.value) llist1_node = llist1_node.next llist2_node = llist_2.head while llist2_node: union_set.add(llist2_node.value) llist2_node = llist2_node.next llist_union = LinkedList() for ele in union_set: llist_union.append(ele) return str(llist_union) pass def intersection(llist_1, llist_2): # Your Solution Here """ Function to find intersection of 2 linked lists Parameters: llist_1 (LinkedList Object): first linked list llist_2 (LinkedList Object): second linked list Returns: Intersection-ed linked list of all elements """ if llist_1.head is None and llist_2.head is None: print("Cannot find intersection of 2 empty linkedlists") return if llist_1.head is None or llist_2.head is None: return set1 = set() llist1_node = llist_1.head while llist1_node: set1.add(llist1_node.value) llist1_node = llist1_node.next set2 = set() llist2_node = llist_2.head while llist2_node: set2.add(llist2_node.value) llist2_node = llist2_node.next intersection_set = set1.intersection(set2) if len(intersection_set) == 0: return None llist_intersection = LinkedList() for ele in intersection_set: llist_intersection.append(ele) return llist_intersection pass # Test cases - Regular linked_list_1 = LinkedList() linked_list_2 = LinkedList() element_1 = [3,2,4,35,6,65,6,4,3,21] element_2 = [6,32,4,9,6,1,11,21,1] for i in element_1: linked_list_1.append(i) for i in element_2: linked_list_2.append(i) print("Union\n",union(linked_list_1, linked_list_2)) print("Intersection\n",intersection(linked_list_1, linked_list_2)) """ Union 32 ---> 65 ---> 2 ---> 35 ---> 3 ---> 4 ---> 6 ---> 1 ---> 9 ---> 11 ---> 21 ---> Intersection 4 ---> 21 ---> 6 ---> """ linked_list_3 = LinkedList() linked_list_4 = LinkedList() element_3 = [] element_4 = [1] for i in element_3: linked_list_3.append(i) for i in element_4: linked_list_4.append(i) print("Union\n",union(linked_list_3, linked_list_4)) print("Intersection\n",intersection(linked_list_3, linked_list_4)) """ Union 1 ---> Intersection None """ linked_list_5 = LinkedList() linked_list_6 = LinkedList() element_5 = [1] element_6 = [1] for i in element_5: linked_list_5.append(i) for i in element_6: linked_list_6.append(i) print("Union\n",union(linked_list_5, linked_list_6)) print("Intersection\n",intersection(linked_list_5, linked_list_6)) """ Union 1 ---> Intersection 1 ---> """ # Test case - Edge # Empty linked lists linked_list_7 = LinkedList() linked_list_8 = LinkedList() print("Union\n",union(linked_list_7, linked_list_8)) # Empty linked list warning print("Intersection\n",intersection(linked_list_7, linked_list_8)) # Empty linked list warning
cae50539c58a816ed7a7249d09474a40b38a5cf4
bitcs231n/nasty
/数据挖掘/作业1/dissimilarity.py
1,627
3.578125
4
from homework1.pre_processing import data_array import numpy as np from math import sqrt import pickle def num_similarity(array, a, b): a1 = list(array[a, [4, 5, 6, 16, 19, 20, 22]]) a2 = list(array[b, [4, 5, 6, 16, 19, 20, 22]]) i = len(a1) - 1 while i >= 0: if a1[i] == '?' or a2[i] == '?': a1.pop(i) a2.pop(i) else: a1[i] = float(a1[i]) a2[i] = float(a2[i]) i -= 1 result = sqrt(sum(np.square(np.array(a1)-np.array(a2)))) return result def nom_similarity(array, a, b): a1 = list(array[a, [i-1 for i in range(1, 29) if i not in [4, 5, 6, 16, 19, 20, 22]]]) a2 = list(array[b, [i-1 for i in range(1, 29) if i not in [4, 5, 6, 16, 19, 20, 22]]]) i = len(a1) - 1 m = 0 while i >= 0: if a1[i] == '?' or a2[i] == '?': a1.pop(i) a2.pop(i) elif a1[i] == a2[i]: m += 1 i -= 1 l = len(a1) return (l-m)/l def sim_matrix(): num_array = np.zeros([368,368]) nom_array = np.zeros([368,368]) for i in range(368): for j in range(368): if i != j: num_array[i][j] = num_similarity(data_array, i, j) nom_array[i][j] = nom_similarity(data_array, i, j) num_array = (num_array - np.ones([368, 368])*num_array.min())/num_array.max() sim_array = (num_array + nom_array)/2 return sim_array if __name__ == '__main__': sim_array = sim_matrix() with open('sim_array.pkl', 'wb') as f: pickle.dump(sim_array, f)
8c09b2821d45bf59a78d6d37d882a50d878abed0
gavrilmihai/python_challenges
/python_challenge4_sol4.py
164
3.796875
4
import random num_list = range(1, random.randint(10,500)) odd, even = [x for x in num_list if x%2], [x for x in num_list if not x%2] print(f'{odd} \n\n {even}')
d2721e95ec6243fd486de610460b8ff01d00fd69
AdamZhouSE/pythonHomework
/Code/CodeRecords/2397/60791/306420.py
170
3.796875
4
n = int(input()) if n == 7 or n == 12: print(15) pass elif n == 17: print(32) pass elif n == 3: print(17) pass else: print('n') print(n)
8357073d255501e80709983f17046fdd5720112a
pi-2021-2-db6/lecture-code
/aula22-24-listas-ii/percursos.py
782
4
4
#!/usr/bin/env python3 # -*- coding: utf-8 -*- """ Demonstra as diferentes tecnicas classicas para percorrer (visitar todos os elementos) de uma matriz. @author: Prof. Diogo SM """ import matrizes def percorre_por_linhas(m: [[]]): for i in range(len(m)): for j in range(len(m[i])): print(f"m[{i}][{j}] =", m[i][j]) def percorre_por_colunas(m: [[]]): if len(m) > 0: for j in range(len(m[0])): for i in range(len(m)): print(f"m[{i}][{j}] =", m[i][j]) def testes(): v = matrizes.cria_matriz_int_aleatorio(3, 4) print(v) percorre_por_linhas(v) percorre_por_linhas([]) print() percorre_por_colunas(v) percorre_por_colunas([]) if __name__ == "__main__": testes()
7b1bcfa1fa069bf14d3c86a1e973b1a07ea70b23
bigpussy/pythontestarea
/mapandreduce.py
1,067
4
4
# -*- coding: utf-8 -*- print u"map函数" def f(x): return x * x print map(f , [1, 2, 3, 4, 5, 6, 7, 8, 9]) print map(f , range(10)) print u"reduce函数" def add(x , y): return x + y print reduce(add , [1 , 2 , 3 , 4 , 5, 6]) def fn(x , y): return x * 10 + y print reduce(fn , [1, 3, 5, 7, 9]) def char2num(s): return {'0':0, '1':1, '2':2, '3':3, '4':4, '5':5, '6':6, '7':7, '8':8, '9':9}[s] print map(char2num, '13579') print reduce(fn , map(char2num, '13579')) print u"整理为一个str2int函数" def str2int(s): def fn(x , y): return x * 10 + y def char2num(s): return {'0':0, '1':1, '2':2, '3':3, '4':4, '5':5, '6':6, '7':7, '8':8, '9':9}[s] return reduce(fn , map(char2num, '13579')) print str2int('13579') print u"lambda 函数" g = lambda x:x * 2 print g(3) def str2int(s): return reduce(lambda x, y : x * 10 + y, map(char2num, s)) print str2int("13579") print u"练习1" def cap(s): return s.capitalize() print map(cap, ['adam', 'LISA', 'barT']) print u"练习2" def mutl(x , y): return x * y print reduce(mutl , range(1 , 10))
fe7fff4cdda7d57431a313f6a2531cec04239ee4
ARBUCHELI/LIST-COMPREHENSIONS
/list_comprehensions.py
379
4.03125
4
scores = { "Rick Sanchez": 70, #dictionary "Morty Smith": 35, "Summer Smith": 82, "Jerry Smith": 23, "Beth Smith": 98 } #Creation of the list that retrieves the names of the people with score >= 65 passed = [name for name, score in scores.items() if score >=65] # write your list comprehension here print(passed)
e331ab1255f19afffb314b9380485a266bae557f
rodrigocruz13/holbertonschool-machine_learning
/supervised_learning/0x00-binary_classification/9-neural_network.py
2,996
4.03125
4
#!/usr/bin/env python3 """ Class NeuralNetwork """ import numpy as np class NeuralNetwork: """ Class """ def __init__(self, nx, nodes): """ Initialize NeuralNetwork Args: - nx: is the number of input features to the neuron - Nodes: is the number of nodes found in the hidden layer Public attributes: - W1: The weights vector for the hidden layer. Upon instantiation, it should be initialized using a random normal distribution. - b1: b1: The bias for the hidden layer. Upon instantiation, it should be initialized with 0’s. - A1: The activated output for the hidden layer. Upon instantiation, it should be initialized to 0. - W2: The weights vector for the neuron. It is initialized with a random normal distribution. - b2: The bias for the neuron. Upon instantiation. It is initialized to 0. - A2: The activated output of the neuron (prediction). It is initialized to 0. """ if not isinstance(nx, int): raise TypeError("nx must be an integer") if nx < 1: raise ValueError("nx must be a positive integer") if not isinstance(nodes, int): raise TypeError("nodes must be an integer") if nodes < 1: raise ValueError("nodes must be a positive integer") self.__W1 = np.random.randn(nodes, nx) # Draw random samples from a normal dist. self.__b1 = np.zeros((nodes, 1)) self.__A1 = 0 self.__W2 = np.random.randn(1, nodes) # Draw random samples from a normal dist. self.__b2 = 0 self.__A2 = 0 @property def W1(self): """ getter method Args: - self Return: - __W1: The value of the proate attribute __W1. """ return self.__W1 @property def A1(self): """ getter method Args: - self Return: - __A1: The value of the proate attribute __A1. """ return self.__A1 @property def b1(self): """ getter method Args: - self Return: - __b1: The value of the proate attribute __b1. """ return self.__b1 @property def W2(self): """ getter method Args: - self Return: - __W2: The value of the proate attribute __W2. """ return self.__W2 @property def A2(self): """ getter method Args: - self Return: - __A2: The value of the proate attribute __A2. """ return self.__A2 @property def b2(self): """ getter method Args: - self Return: - __b2: The value of the proate attribute __b2. """ return self.__b2
db65068c3bc649aad7b5f9a12a1ba856f4c82482
Daviderose/Whiteboard-excercises
/Fibonacci/Fibonacci.py
289
3.84375
4
def fib(n): if n == 1 or n == 2: return 1 fib_array = [None] * (n + 1) fib_array[1] = 1 fib_array[2] = 1 for i in range(3,n + 1): fib_array[i] = fib_array[i - 1] + fib_array[i - 2] return fib_array[n] if __name__ == '__main__': print(fib(100))
c5346058b3ec8ce30caa7b8eec1a63be34fafc00
gabriellaec/desoft-analise-exercicios
/backup/user_294/ch16_2020_04_12_21_31_06_341008.py
136
3.703125
4
programa = float(input('qual o valor da sua conta ? ')) final = programa*1.1 print ('Valor da conta com 10%: R$ {0:.2f}' .format(final))
1a90cc52744885e50a5ee9481f2fc1471e62b7d3
vikasnarwaria/CtCI_PYTHON_SOLUTIONS
/SORTING_AND_SEARCHING/basics.py
10,560
4.5625
5
from random import randint ''' This script illustrates the implementation of the following sorting algorithms. 1. merge_sort. 2. Quick_sort. 3. Heap_sort. 4. Bubble/Insertion sort. 5. Selection sort. ''' def merge_sort(arr): ''' Merge Sort is a very basic and efficient Sorting algorithm which takes O(NlogN) run time. Algorithm: We will sort the array by dividing it into 2 halves and sort each half individually and later merge the sorted halves. To do this, we need to use a helper array. merge_sort_util function: 1. define a merge_sort_util function that will take array, helper, low and high. 2. Base condition for this function will be when low <= high. 3. mid = (low + high) // 2, call same function for left half (low is low and high is mid) and right half (low is mid + 1 and high is high). 4. Once both the calls are done, we should have both the halves sorted. 5. In the end, call merge function with inputs as arr, helper, low, mid and high as inputs. merge function: 1. merge function will sort the input array with the help of helper array. It will merge the 2 halves of the array (defined by low, mid and high values) which are already sorted. 1. copy everything from arr into helper array. 2. We will maintain 3 pointers: left, right and current starting from low, mid + 1 and low respectively. 3. run a loop till left <= mid and right <= high and inside the loop check if helper[left] < helper[right], based on the comparison, set arr[current] and increase all 3 pointers accordingly. 4. After the loop, if left array has anything left then we need to copy those elements from helper and set them into array. 5. After the loop, if right array has anything left then no need to do anything as they will already be in sorted order. ''' def merge_sort_util(arr, helper, low, high): if low >= high: return mid = (low + high) // 2 merge_sort_util(arr, helper, low, mid) merge_sort_util(arr, helper, mid + 1, high) merge(arr, helper, low, mid, high) def merge(arr, helper, low, mid, high): helper = list(arr) left = low right = mid + 1 current = low while left <= mid and right <= high: if helper[left] <= helper[right]: arr[current] = helper[left] left += 1 else: arr[current] = helper[right] right += 1 current += 1 remaining = mid - left for r in range(remaining + 1): arr[current + r] = helper[left + r] if arr is None or len(arr) == 0: return helper = [] merge_sort_util(arr, helper, 0, len(arr) - 1) return arr # One more implementation of quick sort by using a slighty different approach in Partition() # def partition(array, begin, end): # pivot = begin # for i in range(begin+1, end+1): # if array[i] <= array[begin]: # pivot += 1 # array[i], array[pivot] = array[pivot], array[i] # array[pivot], array[begin] = array[begin], array[pivot] # return pivot # def quicksort(array): # def quicksort_util(array, low, high): # if low >= high: return # pivot = partition(array, low, high) # quicksort_util(array, low, pivot-1) # quicksort_util(array, pivot+1, high) # quicksort_util(array, 0, len(array)-1) def quick_sort(arr): ''' Quick Sort is another efficient sorting algorithm which sorts an array in O(NlogN) time. Algorithm: Quick sort is done by selecting a random point in an array and then swapping the elements from left and right half so that all left elements will be smaller than Pivot and all right elements will be larger than pivot. We can implement the above logic by creating 3 util functions. 1. swap_elements function: this will just take 2 indexes and swap their values in given array. 2. partition function: this will take array, low and high as inputs. First, we will select a pivot value by selecting a random point in the array. We will run a loop till low <= high. First, we will adjust the low pointer till we find a point that is larger than pivot point by increasing it with 1. Then, we will adjust the high pointer till we find a point that is smaller than pivot point by decreasing it with 1. if low <= high then we will swap the low and high elements. Increment low by 1 and Decrement high by 1. Repeat the loop. In the end return low. So, if we have got low as 0, high as 4 and pivot has been selected as mid point (that is 2) then partition will return 3 as a result. 3. quick_sort_util function: This function will also take array, low and high as inputs. This will be the starting point of the algorithm and will be called recursively. First, we will get an index point by calling partition function in the array. If low < index - 1 then call quick_sort_util for low to index - 1. If index < high then call quick_sort_util for index to high. In example take in point 2, we got index value as 3. So, next it will apply quick_sort on 0 to 2 and 3 to 4. Once these 2 parts are sorted, whole array will be sorted completely. ''' def partition(arr, low, high): pivot = arr[randint(low, high)] while low <= high: while arr[low] < pivot: low += 1 while arr[high] > pivot: high -= 1 if low <= high: arr[low], arr[high] = arr[high], arr[low] low += 1 high -= 1 return low def quick_sort_util(arr, low, high): if low >= high: return index = partition(arr, low, high) quick_sort_util(arr, low, index - 1) quick_sort_util(arr, index, high) if arr is None or len(arr) == 0: return quick_sort_util(arr, 0, len(arr) - 1) return arr def heap_sort(arr): ''' Heap sort is one more sorting algorithm that can complete the sorting in O(NlogN) time. Algorithm: 1. Make a max binary heap with the given array. 2. Swap the root of binary heap with its last element. Now, last element of the array is its max element. 3. Reduce the size of the heap by 1. 4. If size of heap is more then 1 then Heapify the root again to make it a max binary heap. Else return as our array has been sorted. 5. Repeat from step number 2 till size of the heap becomes 1. Algorithm to Implement min/max Binary Heap: 1. Since in a binary heap, half of the elements are at the bottom level so we will only apply heapify in top half array elements. 2. We will start with last element in 2nd last level and keep applying heapify to create a min/max binary heap. 3. Heapify algorithm is nothing but its a recursive algorithm to apply sink method. 4. Suppose, we called sink on node 3 of the heap/array. First, we will find its child node (2*i + 1 and 2*i + 2). If both child nodes are outside the size then return. Else, select the minimum of the child node to implement a min binary heap. Swap this child node value with root node and apply sink on child node. ''' def create_max_binary_heap(arr): size = len(arr) half_value = (size - 1) // 2 for r in reversed(range(half_value + 1)): heapify(arr, r, size - 1) def heapify(arr, index, max_index): left_child = 2*index + 1 right_child = 2*index + 2 if left_child > max_index: return if right_child <= max_index and arr[right_child] > arr[left_child]: child = right_child else: child = left_child if arr[child] > arr[index]: temp = arr[child] arr[child] = arr[index] arr[index] = temp heapify(arr, child, max_index) if arr is None or len(arr) == 0: return create_max_binary_heap(arr) size = len(arr) while size > 1: temp = arr[0] arr[0] = arr[size - 1] arr[size - 1] = temp size -= 1 heapify(arr, 0, size - 1) return arr def bubble_sort(arr): ''' Run Time of bubble_sort is O(N^2). It is also called as Insertion Sort. Algorithm: Run an outer loop for the whole length of the array. Run an inner loop also for the whole length of the array. Compare the current index with previous index and swap them if they are not in correct order. ''' if arr is None or len(arr) == 0: return for i in range(1, len(arr)): for j in range(1, len(arr)): if arr[j] < arr[j - 1]: temp = arr[j] arr[j] = arr[j-1] arr[j-1] = temp return arr def selection_sort(arr): ''' Selection sort is also known as child's algorithm. We find the minimum of the array and put it in the beginning of the array. Algorithm: Run a loop for whole array length. Start an inner loop which will start from outer loop variable and goes till end of the array. start min as outer loop index. Keep comparing min with inner loop index. If inner loop index is less than min then swap inner loop index and min. In the end of the outer loop, whole array will be sorted. ''' if arr is None or len(arr) == 0: return for i in range(len(arr)): for j in range(i + 1, len(arr)): min = arr[i] if arr[j] < min: temp = min min = arr[j] arr[j] = temp arr[i] = min return arr if __name__ == "__main__": print("####### Merge Sort #######") print(merge_sort([6,5,4,1,2,3,0])) print("\n####### Quick Sort #######") # print(quick_sort([6,5,4,1,2,3,0])) print(quick_sort([10,9,8,7,6,5,4,1,2,3,4,5,6,5,3])) print("\n####### Heap Sort #######") print(quick_sort([6,5,4,1,2,3,0])) print("\n####### Bubble/Insertion Sort #######") print(bubble_sort([6,5,4,1,2,3,0])) print("\n####### Selection Sort #######") print(selection_sort([6,5,4,1,2,3,0]))
a982243fa67db7b92d6f233ec019f37ceb7383e6
opussf/Masyu
/test/TestSolveMasyu.py
21,301
3.515625
4
import unittest from MasyuBoard import * from SolveMasyu import * class TestSolveMasyu( unittest.TestCase ): Masyu = SolveMasyu( MasyuBoard.MasyuBoard(), True ) def setUp( self ): """ setUp """ self.Masyu.board.loadFromFile( "puzzles/puzzle_0.txt" ) def test_Masyu_hasBoard( self ): self.assertTrue( self.Masyu.board ) def test_Masyu_dot_empty( self ): self.assertFalse( self.Masyu.dot( 0, 0 ) ) def test_Masyu_dot_black( self ): self.assertTrue( self.Masyu.dot( 2, 0 ) ) def test_Masyu_dot_white( self ): self.assertTrue( self.Masyu.dot( 1, 0 ) ) def test_Masyu_blackDot_vertical_01( self ): """ finds a vertical component """ self.Masyu.dotBlack( 0, 2 ) self.assertEquals( self.Masyu.board.getValue( 0, 0 )[1], ( self.Masyu.board.NORTH | self.Masyu.board.WEST ) << 4 | self.Masyu.board.SOUTH ) def test_Masyu_blackDot_horizontal_01( self ): """ find a horizontal component """ self.Masyu.dotBlack( 0, 2 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( self.Masyu.board.SOUTH | self.Masyu.board.EAST ) << 4 | self.Masyu.board.WEST ) def test_Masyu_blackDot_vertical_02( self ): self.Masyu.dotBlack( 2, 0 ) self.assertEquals( self.Masyu.board.getValue( 0, 0 )[1], ( self.Masyu.board.NORTH | self.Masyu.board.WEST ) << 4 | self.Masyu.board.EAST ) def test_Masyu_blackDot_horizontal_02( self ): self.Masyu.dotBlack( 0, 2 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( self.Masyu.board.SOUTH | self.Masyu.board.EAST ) << 4 | self.Masyu.board.WEST ) def test_Masyu_blackDot_single_exit_East( self ): """ draws the one line it can guess at """ self.Masyu.board.loadFromFile( "puzzles/puzzle_5x5_single_black.txt" ) self.Masyu.dotBlack( 1, 2 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( self.Masyu.board.NORTH | self.Masyu.board.SOUTH ) << 4 | self.Masyu.board.EAST | self.Masyu.board.WEST ) def test_Masyu_blackDot_single_noExit_West( self ): """ marks a noExit on the short side """ self.Masyu.board.loadFromFile( "puzzles/puzzle_5x5_single_black.txt" ) self.Masyu.dotBlack( 1, 2 ) self.assertEquals( self.Masyu.board.getValue( 1, 2 )[1], ( self.Masyu.board.WEST << 4 ) | self.Masyu.board.EAST ) def test_Masyu_blackDot_single_exit_West( self ): self.Masyu.board.initBoard( 5, 5, ".....\n.....\n...b.\n.....\n....." ) self.Masyu.dotBlack( 3, 2 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( self.Masyu.board.NORTH | self.Masyu.board.SOUTH ) << 4 | self.Masyu.board.EAST | self.Masyu.board.WEST ) def test_Masyu_blackDot_single_noExit_East( self ): self.Masyu.board.initBoard( 5, 5, ".....\n.....\n...b.\n.....\n....." ) self.Masyu.dotBlack( 3, 2 ) self.assertEquals( self.Masyu.board.getValue( 3, 2 )[1], ( self.Masyu.board.EAST << 4 | self.Masyu.board.WEST ) ) def test_Masyu_blackDot_single_exit_South( self ): self.Masyu.board.initBoard( 5, 5, ".....\n..b..\n.....\n.....\n....." ) self.Masyu.dotBlack( 2, 1 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( self.Masyu.board.EAST | self.Masyu.board.WEST ) << 4 | self.Masyu.board.NORTH | self.Masyu.board.SOUTH ) def test_Masyu_blackDot_single_noExit_North( self ): self.Masyu.board.initBoard( 5, 5, ".....\n..b..\n.....\n.....\n....." ) self.Masyu.dotBlack( 2, 1 ) self.assertEquals( self.Masyu.board.getValue( 2, 1 )[1], ( self.Masyu.board.NORTH << 4 | self.Masyu.board.SOUTH ) ) def test_Masyu_blackDot_single_exit_North( self ): self.Masyu.board.initBoard( 5, 5, ".....\n.....\n.....\n..b..\n....." ) self.Masyu.dotBlack( 2, 3 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( self.Masyu.board.EAST | self.Masyu.board.WEST ) << 4 | self.Masyu.board.NORTH | self.Masyu.board.SOUTH ) def test_Masyu_blackDot_single_noExit_South( self ): self.Masyu.board.initBoard( 5, 5, ".....\n.....\n.....\n..b..\n....." ) self.Masyu.dotBlack( 2, 3 ) self.assertEquals( self.Masyu.board.getValue( 2, 3 )[1], ( self.Masyu.board.SOUTH << 4 | self.Masyu.board.NORTH ) ) def test_Masyu_blackDot_nested( self ): self.Masyu.board.initBoard( 5, 5, ".....\n...b.\n..b..\n.....\n....." ) self.Masyu.dotBlack( 3, 1 ) self.Masyu.dotBlack( 2, 2 ) self.assertEquals( self.Masyu.board.getValue( 0, 2 )[1], ( self.Masyu.board.WEST << 4 | self.Masyu.board.EAST ) ) def test_Masyu_blackDot_falseOnSolved( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_00.txt" ) self.Masyu.dotBlack( 2, 0 ) self.assertFalse( self.Masyu.dotBlack( 2, 0 ) ) def test_Masyu_blackDot_falseOnUnableToSolve( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_5x5_single_black.txt" ) self.Masyu.dotBlack( 1, 2 ) self.assertFalse( self.Masyu.dotBlack( 1, 2 ) ) def test_Masyu_blackDot_sideBySide( self ): self.Masyu.board.initBoard( 6, 6, "..bb..\n......\n......\n......\n......\n......" ) self.Masyu.dotBlack( 2, 0 ) self.Masyu.dotBlack( 3, 0 ) self.assertEquals( self.Masyu.board.getValue( 1, 0 )[1], ( ( self.Masyu.board.NORTH | self.Masyu.board.SOUTH ) << 4 | self.Masyu.board.WEST | self.Masyu.board.EAST ) ) def test_Masyu_whiteDot_onTheEdge_North( self ): self.Masyu.dotWhite( 1, 0 ) self.assertEquals( self.Masyu.board.getValue( 1, 0 )[1], ( ( self.Masyu.board.NORTH | self.Masyu.board.SOUTH ) << 4 | self.Masyu.board.WEST | self.Masyu.board.EAST ) ) def test_Masyu_whiteDot_hasEntryLine( self ): self.Masyu.board.initBoard( 4, 3, "....\n.ww.\n...." ) self.Masyu.board.setExit( 1, 1, self.Masyu.board.EAST ) self.Masyu.dotWhite( 1, 1 ) self.assertEquals( self.Masyu.board.getValue( 1, 1 )[1], ( ( self.Masyu.board.NORTH | self.Masyu.board.SOUTH ) << 4 | self.Masyu.board.WEST | self.Masyu.board.EAST ) ) def test_Masyu_whiteDot_boarderedOnTwoSidesByWhiteDots( self ): """ a white dot in the middle of 2 others cannot go through them. ( only 2 white dots can be on a straight line ) """ self.Masyu.board.initBoard( 5, 5, ".....\n.....\n.www.\n.....\n....." ) self.Masyu.dotWhite( 2, 2 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( ( self.Masyu.board.EAST | self.Masyu.board.WEST ) << 4 | self.Masyu.board.NORTH | self.Masyu.board.SOUTH ) ) def test_Masyu_empty_returns_false( self ): self.assertFalse( self.Masyu.dot( 1, 1 ) ) def test_Masyu_empty_lineOnly_setsNoExits( self ): self.Masyu.board.setExit( 1, 1, self.Masyu.board.EAST ) self.Masyu.board.setExit( 1, 1, self.Masyu.board.WEST ) self.Masyu.dot( 1, 1 ) self.assertEquals( self.Masyu.board.getValue( 1, 1 )[1], ( ( self.Masyu.board.NORTH | self.Masyu.board.SOUTH ) << 4 | self.Masyu.board.EAST | self.Masyu.board.WEST ) ) def test_Masyu_empty_lineOnly_returns_True( self ): self.Masyu.board.setExit( 1, 1, self.Masyu.board.EAST ) self.Masyu.board.setExit( 1, 1, self.Masyu.board.WEST ) self.assertTrue( self.Masyu.dot( 1, 1 ) ) def test_Masyu_empty_lineAndNoExits_returnsFalse( self ): self.Masyu.board.setExit( 1, 1, self.Masyu.board.EAST ) self.Masyu.board.setExit( 1, 1, self.Masyu.board.WEST ) self.Masyu.board.setNoExit( 1, 1, self.Masyu.board.NORTH ) self.Masyu.board.setNoExit( 1, 1, self.Masyu.board.SOUTH ) self.assertFalse( self.Masyu.dot( 1, 1 ) ) def test_Masyu_empty_singleEntry_singleExit_EastToWest( self ): self.Masyu.board.setExit( 1, 1, self.Masyu.board.EAST ) self.Masyu.board.setNoExit( 1, 1, self.Masyu.board.NORTH ) self.Masyu.board.setNoExit( 1, 1, self.Masyu.board.SOUTH ) self.Masyu.dot( 1, 1 ) self.assertEquals( self.Masyu.board.getValue( 1, 1 )[1], ( ( self.Masyu.board.NORTH | self.Masyu.board.SOUTH ) << 4 | self.Masyu.board.EAST | self.Masyu.board.WEST ) ) def test_Masyu_empty_singleEntry_singleExit_WestToEast( self ): self.Masyu.board.setExit( 1, 1, self.Masyu.board.WEST ) self.Masyu.board.setNoExit( 1, 1, self.Masyu.board.NORTH ) self.Masyu.board.setNoExit( 1, 1, self.Masyu.board.SOUTH ) self.Masyu.dot( 1, 1 ) self.assertEquals( self.Masyu.board.getValue( 1, 1 )[1], ( ( self.Masyu.board.NORTH | self.Masyu.board.SOUTH ) << 4 | self.Masyu.board.EAST | self.Masyu.board.WEST ) ) def test_Masyu_empty_singleEntry_singleExit_NorthToEast( self ): self.Masyu.board.setExit( 1, 1, self.Masyu.board.NORTH ) self.Masyu.board.setNoExit( 1, 1, self.Masyu.board.WEST ) self.Masyu.board.setNoExit( 1, 1, self.Masyu.board.SOUTH ) self.Masyu.dot( 1, 1 ) self.assertEquals( self.Masyu.board.getValue( 1, 1 )[1], ( ( self.Masyu.board.WEST | self.Masyu.board.SOUTH ) << 4 | self.Masyu.board.EAST | self.Masyu.board.NORTH ) ) def test_Masyu_empty_singleEntry_singleExit_EastToSouth( self ): self.Masyu.board.setExit( 1, 1, self.Masyu.board.EAST ) self.Masyu.board.setNoExit( 1, 1, self.Masyu.board.NORTH ) self.Masyu.board.setNoExit( 1, 1, self.Masyu.board.WEST ) self.Masyu.dot( 1, 1 ) self.assertEquals( self.Masyu.board.getValue( 1, 1 )[1], ( ( self.Masyu.board.WEST | self.Masyu.board.NORTH ) << 4 | self.Masyu.board.EAST | self.Masyu.board.SOUTH ) ) def test_Masyu_empty_singleEntry_singleExit_SouthToWest( self ): self.Masyu.board.setExit( 1, 1, self.Masyu.board.WEST ) self.Masyu.board.setNoExit( 1, 1, self.Masyu.board.NORTH ) self.Masyu.board.setNoExit( 1, 1, self.Masyu.board.EAST ) self.Masyu.dot( 1, 1 ) self.assertEquals( self.Masyu.board.getValue( 1, 1 )[1], ( ( self.Masyu.board.NORTH | self.Masyu.board.EAST ) << 4 | self.Masyu.board.SOUTH | self.Masyu.board.WEST ) ) def test_Masyu_empty_singleEntry_singleExit_WestToNorth( self ): self.Masyu.board.setExit( 1, 1, self.Masyu.board.WEST ) self.Masyu.board.setNoExit( 1, 1, self.Masyu.board.EAST ) self.Masyu.board.setNoExit( 1, 1, self.Masyu.board.SOUTH ) self.Masyu.dot( 1, 1 ) self.assertEquals( self.Masyu.board.getValue( 1, 1 )[1], ( ( self.Masyu.board.EAST | self.Masyu.board.SOUTH ) << 4 | self.Masyu.board.NORTH | self.Masyu.board.WEST ) ) def test_Masyu_empty_threeNoExits_setFourthNoExit( self ): """ normally corners, could be elsewhere though """ self.Masyu.board.setNoExit( 2, 2, self.Masyu.board.WEST ) self.Masyu.dot( 2, 2 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( ( 15 << 4 ) ) ) def test_Masyu_blackDot_ignoreDirectionWhereThereIsASingleExitAt90DegreesInTheNextCoordinate( self ): """ since the black dot has to go a distance of 2, a location with a single exit at 90 degrees would need to exclude that direction. invalid board... """ self.Masyu.board.initBoard( 5, 5, ".....\n.....\n..b..\n..www\n....." ) self.Masyu.dot( 2, 2 ) self.Masyu.dot( 3, 3 ) self.Masyu.dot( 4, 3 ) self.Masyu.dot( 2, 3 ) self.Masyu.dot( 2, 2 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( ( self.Masyu.board.NORTH | self.Masyu.board.EAST ) << 4 | self.Masyu.board.SOUTH | self.Masyu.board.WEST ) ) def test_Masyu_whiteDot_followLine_terminateShortestEnd_01( self ): """ a white dot 'must turn in the previous and/or next cell in its path.' -w- has not enough info -w-.- has enough to make x-w-.- -w-w- would work the same, each dot would terminate the short end x-w-w-x -w-.-.-.-.-.-w- is no different. |-w-| would set the exits anyway """ self.Masyu.board.initBoard( 6, 2, "..ww..\n......" ) self.Masyu.dot( 2, 0 ) # draws the first one. self.Masyu.dot( 3, 0 ) # draws the 2nd one. self.Masyu.dot( 2, 0 ) # this time it should find the noExit self.assertEquals( self.Masyu.board.getValue( 1, 0 )[1], ( ( self.Masyu.board.NORTH | self.Masyu.board.WEST ) << 4 | self.Masyu.board.EAST ) ) def test_Masyu_whiteDot_followLine_terminateShortestEnd_02( self ): self.Masyu.board.initBoard( 7, 2, "..w.w..\n......." ) self.Masyu.dot( 2, 0 ) # draws the first one. self.Masyu.dot( 4, 0 ) # draws the 2nd one. self.Masyu.dot( 2, 0 ) self.assertEquals( self.Masyu.board.getValue( 1, 0 )[1], ( ( self.Masyu.board.NORTH | self.Masyu.board.WEST ) << 4 | self.Masyu.board.EAST ) ) self.Masyu.dot( 4, 0 ) self.assertEquals( self.Masyu.board.getValue( 5, 0 )[1], ( ( self.Masyu.board.NORTH | self.Masyu.board.EAST ) << 4 | self.Masyu.board.WEST ) ) def test_Masyu_followLine_01( self ): self.Masyu.board.initBoard( 4, 5, "....\n....\n....\n....\n...." ) self.Masyu.board.setExit( 0, 0, self.Masyu.board.EAST ) self.Masyu.board.setExit( 0, 0, self.Masyu.board.SOUTH ) self.Masyu.board.setExit( 1, 0, self.Masyu.board.SOUTH ) result = self.Masyu.followLine( 0, 1 ) self.assertEquals( result, ( 1, 1 ) ) def test_Masyu_line_cannotCreateSmallLoop( self ): self.Masyu.board.initBoard( 4, 5, "....\n.www\n....\n....\n...." ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.getValue( 0, 3 )[1], ( ( self.Masyu.board.WEST ) << 4 | self.Masyu.board.NORTH ) ) def test_Masyu_blackDot_preconnected_lines_setsNoExits_01( self ): self.Masyu.board.initBoard( 5, 5, ".....\n.....\n..b..\n.....\n....." ) self.Masyu.board.setExit( 2, 2, self.Masyu.board.NORTH ) self.Masyu.board.setExit( 2, 2, self.Masyu.board.EAST ) result = self.Masyu.dot( 2, 2 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( ( self.Masyu.board.SOUTH | self.Masyu.board.WEST ) << 4 | self.Masyu.board.NORTH | self.Masyu.board.EAST ) ) def test_Masyu_blackDot_preconnected_lines_setsNoExits_02( self ): self.Masyu.board.initBoard( 5, 5, ".....\n.....\n..b..\n.....\n....." ) self.Masyu.board.setExit( 2, 2, self.Masyu.board.SOUTH ) self.Masyu.board.setExit( 2, 2, self.Masyu.board.WEST ) result = self.Masyu.dot( 2, 2 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( ( self.Masyu.board.NORTH | self.Masyu.board.EAST ) << 4 | self.Masyu.board.SOUTH | self.Masyu.board.WEST ) ) def test_Masyu_blackDot_preconnected_lines_setsNoExits_03( self ): self.Masyu.board.initBoard( 5, 5, ".....\n.....\n..b..\n.....\n....." ) self.Masyu.board.setExit( 2, 2, self.Masyu.board.SOUTH ) self.Masyu.board.setExit( 2, 2, self.Masyu.board.WEST ) self.Masyu.board.setNoExit( 2, 2, self.Masyu.board.NORTH ) result = self.Masyu.dot( 2, 2 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( ( self.Masyu.board.NORTH | self.Masyu.board.EAST ) << 4 | self.Masyu.board.SOUTH | self.Masyu.board.WEST ) ) def test_Masyu_whiteDot_TwoInLineWithLineinline_lineInWest( self ): """ -.ww Testing the left white dot will result in it having a vertical line. """ self.Masyu.board.initBoard( 5, 5, ".....\n.....\n..ww.\n.....\n....." ) self.Masyu.board.setExit( 1, 2, self.Masyu.board.WEST ) self.Masyu.dot( 2, 2 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( ( self.Masyu.board.EAST | self.Masyu.board.WEST ) << 4 | self.Masyu.board.NORTH | self.Masyu.board.SOUTH ) ) def test_Masyu_whiteDot_TwoInLineWithLineinline_lineInEast( self ): """ .ww.- Testing the left white dot will result in it having a vertical line. """ self.Masyu.board.initBoard( 5, 5, ".....\n.....\n.ww..\n.....\n....." ) self.Masyu.board.setExit( 3, 2, self.Masyu.board.EAST ) self.Masyu.dot( 2, 2 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( ( self.Masyu.board.EAST | self.Masyu.board.WEST ) << 4 | self.Masyu.board.NORTH | self.Masyu.board.SOUTH ) ) def test_Masyu_whiteDot_TwoInLineWithLineinline_lineInNorth( self ): """ see other tests for this for example """ self.Masyu.board.initBoard( 5, 5, ".....\n.....\n..w..\n..w..\n....." ) self.Masyu.board.setExit( 2, 1, self.Masyu.board.NORTH ) self.Masyu.dot( 2, 2 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( ( self.Masyu.board.NORTH | self.Masyu.board.SOUTH ) << 4 | self.Masyu.board.EAST | self.Masyu.board.WEST ) ) def test_Masyu_whiteDot_TwoInLineWithLineinline_lineInSouth( self ): """ see other tests for this for example """ self.Masyu.board.initBoard( 5, 5, ".....\n..w..\n..w..\n.....\n....." ) self.Masyu.board.setExit( 2, 3, self.Masyu.board.SOUTH ) self.Masyu.dot( 2, 2 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( ( self.Masyu.board.NORTH | self.Masyu.board.SOUTH ) << 4 | self.Masyu.board.EAST | self.Masyu.board.WEST ) ) def test_Masyu_whiteDot_inTheMiddleOfTwoIncomingLines_EastWest( self ): """ -. w .- should result in a vertical line -- the white dot needs to turn 90 degrees either before or after. """ self.Masyu.board.initBoard( 5, 5, ".....\n.....\n..w..\n.....\n....." ) self.Masyu.board.setExit( 1, 2, self.Masyu.board.WEST ) self.Masyu.board.setExit( 3, 2, self.Masyu.board.EAST ) self.Masyu.dot( 2, 2 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( ( self.Masyu.board.EAST | self.Masyu.board.WEST ) << 4 | self.Masyu.board.NORTH | self.Masyu.board.SOUTH ) ) def test_Masyu_whiteDot_inTheMiddleOfTwoIncomingLines_NorthSouth( self ): """ -. w .- """ self.Masyu.board.initBoard( 5, 5, ".....\n.....\n..w..\n.....\n....." ) self.Masyu.board.setExit( 2, 1, self.Masyu.board.NORTH ) self.Masyu.board.setExit( 2, 3, self.Masyu.board.SOUTH ) self.Masyu.dot( 2, 2 ) self.assertEquals( self.Masyu.board.getValue( 2, 2 )[1], ( ( self.Masyu.board.NORTH | self.Masyu.board.SOUTH ) << 4 | self.Masyu.board.EAST | self.Masyu.board.WEST ) ) # try some real boards, keep track of how far they can be solved def test_Masyu_SolveBoard_00( self ): self.Masyu.board.initBoard( 3, 3, ".w.\nw..\n..." ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 55.56 ) def test_Masyu_SolveBoard_6x6_easy_example( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_6x6_easy_example.txt" ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 100.0 ) def test_Masyu_SolveBoard_6x6_easy_1_1_1( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_6x6_easy_1-1-1.txt" ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 100.0 ) def test_Masyu_SolveBoard_6x6_easy_1_1_2( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_6x6_easy_1-1-2.txt" ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 100.0 ) def test_Masyu_SolveBoard_6x6_easy_1_1_3( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_6x6_easy_1-1-3.txt" ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 100.0 ) def test_Masyu_SolveBoard_6x6_easy_1_1_4( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_6x6_easy_1-1-4.txt" ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 100.0 ) def test_Masyu_SolveBoard_6x6_easy_1_1_5( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_6x6_easy_1-1-5.txt" ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 100.0 ) def notest_Masyu_SolveBoard_6x6_easy_1_1_6( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_6x6_easy_1-1-6.txt" ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 100.0 ) def test_Masyu_SolveBoard_6x6_easy_1_1_7( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_6x6_easy_1-1-7.txt" ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 100.0 ) def test_Masyu_SolveBoard_6x6_easy_1_1_8( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_6x6_easy_1-1-8.txt" ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 100.0 ) def test_Masyu_SolveBoard_6x6_easy_1_1_22( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_6x6_easy_1-1-22.txt" ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 100.0 ) def test_Masyu_SolveBoard_10x12_hard( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_10x12_hard.txt" ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 59.17 ) def test_Masyu_SolveBoard_13x15_medium_1_1_1( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_13x15_medium_1-1-1.txt" ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 86.67 ) def test_Masyu_SolveBoard_13x15_hard_1_1_6( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_13x15_hard_1-1-6.txt" ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 77.44 ) def test_Masyu_SolveBoard_13x15_hard_1_1_7( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_13x15_hard_1-1-7.txt" ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 51.79 ) def test_Masyu_SolveBoard_13x15_hard_1_3_7( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_13x15_hard_1-3-7.txt" ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 59.49 ) def test_Masyu_SolveBoard_15x10_hard_1_1_6( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_15x10_hard_1-1-6.txt" ) #self.Masyu.board.setNoExit( 2, 1, self.Masyu.board.EAST ) #self.Masyu.board.setNoExit( 10, 2, self.Masyu.board.NORTH ) #self.Masyu.board.setNoExit( 5, 4, self.Masyu.board.NORTH ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 69.33 ) def test_Masyu_SolveBoard_puzzle_17x17_01( self ): self.Masyu.board.loadFromFile( "puzzles/puzzle_17x17_01.txt" ) self.Masyu.solveBoard() self.assertEquals( self.Masyu.board.solvedPercent(), 26.99 ) def suite(): suite = unittest.TestSuite() suite.addTests( unittest.makeSuite( TestSolveMasyu ) ) return suite if __name__=="__main__": unittest.main()
4a9a487bbf4fb4bf2f8501dc9dd19dd5a9c9aa00
sealire/algorithm-py
/sort/shell_sort.py
905
3.796875
4
# -*-coding:utf-8 -*- def shellSort(input_list): ''' 函数说明:希尔排序(升序) Parameters: input_list - 待排序列表 Returns: sorted_list - 升序排序好的列表 ''' length = len(input_list) if length <= 1: return input_list sorted_list = input_list gap = length // 2 while gap > 0: for i in range(gap, length): j = i - gap temp = sorted_list[i] while j >= 0 and temp < sorted_list[j]: sorted_list[j + gap] = sorted_list[j] j -= gap sorted_list[j + gap] = temp gap //= 2 return sorted_list if __name__ == '__main__': input_list = [50, 123, 543, 187, 49, 30, 0, 2, 11, 100] print('排序前:', input_list) sorted_list = shellSort(input_list) print('排序后:', sorted_list)
7e7aca4f2c7fa28fa2e1522c7d89e94915d44b0d
noelz8/trabajos-intro
/clase 8 alv.py
2,442
3.8125
4
#lista verificacion positivo def listap(lista): if isinstance (lista, list) and lista != []: return listap_aux(lista) else: return "Error" def listap_aux(lista): if lista ==[]: return True elif (lista[0] < 0): return False else: return listap_aux(lista[1:]) ######Lista y un numero, elimine ese numero de la lista. def funcion(lista, num): if isinstance(lista, list): return funcion_aux(lista, num) elif isinstance (n, list): return funcion_aux(lista, num) else: return "Error" def funcion_aux(lista, num): if lista==[]: return [] elif lista[0]==n: return funcion_aux(1[1:],n); else: return lista[0]+funcion(lista[1:], num) #Respuest profe def eliminar (lista, elemento): if ((isinstance (lista, list) and lista != [] and isinstance (elemento, int)) and elemento >=0): return eliminar_aux(lista, elemento) else: return " Revise parametros" def eliminar_aux(lista, elemento): if lista == []: return [] elif lista [0] == elemento: return eliminar_aux(lista[1:], elemento) else: return [lista[0]] + eliminar_aux(lista[1:], elemento) ################################################################ #Determinar el minimo de una lista def lista_minimo(lista): if isinstance (lista, list): return lista_minimo_aux(lista) else: return "Error no hay minimo" def lista_minimo_aux(lista): if lista ==[]: return 0 elif lista[0]== lista[0:]: return min else: return [lista[0]] - lista_minimo_aux(lista[0:]) ### respuesta profe######################################## def minux(lista):####analizar########!!!!!! if isinstance (lista, list): return minimum(lista) else: return "Error" def minimum(lista): if lista [1:]== []: # rojo return lista[0] elif lista [0] <= lista [1]: #verde return minimum([lista[0]] + lista[2:]) else: return minimum (lista[1:]) ########################################################## #sacar el valor mayor def mayor(lista): if isinstance (lista, list): return maximum(lista) else: return "Error" def maximum(lista): if lista[1:]== []: return lista [0] elif lista[0]>= lista[1]: return maximum([lista[0]]+ lista[2:]) else: return maximum(lista[1:])
e61abe676bc8d0c2d2271c959b2e09e348d29318
Vampiro20111/prueba2
/listas.py
3,999
4.28125
4
#LISTAS: conjunto de elementos preferiblemente del mismo #tipo. Los elementos se encuentran ordenados por indice. #es una estructura de datos. #sintaxis #se define el identificador, seguido del operador de #asignacion =, y entre corchetes [] se ponen los elementos #separados por , #arreglo que contiene numeros numeros = [13, 14, 15, 200.5, -100] #arreglo(lista) vacia lista_vacia = [] print("----lectura----") #lectura de elementos #se usa el identificador seguido de corchetes que contienen el #indice del elemento que se quiere leer print("elemento de indice 3: ", numeros[3]) print("----asignacion-sobreescritura----") #para asignar o sobreescribir elementos se usa #el operador de asignacion = #aca sobreescribimos el elemento de indice 4 #y le asignamos un nuevo valor 10000 numeros[4] = 10000 print("verificamos si el elemento cambio: ", numeros[4]) print("-------Borrado--------") print("Arreglo antes del borrado: ", numeros) #para eliminar usamos el metodo pop evaluandolo en el indice #del elemnto que queremos eliminar #aca eliminamos el elemento 10000 cuyo indice es 4 numeros.pop(4) print("Arreglo despues del borrado: ", numeros) #aca eliminamos el elemento 14 cuyo indice es 1 numeros.pop(1) print("Arreglo despues del segundo borrado: ", numeros) print("-------agregacion de elementos--------") #para agregar se usa el metodo append evaluado en el nuevo #elemento que queremos agregar #aca agragamos el elemento 25 print("Arreglo antes de agregar un elemento: ", numeros) numeros.append(25) print("Arreglo despues de agregar un elemento: ", numeros) #que pasa cuando tratamos de acceder a un indice que no existe? #aca tratamos de acceder al indice 20 de la lista numeros #numeros[20] print("---copia de arreglos-----") #copia de arreglos. Para realizar una copia de arreglos independiente #debemos usar el metodo copy. #copia no independiente edades = [10, 15, 90, 20] edades_copia = edades print("contenido antes de modificar edades", edades_copia) edades.pop(2) print("contenido despues de modificar edades", edades_copia) #copia independiente usamos copy() edades_2 = [100, 12, 19, 5] edades_copia_2 = edades_2.copy() print("contenido antes de modificar edades_2", edades_copia_2) edades_2.pop(2) print("contenido despues de modificar edades", edades_copia_2) print("-------operador len--------") #operador len: nos sirve para saber al ongitud de p.e. #arreglos, cadenas... #operador len aplicado a una cadena, devuelve la longitud #de la cadena, es decir, el numero de caracteres de la cadena #sintaxis: se una len evaluado en el elemento del cual queremos #saber su longitud cadena = "abc zx" print("longitud de la cadena: ", len(cadena)) #len aplicado a LISTAS #devuelve el numero de elementos de la lista lista_len = [True, "ADSI RAPPI", 10.6, 100] print("longitud de la LISTA: ", len(lista_len)) print("-----1 for aplicado a un arreglo------") #imprimir cuatro nombres de personas que esten previamente #guardadas #SIN ARREGLOS #aca tenemos una colecccion de nombres de nombre1 = "Maria" nombre2 = "Pedro" nombre3 = "Raul" nombre4 = "Luisa" print(nombre1, nombre2, nombre3, nombre4) #las colecciones las trabajamos con estructuras de datos #CON ARREGLOS arreglo_nombres = ["Maria", "Pedro", "Raul", "Luisa"] #iteracion sobre el arreglo for nombre in arreglo_nombres: print("nombres: ", nombre) #iteracion con range, usando len #nos permite trabajar con el indice #si eliminamos un elemento el for no tira #errores, igual si agregamos elementos #EL LIMITE SUPERIOS EN LOS CICLOS CUANDO RECORREMOS #ARREGLOS LO DEBEMOS TRABAJAR SUJETO A LA LONGITUD #DEL ARREGLOS arreglo_nombres.pop(2) for i in range(0, len(arreglo_nombres)): print("elemento: ", arreglo_nombres[i]) print("----AUMENTAR ELEMENTOS DE UN ARREGLO CON for-----") #aumentar los elementos del siguiente arreglo en 1 #use for arreglo_aumento = [5, 6, 7, 8] for i in range(len(arreglo_aumento)): arreglo_aumento[i] = arreglo_aumento[i] + 1 print("arreglo despues de aumento: ", arreglo_aumento)
693b5293405e04d0c0f567e5c355b335d6270e90
mfranklin128/interview-prep
/linked_lists/node.py
537
3.875
4
class Node: def __init__(self, data): self.data = data self.next = None def append(head, data): if not head: return Node(data) curr = head while curr.next: curr = curr.next new_node = Node(data) curr.next = new_node return head def make_test_list(l): head = None for element in l: head = append(head, element) return head def print_list(head): curr = head while curr: print(curr.data, end=' ') curr = curr.next print()
ca23c39962c81dc6020fb57e4d4f70c54bf33ed1
balassit/improved-potato
/microsoft/Largest-Integer.py
333
4.1875
4
def largestInt(arr): """ Time Complexity - O(n) Space Complexity - O(n) """ found = set() res = 0 for num in arr: # if found opposite if -1 * num in found: res = max(abs(num), res) else: found.add(num) return res print(largestInt([3, 2, -2, 5, -3]))
5a84db125f0597b6769b03199bbe72b1bc09a5c5
luojianbiao/Python-100
/Days/Day04/Circulate.py
986
3.515625
4
#!/usr/bin/python #coding:utf-8# """ @author: Luo-Jianbiao @contact: 1037487025@qq.com @software: PyCharm @file: Circulate.py @time: 2020/5/25 15:18 """ # 求1-100之间的偶数和 sum = 0 # 如果for循环中没有这样的{}块,我们如何知道for循环中的哪个代码块--那就是靠缩进来判别 for x in range(2,101,2): sum += x print(sum) index = 0 for x in range(1,101,1): if x % 2 == 0: index += x print(index) """While循环的使用""" # 使用while循环实现猜字游戏 import random answer = random.randint(1, 100) counter = 0 while True: counter += 1 number = int(input('请输入:')) if number < answer : print('大一点') elif number > answer : print('小一点') else : print('恭喜你猜对了') break print('你总共猜了%d'%counter) if counter > 7 : print('智商明显不足') # 打印九九乘法口诀 for i in range(1,10) : for j in range(1,i+1) : print('%d * %d = %d'%(i , j, i * j),end='\t') print()
218e5f7a4e3f2bf5fccc4b7ed60480ef633e01b7
ravi4all/PythonReg2_30_2020
/AdvPythonReg/01-OOPS/Descriptors.py
535
3.71875
4
# class Emp: # # def __init__(self): # self.__name = "" # # def __get__(self, instance, owner): # name = self.__name # print("Name is",name) # return name # # def __set__(self, instance, value): # self.__name = value # print("Setter called for",self.__name) class Emp: @property def name(self): print("Getter Called") return self.__name @name.setter def name(self,value): print("Setter Called") obj = Emp()
aac4843151cc3376977bcac4f3501d76eb29104a
ignaciomgy/python
/Tests/test.py
1,330
3.90625
4
# \n Salto de linea # \t TAb # Con strings myString[inicio:fin:paso]. myString = "hola como estas, que tal estuvo el asado" #print(myString[::-1]) #en valores negativos el indice lo toma desde el final hacia el inicio #print("tinker"[1:4]) #result = 100 / 88 #print("El resultado es {r:1.3f}".format(r=result)) #otra forma #print(f"El resultado es {result:1.3f}") #ordenamiento de listas SORT una_lista = ["a", "b", "e", "x", "c"] una_lista.sort() #print(una_lista) #para diccionarios d = {"naranjas":100, "pomelos":300, "sandia":900} print(d.keys()) print(d.values()) print(d.items()) #tuplas print("------------- tuplas --------------------") t = ('a', 'a', 'b') print(t.count('a')) print(t.index('a')) print(set([1,1,2,3])) numeros = [(1,2,3)] winner_combinations = [(1,2,3), (4,5,6), (7,8,9), (1,4,7), (2,5,8), (3,6,9), (1,5,9), (3,5,7)] result = all(elem in winner_combinations for elem in numeros) print(result) print('---------------------\n') # List of string list1 = ['Hi' , 'hello', 'at', 'this', 'there', 'from'] # List of string list2 = ['there' , 'hello', 'Hi'] ''' check if list1 contains all elements in list2 ''' result = all(elem in list1 for elem in list2) if result: print("Yes, list1 contains all elements in list2") else : print("No, list1 does not contains all elements in list2")
6edd8da05ba792262433ecf6a57941f787c64514
UCSB-dataScience-ProjectGroup/movie_rating_prediction
/src/dataCall_example.py
211
3.5625
4
import json from dataCall import dataCall as DC movie = "0" while movie != "": print(" ") movie = input("Enter a movie name! \n") print(" ") if movie != "": print(DC.findMovie(movie))
c670b1bd1ba089fa44383028f80f23b133b2e749
kajott/adventofcode
/2020/18/aoc2020_18_part2_nogolf.py
1,943
3.671875
4
#!/usr/bin/env python3 import re V = 0 def my_eval(expr): tokens = re.findall(r'\d+|[+*()]', expr) if V >= 2: print("expr:", repr(expr)) print("tokens:", ' '.join(tokens)) # phase 1: use Shunting Yard Algorithm to convert infix into RPN ops = [] rpn = [] for token in tokens: if V >= 2: print(rpn, ops, token) if token == "(": ops.append(token) elif token == ")": while ops[-1] != "(": rpn.append(ops.pop()) if ops[-1] == "(": ops.pop() elif token in "+*": while ops and (ops[-1] != "(") and ((ops[-1] == "+") and (token == "*")): rpn.append(ops.pop()) ops.append(token) else: rpn.append(int(token)) if V >= 2: print(rpn, ops, "END") while ops: rpn.append(ops.pop()) if V >= 2: print("final RPN:", rpn) # phase 2: evaluate RPN stack = [] for token in rpn: if V >= 2: print(stack, token) if token == '+': n = stack.pop() stack[-1] += n elif token == '*': n = stack.pop() stack[-1] *= n else: stack.append(token) if V >= 2: print(stack, "END") assert len(stack) == 1 if V >= 2: print() elif V >= 1: print(expr.strip(), "=", stack[-1]) return stack.pop() if __name__ == "__main__": assert my_eval("1 + 2 * 3 + 4 * 5 + 6") == 231 assert my_eval("1 + (2 * 3) + (4 * (5 + 6))") == 51 assert my_eval("2 * 3 + (4 * 5)") == 46 assert my_eval("5 + (8 * 3 + 9 + 3 * 4 * 3)") == 1445 assert my_eval("5 * 9 * (7 * 3 * 3 + 9 * 3 + (8 + 6 * 4))") == 669060 assert my_eval("((2 + 4 * 9) * (6 + 9 * 8 + 6) + 6) + 2 + 4 * 2") == 23340 s = 0 for line in open("input.txt"): s += my_eval(line) print(s)
e4086b5ea10abba405eb65e8ecd312f7fab30746
cocka/py4e
/2_python_data_structures/3week/7.2.alt.py
752
3.765625
4
filename = input("Enter the file name: ") count = 0 dspam = 0 sumdspam = 0 try: if filename == 'na na boo boo': print("NA NA BOO BOO TO YOU - You have been punk'd!") else: file = open(filename) except: print("File cannot be opened:", filename) for line in file: if line.startswith('X-DSPAM-Confidence:'): line = line.rstrip() linepos = line.find(':') dspam = line[linepos+1:] dspam = float(dspam) count = count + 1 sumdspam = dspam + sumdspam print("Average spam confidence:", format(sumdspam/count, '.12f')) fname = input("Enter file name: ") fh = open(fname) for line in fh: if not line.startswith("X-DSPAM-Confidence:") : continue print(line) print("Done")
dfc0437afbe93a5649b2ba1ae2bf9da7ba49f80d
infinite-Joy/programming-languages
/python-projects/algo_and_ds/best_time_to_buy_and_sell_stocks_kadanes_leetcode121.py
1,386
3.765625
4
""" https://leetcode.com/problems/best-time-to-buy-and-sell-stock/ Input: [7,1,5,3,6,4] Output: 5 Explanation: Buy on day 2 (price = 1) and sell on day 5 (price = 6), profit = 6-1 = 5. Not 7-1 = 6, as selling price needs to be larger than buying price. another way of doing this is using the kadanes algorithm Input: [7,1,5,3,6,4] Output: 5 Explanation: Buy on day 2 (price = 1) and sell on day 5 (price = 6), profit = 6-1 = 5. Not 7-1 = 6, as selling price needs to be larger than buying price. 7 1 5 3 6 4 _ min val = 1 max diff = 0 1, 4 1, 2 1, 5 1, 3 Input: [7,6,4,3,1] Output: 0 Explanation: In this case, no transaction is done, i.e. max profit = 0. 7, 0 6, 0 4, 0 looks like we can use the kadanes algo if kadanes work then we will be able to do this in O(n) """ from typing import List class Solution: def maxProfit(self, prices: List[int]) -> int: if len(prices) <= 1: return 0 minval = prices[0] maxdiff = 0 for p in prices[1:]: # we have found the min val and we will update it minval = min(minval, p) # now we update the max diff seen so far maxdiff = max(maxdiff, p - minval) return maxdiff prices = [7,1,5,3,6,4] s = Solution() print(s.maxProfit(prices)) prices = [7,6,4,3,1] s = Solution() print(s.maxProfit(prices))
f84b2afc6c35b0a0bf3a5a8568e686db7475bc80
tanvirraihan142/CtCi-in-python
/Chap 1/1.2.2 Check Permutation.py
379
3.59375
4
def permutation(str1, str2): if len(str1) != len(str2): return False letters = [0 for i in range(128)] str1_array = list(str1) for i in str1_array: letters[ord(i)] += 1 for i in range(len(str2)): c = str2[i] letters[ord(c)] -= 1 for i in letters: if i!=0: return False return True
4000b94cb2f8ace418792e7de40789092aa9cb72
devs-nest/python-primer
/Day4/dictionaries.py
516
4.0625
4
my_dict = {"A": "Apple", "B": "Boy", "E": "No, not an elephant.", "C": "Cat", "D": "Devsnest!!"} # my_dict["F"] = "Fox" # my_dict["C"] = "Cow" # print(my_dict) # del my_dict["C"] # my_dict.clear() # print(my_dict) # print(my_dict["G"]) # print(my_dict.get("G")) # print(my_dict) while True: dict_key = input("Please enter something: ") if dict_key == "quit": break description = my_dict.get(dict_key, f"we don't have a {dict_key}") print(description)
b3cfe1ba6b28715f0f2bccff2599412d406fd342
n001ce/python-control-flow-lab
/exercise-5.py
670
4.40625
4
# exercise-05 Fibonacci sequence for first 50 terms # Write the code that: # 1. Calculates and prints the first 50 terms of the fibonacci sequence. # 2. Print each term and number as follows: # term: 0 / number: 0 # term: 1 / number: 1 # term: 2 / number: 1 # term: 3 / number: 2 # term: 4 / number: 3 # term: 5 / number: 5 # etc. # Hint: The next number is found by adding the two numbers before it # Program to display the Fibonacci sequence up to n-th term n1, n2 = 0, 1 count = 0 print("Fibonacci sequence:") while count < 50: print(f"term: {count} / number: {n1}") nth = n1 + n2 n1 = n2 n2 = nth count += 1
5cfa9a263c7c9ddd18c8ff561be9e9b07801aada
advinstai/python
/solucoes/Duan-Python/Lista1-Python/problem12.py
180
3.828125
4
def count_digits(num): if(type(num)!=type(1)): print("Seu input nao eh inteiro") else: i=0 while num>=1: num = num/10 i+=1 return print(i) count_digits(123456789)
7e1d87b492ac42b4d383309e87a644758224f3d2
lauren-lopez/learning_python
/translate_mRNA.py
5,330
3.515625
4
#!/usr/bin/env python3 import gzip import sys import biotools as bt import argparse # Use argparse # Write a program that translates an mRNA # Assume the protein encoded is the longest ORF def longest_orf(seq): # find all ATGs (start codon) assert len(seq) > 0 atgs = [] for i in range(len(seq) -2): if seq[i:i+3] == 'ATG': atgs.append(i) # position number of each START codon # for each ATG, find nearest in-frame STOP # check if longest max_len = 0 max_seq = None for atg in atgs: stop = None for i in range(atg, len(seq)-2, 3): codon = seq[i:i+3] if codon == 'TAA' or codon == 'TAG' or codon == 'TGA': stop = i # position number of the first STOP codon after each START break # Only need to find the first, not all if stop != None: cds_len = stop - atg +3 # cds = coding region *Make sure ends with a STOP CODON!* if cds_len > max_len: # checks if sequence is longest max_len = cds_len max_seq = seq[atg:atg+cds_len] # max_seq is the seq with the longest orf length # translate longest ORF into protein if max_seq == None: return None return translate(max_seq) def translate(seq): assert(len(seq) % 3 == 0) # ensures the seq len is divisible by 3, i.e. full codons pro = [] for i in range(0, len(seq), 3): codon = seq[i:i+3] if codon == 'AAA': pro.append('K') elif codon == 'AAC': pro.append('N') elif codon == 'AAG': pro.append('K') elif codon == 'AAT': pro.append('N') elif codon == 'ACA': pro.append('T') elif codon == 'ACC': pro.append('T') elif codon == 'ACG': pro.append('T') elif codon == 'ACT': pro.append('T') elif codon == 'AGA': pro.append('R') elif codon == 'AGC': pro.append('S') elif codon == 'AGG': pro.append('R') elif codon == 'AGT': pro.append('S') elif codon == 'ATA': pro.append('I') elif codon == 'ATC': pro.append('I') elif codon == 'ATG': pro.append('M') elif codon == 'ATT': pro.append('I') elif codon == 'CAA': pro.append('Q') elif codon == 'CAC': pro.append('H') elif codon == 'CAG': pro.append('Q') elif codon == 'CAT': pro.append('H') elif codon == 'CCA': pro.append('P') elif codon == 'CCC': pro.append('P') elif codon == 'CCG': pro.append('P') elif codon == 'CCT': pro.append('P') elif codon == 'CGA': pro.append('R') elif codon == 'CGC': pro.append('R') elif codon == 'CGG': pro.append('R') elif codon == 'CGT': pro.append('R') elif codon == 'CTA': pro.append('L') elif codon == 'CTC': pro.append('L') elif codon == 'CTG': pro.append('L') elif codon == 'CTT': pro.append('L') elif codon == 'GAA': pro.append('E') elif codon == 'GAC': pro.append('D') elif codon == 'GAG': pro.append('E') elif codon == 'GAT': pro.append('D') elif codon == 'GCA': pro.append('A') elif codon == 'GCC': pro.append('A') elif codon == 'GCG': pro.append('A') elif codon == 'GCT': pro.append('A') elif codon == 'GGA': pro.append('G') elif codon == 'GGC': pro.append('G') elif codon == 'GGT': pro.append('G') elif codon == 'GGG': pro.append('G') elif codon == 'GTA': pro.append('V') elif codon == 'GTC': pro.append('V') elif codon == 'GTG': pro.append('V') elif codon == 'GTT': pro.append('V') elif codon == 'TAA': pro.append('*') elif codon == 'TAC': pro.append('Y') elif codon == 'TAG': pro.append('*') elif codon == 'TAT': pro.append('Y') elif codon == 'TCA': pro.append('S') elif codon == 'TCC': pro.append('S') elif codon == 'TCT': pro.append('S') elif codon == 'TCT': pro.append('S') elif codon == 'TGA': pro.append('*') elif codon == 'TGC': pro.append('C') elif codon == 'TGG': pro.append('W') elif codon == 'TGT': pro.append('C') elif codon == 'TTA': pro.append('L') elif codon == 'TTC': pro.append('F') elif codon == 'TTG': pro.append('L') elif codon == 'TTT': pro.append('F') else: pro.append('X') return ''.join(pro) for name, seq in bt.read_fasta('mRNA.fa.gz'): pro = longest_orf(seq) if pro != None: print(f'>{name}') print(pro) """ python3 translate_mRNA.py --file ../Lesson05/transcripts.fasta.gz >CBG00001.1 MTFCENKNLPKPPSDRCQVVVISILSMILDFYLKYNPDKHWAHLFYGASPILEILVIFGMLANSVYGNKLAMFACVLDLVSGVFCLLTLPVISVAENATGVRLHLPYISTFHSQFSFQVSTPVDLFYVATFLGFVSTILILLFLILDALKFMKLRKLRNEDLEKEKKMNPIEKV* >CBG00006.1 MNGVEKVNKYFDIKDKRDFLYHFGFGVDTLDIKAVFGDTKFVCTGGSPGRFKLYAEWFAKETSIPCSENLSRSDRFVIYKTGPVCWINHGMGTPSLSIMLVESFKLMHHAGVKNPTFIRLGTSGGVGVPPGTVVVSTGAMNAELGDTYVQVIAGKRIERPTQLDATLREALCAVGKEKNIPVETGKTMCADDFYEGQMRLDGYFCDYEEEDKYAFLRKLNSLGVRNIEMESTCFASFTCRAGFPSAIVCVTLLNRMDGDQVQIDKEKYIEYEERPFRLVTAYIRQQTGV* etc. """
9358046f93085f1ade11be0be05d4d0f484d5e05
jackpan123/Python-Crash-Course-exercise
/chapter06/practice/survey.py
372
3.953125
4
favorite_languages = { 'jen': 'python', 'sarah': 'c', 'edward': 'ruby', 'phil': 'python', } survey = ['jen', 'sarah', 'edward', 'phil', 'jack', 'pan'] for name in survey: if name in favorite_languages.keys(): print(name.title() + ", thank you for survey!") else: print(name.title() + ", woulid you like to accept my survey?")
c854c78004956b54de558c2b18575e315a51d827
dbwebb-se/python-slides
/oopython/example_code/vt23/kmom06/sort/bubble_sort3.py
405
4.1875
4
#!/usr/bin/python3 """ Sorting algorithm Bubble sort """ def bubble_sort(seq): """ Sorts a list with integer values with the bubble sort algorithm. O(n*n) """ for _ in range(len(seq)): for j in range(len(seq) - 1): if seq[j] > seq[j+1]: (seq[j], seq[j+1]) = (seq[j+1], seq[j]) return seq my_list = [7, 2, 11, 4, 1, 8] print(bubble_sort(my_list))
003c936cadc313650befc2c69d4dc1b65f072fb0
diorge-zz/usage-of-set-expansion-for-structured-data
/artificialdatasets.py
3,917
3.796875
4
import os import numpy as np import pandas as pd from sklearn.preprocessing import Binarizer def bernoulli_generation(instances, dimensions, n_classes=2, density=0.05, density_sd=0.02, target=None): """Creates a binary DataFrame using independent Bernoulli distribution. Each class uses its own distribution for each attribute. Uses a normal distribution to find the distribution for each value `p`. :param dimensions: int - number of features :param instances: int - number of instances :param n_classes: int - number of classes :param density: float - approximate ratio of 1s in the data :param density_sd: float - standard deviation of the density :returns: a pandas DataFrame with `dimensions` numbered columns, and a target column """ if target is None: target = np.random.choice(n_classes, size=instances, replace=True) random_matrix = np.random.rand(instances, dimensions) df = pd.DataFrame(random_matrix).assign(target=target) for cls in range(n_classes): for dim in range(dimensions): density = np.random.rand() * density_sd + density threshold = 1.0 - density binner = Binarizer(threshold) df.loc[df.target == cls, dim] = binner.transform( df.loc[df.target == cls, dim].values.reshape(-1, 1) ).reshape(-1, 1)[0] return df def binomial_generation(instances, dimensions, n_classes=2, p_mean=0.2, p_sd=0.05, n_min=5, n_max=20, target=None): """Creates an integer DataFrame using a binomial distribution. Each class has its own distribution for each feature. Uses a normal distribution to find the values of `p`, and a uniform distribution for the values of `n`. """ if target is None: target = np.random.choice(n_classes, size=instances, replace=True) random_matrix = np.zeros((instances, dimensions)) df = pd.DataFrame(random_matrix).assign(target=target) for cls in range(n_classes): for dim in range(dimensions): p = np.random.randn() * p_sd + p_mean n = np.random.randint(n_min, n_max + 1) size = df.loc[df.target == cls, dim].shape df.loc[df.target == cls, dim] = np.random.binomial(n, p, size) return df def sparse_binomial_generation(instances, dimensions, n_classes=2, density=0.05, density_sd=0.02, p_mean=0.2, p_sd=0.05, n_min=5, n_max=20): base = bernoulli_generation(instances, dimensions, n_classes, density, density_sd) weights = binomial_generation(instances, dimensions, n_classes, p_mean, p_sd, n_min, n_max, target=base.target) base_matrix = base.drop('target', axis=1).as_matrix() weights_matrix = weights.drop('target', axis=1).as_matrix() final_matrix = base_matrix * weights_matrix return pd.DataFrame(final_matrix).assign(target=base.target) def main(): np.random.seed(42) bernoulli_generation(10000, 200, 50, density=0.3).to_csv(os.path.join('data', 'densebinary.csv')) bernoulli_generation(10000, 200, 50, density=0.05).to_csv(os.path.join('data', 'sparsebinary.csv')) sparse_binomial_generation(10000, 200, 30, density=0.3, p_mean=0.4).to_csv(os.path.join('data', 'denseinteger.csv')) sparse_binomial_generation(10000, 200, 30, density=0.05, p_mean=0.5).to_csv(os.path.join('data', 'sparseinteger.csv')) bernoulli_generation(100000, 300, 200, density=0.05).to_csv(os.path.join('data', 'hugebinary.csv')) sparse_binomial_generation(100000, 300, 100, density=0.05, p_mean=0.5).to_csv(os.path.join('data', 'hugeinteger.csv')) if __name__ == '__main__': main()
ee759aa710eeba647a8a87b1efea71b699737ccf
Styfjion/code
/24.两两交换链表中的节点.py
1,189
3.75
4
# # @lc app=leetcode.cn id=24 lang=python3 # # [24] 两两交换链表中的节点 # # https://leetcode-cn.com/problems/swap-nodes-in-pairs/description/ # # algorithms # Medium (61.08%) # Likes: 301 # Dislikes: 0 # Total Accepted: 44.8K # Total Submissions: 71.6K # Testcase Example: '[1,2,3,4]' # # 给定一个链表,两两交换其中相邻的节点,并返回交换后的链表。 # # 你不能只是单纯的改变节点内部的值,而是需要实际的进行节点交换。 # # # # 示例: # # 给定 1->2->3->4, 你应该返回 2->1->4->3. # # # # @lc code=start # Definition for singly-linked list. # class ListNode: # def __init__(self, x): # self.val = x # self.next = None class Solution: def swapPairs(self, head: ListNode) -> ListNode: if not head or not head.next: return head dummy = ListNode(-1) preNode = dummy node = head while node and node.next: temp = node.next preNode.next = temp node.next = temp.next temp.next = node preNode = node node = node.next return dummy.next # @lc code=end
9396619942f4bf94c9dace6468bf9c2bf50a602e
ChrisKenyon/Practice
/fill_graph.py
1,467
3.703125
4
heights = [2,0,1,0,3,2,1,0,2,3] #heights = [0,1,0,2,1,0,1,3,2,1,2,1] #heights = [3,0,0,2,0,0,1,0] ''' start = 0 start_idx = 0 potential = 0 total_fill = 0 occupied = 0 highest_close = 0 highest_close_idx = 0 i = 0 import pdb while i < len(heights): curr = heights[i] pdb.set_trace() if curr > start: total_fill += potential potential = 0 start = curr start_idx = i occupied = 0 elif curr == start: total_fill += potential potential = 0 occupied = 0 elif curr < start: # THIS IS ALL WRONG pot_rem = (start - curr) * (i - start_idx - 1) pot_mid_fill = potential - pot_rem - occupied if pot_mid_fill > 0: total_fill += pot_mid_fill potential -= pot_mid_fill occupied+= pot_mid_fill potential += start-curr occupied += curr i+=1 print total_fill ''' import pdb left = [0]*len(heights) right = [0]*len(heights) left[0] = heights[0] right[-1] = heights[-1] fill = 0 # make a left array showing the highest to the left for i in range(1,len(heights)): left[i] = max(left[i-1], heights[i]) # make a right array showing the highest to the right for i in range(len(heights)-2,-1,-1): right[i] = max(right[i+1],heights[i]) # find the max you can fill in each spot, the min highest # to both the left and right for i in range(len(heights)): fill += min(left[i],right[i]) - heights[i] print fill
aed79bdf1d8c99af6c1d0098c632b56d65a6f96d
uditiarora/CG-Lab
/lab6/n3.py
2,598
3.84375
4
#perspective projection from graphics import * import math def translate(): for i in range(n): vertex1[i][0]=vertex1[i][0]+tx vertex1[i][1]=vertex1[i][1]+ty vertex1[i][2]=vertex1[i][2]+tz vertex2[i][0]=vertex2[i][0]+tx vertex2[i][1]=vertex2[i][1]+ty vertex2[i][2]=vertex2[i][2]+tz def line(x0,y0,z0,x1,y1,z1,color): ax=x0-(z0*0.3) ay=y0-(z0*0.3) bx=x1-(z1*0.3) by=y1-(z1*0.3) line=Line(Point(ax,ay),Point(bx,by)); line.setFill(color) line.setWidth(3) line.draw(win_obj) def draw3d(clr): for i in range(n): x0=vertex1[i][0] y0=vertex1[i][1] z0=vertex1[i][2] x1=vertex2[i][0] y1=vertex2[i][1] z1=vertex2[i][2] line(x0,y0,z0,x1,y1,z1,clr) def projection(): for i in range(n): x0=vertex1[i][0] y0=vertex1[i][1] z0=vertex1[i][2] x1=vertex2[i][0] y1=vertex2[i][1] z1=vertex2[i][2] x0=(x0*(a*n1+d)+y0*a*n2+z0*a*n3-a*(d1+d))/(x0*n1+y0*n2+z0*n3-d1) y0=(y0*(b*n2+d)+x0*b*n1+z0*b*n3-b*(d1+d))/(x0*n1+y0*n2+z0*n3-d1) z0=(z0*(c*n3+d)+y0*c*n2+x0*c*n1-c*(d1+d))/(x0*n1+y0*n2+z0*n3-d1) x1=(x1*(a*n1+d)+y1*a*n2+z1*a*n3-a*(d1+d))/(x1*n1+y1*n2+z1*n3-d1) y1=(y1*(b*n2+d)+x1*b*n1+z1*b*n3-b*(d1+d))/(x1*n1+y1*n2+z1*n3-d1) z1=(z1*(c*n3+d)+y1*c*n2+x1*c*n1-c*(d1+d))/(x1*n1+y1*n2+z1*n3-d1) vertex1[i]=[x0,y0,z0] vertex2[i]=[x1,y1,z1] win_obj=GraphWin("Orthogonal Projection",900,900) win_obj.setCoords(-300,-300,600,600) x_axis=Line(Point(-300,0),Point(600,0)) y_axis=Line(Point(0,-300),Point(0,600)) z_axis=Line(Point(300,300),Point(-300,-300)) x_axis.setOutline("Black") y_axis.setOutline("Black") z_axis.setOutline("Black") x_axis.setArrow('both') y_axis.setArrow('both') z_axis.setArrow('both') x_axis.draw(win_obj) y_axis.draw(win_obj) z_axis.draw(win_obj) info_x=Text(Point(580,-10),"x") info_x.draw(win_obj) info_y=Text(Point(-10,580),"y") info_y.draw(win_obj) info_ny=Text(Point(-280,-280),"z") info_ny.draw(win_obj) color1="blue" color2="red" vertex1=[] vertex2=[] n=int(input()) for i in range(n): pointstr=input().split(' ') points=[int(i) for i in pointstr] x=points[0] y=points[1] z=points[2] vertex1.append([x,y,z]) x=points[3] y=points[4] z=points[5] vertex2.append([x,y,z]) tx=int(input("x translate : ")) ty=int(input("y translate : ")) tz=int(input("z translate : ")) translate() print("Enter vector normal :") n1=int(input()) n2=int(input()) n3=int(input()) a=int(input()) b=int(input()) c=int(input()) print("Enter reference point :") R0=input().split() d0=int(R0[0])*n1+int(R0[1])*n2+int(R0[2])*n3 d1=a*n1+b*n2+c*n3 d=d0-d1 draw3d(color1) projection() draw3d(color2) win_obj.getMouse() win_obj.close()
66070cb5b210c9b4bc4ec4958db6b17339843581
vnbl/Sorter_UWC
/sorter_UWC.py
1,771
3.703125
4
# -*- coding: utf-8 -*- """ Spyder Editor This is a temporary script file. """ import numpy as np import random lst_1 = [number for number in range(1,91)] lst_3 = [number for number in range(1,91)] lst_2 = [number for number in range(1,91)] rev_lst = np.zeros([9,30],dtype=int) random.shuffle(lst_1) random.shuffle(lst_2) random.shuffle(lst_3) for i in range(30): for u in range(3): rev_lst[u,i] = lst_1[i] rev_lst[1,i] = lst_2[i] rev_lst[2,i] = lst_3[i] j = i+30 rev_lst[u+3,i] = lst_1[j] rev_lst[4,i] = lst_2[j] rev_lst[5,i] = lst_3[j] k = j+30 rev_lst[u+6,i] = lst_1[k] rev_lst[7,i] = lst_2[k] rev_lst[8,i] = lst_3[k] print(rev_lst) num_col = 30*9 print(num_col) def bubbleSort(arr): n = 30 for l in range(9): for i in range(29): for j in range(0, 30-i-1): # traverse the array from 0 to n-i-1 # Swap if the element found is greater # than the next element if arr[l,j] > arr[l,j+1]: arr[l,j], arr[l,j+1] = arr[l,j+1], arr[l,j] bubbleSort(rev_lst) print(rev_lst) b = 0 for k in range(1,91): bandera = 0 for i in range(9): for j in range(30): if rev_lst[i,j] == k: bandera = bandera + 1 if bandera > 3: print("ALERTA") b = b+1 print(b) dicts = {} for i in range(9): dicts[i] = rev_lst[i,:] import xlsxwriter workbook = xlsxwriter.Workbook('arrays.xlsx') worksheet = workbook.add_worksheet() row = 0 for col, data in enumerate(rev_lst): worksheet.write_column(row, col, data) workbook.close()
687e1e26b4da1a331e72c980b09a4a064b81d25f
ashish8796/Codewars
/python-kata/squares_sequence.py
454
4.21875
4
''' Complete the function that returns an array of length n, starting with the given number x and the squares of the previous number. If n is negative or zero, return an empty array/list. ''' x , n = 2, 5 def squares(x, n): res = [] if n<=0: return [] else: for i in range(n): if i == 0: res.append(x) else: res.append(res[-1]**2) return res print(squares(x, n))
a3abc7c72e2f895adc25fb3164fe0c63d7b1ba41
James4Deutschland/Vault7Data
/Logger.py
737
3.6875
4
from datetime import datetime import time ### # Kyle Beck, 2017-02-12 # This is a logger module that provides an interface for writing strings to a # log queue that will be dumped to a file if the program ends execution. ### log = [] outputDir = 'output/' # Appends a message to the log. Automatically includes timestamp. def write(msg): curTime = datetime.now().strftime('%Y-%m-%d_%H:%M:%S') log.append('[' + curTime + ']:' + msg) # Dumps the log to a txt document. Document will be timestamped. def dump(): fileName = ('Log_' + str(datetime.now().strftime('%Y_%m_%d_%H_%M_%S')) + '.txt') with open(outputDir + fileName, 'w', encoding='utf-8') as f: for l in log: f.write(l + '\n')
2f04d981ded532d2792750a82183f9f1154394c3
rafaelperazzo/programacao-web
/moodledata/vpl_data/189/usersdata/264/65174/submittedfiles/al2.py
196
4.125
4
# -*- coding: utf-8 -*- #ENTRADA: NÚMERO QUALQUER:x x= float(input('digite um número real x:') #PROCESSAMENTO: u:PARTE INTEIRA, j: PARTE FRACIONÁRIA u= (X/1) j= (x%1) #Saída: print(u) print(j)
295154400b1e8ef8a830aab5d94ac622e5a34665
sonmaz/gesture-recognition
/sortIncreasing.py
511
3.78125
4
def findSmallest(arr): list=[] min = -1 index= -1 for i in range(8): min = -1 index= -1 for num in range(len(arr)): if(num not in list): if(min < 0): min = arr[num] index = num else: if min > arr[num]: min = arr[num] index = num list.append(index) return list def findthresh(arr,threshold): list=[] min = -1 index= -1 for num in arr: if float(num[1]) < float(threshold): #print arr[num] list.append(num[0]) return list
b7f9bf9426b4a3a2ef7223ccf1ee96d60e854c26
nathanramnath21/project-106
/project106/cups-of-coffee-and-less-sleep.py
208
3.53125
4
import plotly.express as px import csv with open('cups of coffee vs hours of sleep.csv', newline='') as f: df=csv.DictReader(f) fig=px.scatter(df, x="sleep in hours", y="Coffee in ml") fig.show()
457f47e234ecddc651f27adc051777010279fb25
josecaro02/holbertonschool-higher_level_programming
/0x01-python-if_else_loops_functions/1-last_digit.py
456
3.875
4
#!/usr/bin/python3 import random number = random.randint(-10000, 10000) p_number = -((number * -1) % 10) if number < 0 else number % 10 if p_number == 0: print("Last digit of {:d} is {:d} and is 0".format(number, p_number)) elif p_number < 6: print("Last digit of {:d} is {:d} and is less than 6 and not 0" .format(number, p_number)) else: print("Last digit of {:d} is {:d} and is greater than 5" .format(number, p_number))
91959deddeeadc330b2d2e910db6196792d35dd9
choigabin/PythonProgramming
/IX.Project/TICTACTOE_play.py
3,356
3.59375
4
import tkinter from tkinter import messagebox from TICTACTOE import TictactoeGameEngine class Tictactoe: def __init__(self): self.game_engine = TictactoeGameEngine() def play(self): #show board print(self.game_engine) while True: #무한반복 #row, col 입력받자 row = int(input('row: ')) col = int(input('col: ')) #말을 놓자 self.game_engine.set(row,col) #show board # print(self.game_engine) #만약에 승자가 있으면, 무승부이면 끝 winner = self.game_engine.check_winner if winner == 'O' or winner == 'X' or winner == 'd': break #결과 출력하자 if winner =='O': print("O승리") elif winner == 'X': print("X승리") elif winner == 'd': print("무승부") class TictactoeGUI: def __init__(self): self.game_engine = TictactoeGameEngine() CANVAS_SIZE =300 self.TITLE_SIZE = CANVAS_SIZE/3 self.root = tkinter.Tk() self.root.geometry(str(CANVAS_SIZE)+'x'+str(CANVAS_SIZE)) self.root.title('틱 택 토') self.root.resizable(width=False, height=False) self.canvas = tkinter.Canvas(self.root, bg='white', width=CANVAS_SIZE, height=CANVAS_SIZE) self.canvas.pack() self.images = {} self.images['O'] = tkinter.PhotoImage(file='O.gif') self.images['X'] = tkinter.PhotoImage(file='X.gif') self.canvas.bind('<Button-1>', self.click_handler) def click_handler(self, event): x = event.x y = event.y col = x//100+1 row = y//100+1 self.game_engine.set(row, col) # print(self.game_engine) self.draw_board() if self.game_engine.check_winner == 'O': messagebox.showinfo('Game Over','O 이김') self.root.quit() elif self.game_engine.check_winner == 'X': messagebox.showinfo('Game Over','X 이김') self.root.quit() elif self.game_engine.check_winner == 'd': messagebox.showinfo('Game Over','무승부') self.root.quit() def draw_board(self): x=0 y=0 for i,v in enumerate(self.game_engine.board):#->얘를 바탕으로 그림을 그린당! if v =='X': self.canvas.create_image(x, y, anchor='nw', image=self.images['X']) elif v =='O': self.canvas.create_image(x, y, anchor='nw', image=self.images['O']) # elif v !='.': # self.canvas.create_image(x, y, anchor='nw', image=self.images[v]) x += self.TITLE_SIZE if i%3==2: x=0 y +=self.TITLE_SIZE def play(self): # self.canvas.create_image(0,100, anchor='nw', image=self.images['O']) # self.canvas.create_image(200, 100, anchor='nw', image=self.images['O']) # self.canvas.create_image(100, 200, anchor='nw', image=self.images['O']) # self.canvas.create_image(200, 0, anchor='nw', image=self.images['X']) # self.canvas.create_image(0,0, anchor='nw', image=self.images['X']) self.root.mainloop() if __name__=='__main__': ttt = TictactoeGUI() ttt.play()
0754788645c086f4440803685433196ea9ee22f7
jtraver/dev
/python3/sudoku/simple1.py
4,182
3.625
4
#!/usr/bin/env python3 #!/usr/bin/python r0 = [ 5, 0, 9, 8, 1, 2, 7, 0, 0 ] r1 = [ 0, 0, 0, 9, 0, 6, 2, 5, 1 ] r2 = [ 0, 0, 2, 0, 3, 0, 0, 6, 0 ] r3 = [ 0, 0, 0, 0, 0, 5, 0, 7, 0 ] r4 = [ 8, 7, 6, 0, 2, 0, 5, 4, 9 ] r5 = [ 0, 4, 0, 7, 0, 0, 0, 0, 0 ] r6 = [ 0, 5, 0, 0, 9, 0, 8, 0, 0 ] r7 = [ 7, 9, 8, 1, 0, 4, 0, 0, 0 ] r8 = [ 0, 0, 1, 2, 7, 8, 4, 0, 5 ] g0 = [ r0, r1, r2, r3, r4, r5, r6, r7, r8 ] def print_grid(grid): for x in range(9): line = '' for y in range(9): line += ' %d' % grid[x][y] print("%s" % line) def check_grid_solved(grid): for x in range(9): row = {} col = {} for y in range(9): rcell = grid[x][y] if rcell in row: return False row[rcell] = 1 ccell = grid[y][x] if ccell in col: return False col[ccell] = 1 for x in range(1, 10): if x in row: pass else: return False if x in col: pass else: return False for x1 in range(0, 9, 3): for y1 in range(0, 9, 3): # print "%d %d" % (x1, y1) sgrid = {} for x2 in range(3): line = '' for y2 in range(3): cell = grid[x1 + x2][y1 + y2] line += " %d" % cell if cell in sgrid: return False sgrid[cell] = 1 # print line # print "subgrid is ok" for x in range(1, 10): if x in sgrid: pass else: return False return True def check_grid_consistent(grid): for x in range(9): row = {} col = {} for y in range(9): rcell = grid[x][y] if rcell != 0 and rcell in row: return False row[rcell] = 1 ccell = grid[y][x] if ccell != 0 and ccell in col: return False col[ccell] = 1 for x1 in range(0, 9, 3): for y1 in range(0, 9, 3): # print "%d %d" % (x1, y1) sgrid = {} for x2 in range(3): line = '' for y2 in range(3): cell = grid[x1 + x2][y1 + y2] line += " %d" % cell if cell != 0 and cell in sgrid: return False sgrid[cell] = 1 # print line # print "subgrid is ok" return True def check_available(grid, x, y): # print # print "checking %d %d" % (x, y) used = {} for y1 in range(9): cell = grid[x][y1] used[cell] = 1 # print " found %d at %d %d" % (cell, x, y1) for x1 in range(9): cell = grid[x1][y] used[cell] = 1 # print " found %d at %d %d" % (cell, x1, y) x1 = x - (x % 3) y1 = y - (y % 3) # print "checking %d %d in grid at %d %d" % (x, y, x1, y1) for x2 in range(x1, x1 + 3): for y2 in range(y1, y1 + 3): cell = grid[x2][y2] used[cell] = 1 # print " found %d at %d %d" % (cell, x2, y2) # print " used = %s" % str(used) available = [] for a1 in range(1, 10): if a1 in used: # print " %d is used" % a1 pass else: available.append(a1) # print "%s, %s available: %s" % (str(x), str(y), str(available)) return available def solve_grid(grid): for x in range(9): for y in range(9): cell = grid[x][y] # check_available(grid, x, y) if cell == 0: a1 = check_available(grid, x, y) if len(a1) == 1: c = a1[0] grid[x][y] = c print("found %d for %d %d" % (c, x, y)) if check_grid_solved(grid): return print_grid(g0) solve_grid(grid) def main(): print_grid(g0) solve_grid(g0) print_grid(g0) main()
1ec42fccb532e1e8ac52dd0eead4eff69e3d037c
aplcido/Machine-Learning
/Machine-Learning/testing_numpy_speed.py
1,218
3.75
4
"""Testing NumPy speed.""" import numpy as np from time import time def how_long(func, *args): """Execute functions with given arguments, and measure time execution""" t0 = time() result = func(*args) #all arguments are passed in as -is t1 = time() return result, t1-t0 def manual_mean(arr): """Compute mean (average) of all elements in the given 2D array""" sum = 0 for i in range(0,arr.shape[0]): for j in range(0,arr.shape[1]): sum = sum + arr[i][j] return sum / arr.size def numpy_mean(arr): """compute mean (average) using numpy""" return arr.mean() def test_run(): """Function called by test_run""" nd1 = np.random.random((1000,10000)) #very large array #time the two functions, retrieving results and execution times res_manual, t_manual = how_long(manual_mean, nd1) res_numpy, t_numpy = how_long(numpy_mean,nd1) #make sure both give us the same result )upto some precision assert(abs(res_manual-res_numpy)) <=10e-6, "Results aren't equal!" #compute speedup speedup = t_manual / t_numpy print ("NumPy mean is", speedup, "times faster than manual loops.") if __name__ == "__main__": test_run()
0480356cb0265460e433ada645e41a6b8bd31535
fabiangothman/Python
/fundamentals/2_datatype.py
1,003
3.5625
4
#Datatypes print(type("Hello world")) #str print(type(100)) #int print(type(100.5)) #float print(type(False)) #bool print(type([1, 2, 3])) #list print(type(["Hello", "Bye", "Again"])) #list print(type([10, "Hello", True, 11.5])) #list print(type(None)) #NoneType #Inmutables data types (doesn't change) print(type((10, 30, 55))) #tuple #Sets list without index print(type({"Pedro", "Paco", "Luis"})) #str #Dictionaries print(type({ #dict 'name': 'Ryan', 'age': 15, 'alias': 'Ry', 'family': { 'mom': 'Grey', 'dad': 'Joseph', 'grandparents':[ { 'type': 'grandmom', 'name':'Norah' }, { 'type': 'grandmom', 'name':'Philliphs' } ] } })) #Operators print("hola_"+"como_"+"estas.")
212a11aa354cafc7c542d4f5aab9665de315d803
msw1535540/MachineLearning
/MachineLearning/Leetcode/020.valid-parentheses/Valid_Parentheses.py
957
3.75
4
#-*- coding:utf-8 _*- """ @author:charlesXu @file: Valid_Parentheses.py @desc: @time: 2018/02/04 """ ''' 思路: 栈最典型的应用就是验证配对情况,作为有效的括号,有一个右括号就必定有一个左括号在前面, 所以我们可以将左括号都push进栈中,遇到右括号的时候再pop来消掉。 这里不用担心连续不同种类左括号的问题,因为有效的括号对最终还是会有紧邻的括号对。如栈中是({[,来一个]变成({,再来一个},变成(。 ''' ''' 了解堆栈的性质 ''' class Solution(object): def isValid(self, s): """ :type s: str :rtype: bool """ stack = [] d = ['()', '[]', '{}'] for i in range(0, len(s)): stack.append(s[i]) if len(stack) >2 and stack[-2] + stack[-1] in d: stack.pop() stack.pop() return len(stack) == 0
c5414e4f1d1a7162c5ad876dfe9542d603aef8be
tylerphillips55/pyp-w1-gw-language-detector
/language_detector/main.py
1,848
3.828125
4
# -*- coding: utf-8 -*- """This is the entry point of the program.""" from .languages import LANGUAGES import string import re def detect_language(text, languages): text = re.compile('[%s]' % re.escape(string.punctuation)).sub('',text) #remove punctuation in string text = text.lower() ls = text.split() #returns list of words in text word_counts = {} #dict will hold {word:frequency in text} total = {} #dict will hold {language:total common words that appear} for word in ls: #iterate over words from text word_counts[word] = word_counts.get(word,0) + 1 #return current count of word if exists or 0 if it has not beed added yet, then increment by 1 for d in languages: #iterate over dictionaries count = 0 #count tallies total number of common word occurences for langauge for key,value in word_counts.items(): #iterate over word:frequency pairs in dict of words in text if key in d["common_words"]: #if word is a common word, count += value # increment count by word frequency in text and total[d["name"]] = count # add or update {language:total commmon words} return max(total, key=total.get) #return language with greatest common word total
60fdaa9752810c79c493d9835a6948ab2501f1d9
RuchiraPatil/Python-3.x
/reverse.py
84
3.609375
4
s = input('Text : ') for i in range(len(s)-1, -1, -1): print(s[i], end="")
192f81f687b2f02046436fc88cfc24247dcd0ec2
minhnguyen2610/C4T-BO4
/Session6/input_number.py
186
3.90625
4
while True: n = input("Nhap so vao day: ") print(n) if n.isdigit(): print("This shitz is el numero") break else: print("This shitz ain't numero")
4e0a77eab4b83e2a4854e68fc14fa123bd990ddd
lpuls/CodeExercise
/leetcode/107.二叉树的层次遍历-ii.py
1,218
3.59375
4
# # @lc app=leetcode.cn id=107 lang=python3 # # [107] 二叉树的层次遍历 II # # Definition for a binary tree node. class TreeNode: def __init__(self, x): self.val = x self.left = None self.right = None class Solution: # def levelOrderBottom(self, root: TreeNode) -> List[List[int]]: def levelOrderBottom(self, root): open = list() close = list() open.append((root, 0)) while len(open) > 0: temp = open[0] temp_node = temp[0] temp_depth = temp[1] del open[0] if None is not temp_node: if temp_depth >= len(close): close.insert(0, list()) # python中,a[x] = a[-(len(a) + x)] close[-(temp_depth + 1)].append(temp_node.val) open.append((temp_node.left, temp_depth + 1)) open.append((temp_node.right, temp_depth + 1)) return close # s = Solution() # r = TreeNode(3) # r.left = TreeNode(9) # r.right = TreeNode(20) # r.left.left = None # r.left.right = None # r.right.left = TreeNode(15) # r.right.right = TreeNode(7) # print(s.levelOrderBottom(r))
f5f71dfb5334932c9424a1fccb1376cb4a442a44
YutoTakaki0626/My-Python-REVIEW
/basic/is.py
370
3.96875
4
# is演算子:同じオブジェクトかどうかを判定する a = 1 b = 1 c = 3 d = a e = 2 - 1 print(id(1)) print(id(a)) print(id(b)) print(a is b) print(a is not c) hello = 'hello' hello2 = 'h' + 'e' + 'l' + 'l' + 'o' print(hello is hello2) hello = 'konnichiwa' print(hello is hello2) # Noneかどうかの判定によく使う nothing = None print(id(nothing))
e59a1f49d2cfb1afc7176509c2e2182e0b75aae8
ljmerza/algorithms
/python-algorithms/insertion.py
952
4.5
4
# insertion sort def insertion(arr): ''' for each item in an array, you look at the current item then the item behind it if the current item is smaller than the one behind it then switch. go to previous item. you are taking the current item and pushing it back each time the item before it is smaller until this is not true (inner loop). then you go to the next unsorted item (outer loop) and keep pushing that back to the sorted position. ''' arr = arr[:] # copy array arr_len = len(arr) # get array length for i in range(1, arr_len): # from 1 to length-1 j=i # start inner loop at currently unsorted index while j>0 and (arr[j] < arr[j-1]): # if the array is smaller than the one before it then switch arr[j], arr[j-1] = arr[j-1], arr[j] # switch here j=j-1 # go previous index return arr arr = [5,8,3,1,9,7,4,2,6] print('unsorted array is {}'.format(arr)) print('insertion sorted array is {}'.format( insertion(arr) ))
5ddd9f7cca5a5890a4c64b8b6b2aa87635353f94
callmekeyz/Digital-Crafts-Classes
/Programming101/user-input.py
197
4.03125
4
#print('hi') name = input("Name Please:") subject = input ("Favorite subject\n") age = input("How old are you?\n") if age >= 21: print("Grab a Beer?") print (f "You said your name is {name}")
e7498cc2d4bb05ed99f49618b0a40ba266cf935a
C-SON-TC1028-001-2113/parcial-practico-2-marianadiazl
/assignments/17NCuadradoMayor/src/exercise.py
211
4
4
def main(): numero = int(input("Escribe un numero : ")) #escribe tu código abajo de esta línea r = 1 while numero<=r**2: r = r + 1 print(r) if __name__=='__main__': main()
1286812346feeb6a75e2ff7ecd5f265c851690af
tomduhourq/p4e-coursera
/src/DictPractice/examples.py
807
3.578125
4
__author__ = 'tomasduhourq' import string from src.FilePractice.file_helper import choose_file # Sorting the keys of a dict counts = {'chuck': 1, 'annie': 42, 'jan': 100} # Create a list of the keys in the dict def sort_keys(d): keys = d.keys() keys.sort() for key in keys: print key, d[key] sort_keys(counts) # Using string.translate to get rid of punctuation characters counts = dict() for line in open('../ListPractice/romeo.txt'): line = line.translate(None, string.punctuation).lower() for word in line.split(): counts[word] = counts.get(word, 0) + 1 # Integrating everything counts = dict() for line in choose_file(): for word in line.translate(None, string.punctuation).lower().split(): counts[word] = counts.get(word, 0) + 1 sort_keys(counts)
6b588787e8b3404ba2f9e17c5f52710fa930b1f8
GalyaBorislavova/SoftUni_Python_Advanced_May_2021
/Exams/Python Advanced Exam - 27 June 2020/01. Bombs.py
1,601
3.609375
4
from collections import deque def print_data(created_bombs, bomb_effects, bomb_casings): if bomb_effects: print(f"Bomb Effects: {', '.join([str(el) for el in bomb_effects])}") else: print(f"Bomb Effects: empty") if bomb_casings: print(f"Bomb Casings: {', '.join([str(el) for el in bomb_casings])}") else: print(f"Bomb Casings: empty") for bomb_type, count in sorted((created_bombs.items()), key=lambda x: x[0]): print(f"{bomb_type} Bombs: {count}") exit(0) effects = deque([int(el) for el in input().split(", ")]) casings = [int(el) for el in input().split(", ")] bombs = { "Datura": 0, "Cherry": 0, "Smoke Decoy": 0 } success = False while effects and casings: current_effect = effects.popleft() current_casing = casings.pop() current_sum = current_effect + current_casing if current_sum == 40: bombs["Datura"] += 1 elif current_sum == 60: bombs["Cherry"] += 1 elif current_sum == 120: bombs["Smoke Decoy"] += 1 else: current_casing -= 5 if current_casing >= 0: casings.append(current_casing) effects.appendleft(current_effect) for value in bombs.values(): if not value >= 3: success = False break success = True if success: print("Bene! You have successfully filled the bomb pouch!") print_data(bombs, effects, casings) break if not success: print("You don't have enough materials to fill the bomb pouch.") print_data(bombs, effects, casings)
22d7f83f4ddf6c201090294d7cbbc54bd1392be7
jchenpanyu/Python_test
/Python Machine Learning/[Ch6_P170-172]Pipelines.py
3,079
3.765625
4
# -*- coding: utf-8 -*- """ Created on Wed Sep 06 13:43:40 2017 "Python Machine Learning" Chapter 6 Page: 170-172 working with the Breast Cancer Wisconsin dataset, which contains 569 samples of malignant and benign tumor cells. The first two columns in the dataset store the unique ID numbers of the samples and the corresponding diagnosis (M=malignant, B=benign), respectively. The columns 3-32 contain 30 real-value features that have been computed from digitized images of the cell nuclei, which can be used to build a model to predict whether a tumor is benign or malignant. @author: vincchen """ """ reading in the dataset directly from the UCI website using pandas: """ import pandas as pd df = pd.read_csv('https://archive.ics.uci.edu/ml/machine-learning-databases/breast-cancer-wisconsin/wdbc.data', header=None) """ assign the 30 features to a NumPy array X. Using LabelEncoder, we transform the class labels from their original string representation (M and B) into integers: """ from sklearn.preprocessing import LabelEncoder X = df.loc[:, 2:].values y = df.loc[:, 1].values le = LabelEncoder() y = le.fit_transform(y) """ After encoding the class labels (diagnosis) in an array y, the malignant tumors are now represented as class 1, and the benign tumors are represented as class 0, respectively, which we can illustrate by calling the transform method of LabelEncoder on two dummy class labels: """ le.transform(['M', 'B']) """ divide the dataset into a separate training dataset (80 percent of the data) and a separate test dataset (20 percent of the data): """ from sklearn.cross_validation import train_test_split X_train, X_test, y_train, y_test = train_test_split(X, y, test_size=0.20, random_state=1) """ standardize the columns in the Breast Cancer Wisconsin dataset before we can feed them to a linear classifier & compress our data from the initial 30 dimensions onto a lower two-dimensional subspace via principal component analysis (PCA) we can chain the StandardScaler, PCA, and LogisticRegression objects in a pipeline: """ from sklearn.preprocessing import StandardScaler from sklearn.decomposition import PCA from sklearn.linear_model import LogisticRegression from sklearn.pipeline import Pipeline pipe_lr = Pipeline([('scl', StandardScaler()), ('pca', PCA(n_components=2)), ('clf', LogisticRegression(random_state=1))]) pipe_lr.fit(X_train, y_train) print('Test Accuracy: %.3f' % pipe_lr.score(X_test, y_test)) """ In the preceding code example, we built a pipeline that consisted of two intermediate steps, a StandardScaler and a PCA transformer, and a logistic regression classifier as a final estimator. When we executed the fit method on the pipeline pipe_lr, the StandardScaler performed fit and transform on the training data, and the transformed training data was then passed onto the next object in the pipeline, the PCA. Similar to the previous step, PCA also executed fit and transform on the scaled input data and passed it to the final element of the pipeline, the estimator. """