MatrixStudio/Codeforces-Python-Submissions

937

A

Olympiad

PROGRAMMING

800

[ "implementation", "sortings" ]

null

The recent All-Berland Olympiad in Informatics featured *n* participants with each scoring a certain amount of points. As the head of the programming committee, you are to determine the set of participants to be awarded with diplomas with respect to the following criteria: - At least one participant should get a diploma. - None of those with score equal to zero should get awarded. - When someone is awarded, all participants with score not less than his score should also be awarded. Determine the number of ways to choose a subset of participants that will receive the diplomas.

The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants. The next line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=600) — participants' scores. It's guaranteed that at least one participant has non-zero score.

Print a single integer — the desired number of ways.

[ "4\n1 3 3 2\n", "3\n1 1 1\n", "4\n42 0 0 42\n" ]

[ "3\n", "1\n", "1\n" ]

There are three ways to choose a subset in sample case one. 1. Only participants with 3 points will get diplomas. 1. Participants with 2 or 3 points will get diplomas. 1. Everyone will get a diploma! The only option in sample case two is to award everyone. Note that in sample case three participants with zero scores cannot get anything.

500

[ { "input": "4\n1 3 3 2", "output": "3" }, { "input": "3\n1 1 1", "output": "1" }, { "input": "4\n42 0 0 42", "output": "1" }, { "input": "10\n1 0 1 0 1 0 0 0 0 1", "output": "1" }, { "input": "10\n572 471 540 163 50 30 561 510 43 200", "output": "10" }, { "input": "100\n122 575 426 445 172 81 247 429 97 202 175 325 382 384 417 356 132 502 328 537 57 339 518 211 479 306 140 168 268 16 140 263 593 249 391 310 555 468 231 180 157 18 334 328 276 155 21 280 322 545 111 267 467 274 291 304 235 34 365 180 21 95 501 552 325 331 302 353 296 22 289 399 7 466 32 302 568 333 75 192 284 10 94 128 154 512 9 480 243 521 551 492 420 197 207 125 367 117 438 600", "output": "94" }, { "input": "100\n600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600", "output": "1" }, { "input": "78\n5 4 13 2 5 6 2 10 10 1 2 6 7 9 6 3 5 7 1 10 2 2 7 0 2 11 11 3 1 13 3 10 6 2 0 3 0 5 0 1 4 11 1 1 7 0 12 7 5 12 0 2 12 9 8 3 4 3 4 11 4 10 2 3 10 12 5 6 1 11 2 0 8 7 9 1 3 12", "output": "13" }, { "input": "34\n220 387 408 343 184 447 197 307 337 414 251 319 426 322 347 242 208 412 188 185 241 235 216 259 331 372 322 284 444 384 214 297 389 391", "output": "33" }, { "input": "100\n1 2 1 0 3 0 2 0 0 1 2 0 1 3 0 3 3 1 3 0 0 2 1 2 2 1 3 3 3 3 3 2 0 0 2 1 2 3 2 3 0 1 1 3 3 2 0 3 1 0 2 2 2 1 2 3 2 1 0 3 0 2 0 3 0 2 1 0 3 1 0 2 2 1 3 1 3 0 2 3 3 1 1 3 1 3 0 3 2 0 2 3 3 0 2 0 2 0 1 3", "output": "3" }, { "input": "100\n572 471 540 163 50 30 561 510 43 200 213 387 500 424 113 487 357 333 294 337 435 202 447 494 485 465 161 344 470 559 104 356 393 207 224 213 511 514 60 386 149 216 392 229 429 173 165 401 395 150 127 579 344 390 529 296 225 425 318 79 465 447 177 110 367 212 459 270 41 500 277 567 125 436 178 9 214 342 203 112 144 24 79 155 495 556 40 549 463 281 241 316 2 246 1 396 510 293 332 55", "output": "93" }, { "input": "99\n5 4 13 2 5 6 2 10 10 1 2 6 7 9 6 3 5 7 1 10 2 2 7 0 2 11 11 3 1 13 3 10 6 2 0 3 0 5 0 1 4 11 1 1 7 0 12 7 5 12 0 2 12 9 8 3 4 3 4 11 4 10 2 3 10 12 5 6 1 11 2 0 8 7 9 1 3 12 2 3 9 3 7 13 7 13 0 11 8 12 2 5 9 4 0 6 6 2 13", "output": "13" }, { "input": "99\n1 0 1 0 1 0 0 0 0 1 0 0 1 1 0 1 1 1 1 0 0 0 1 0 0 1 1 1 1 1 1 0 0 0 0 1 0 1 0 1 0 1 1 1 1 0 0 1 1 0 0 0 0 1 0 1 0 1 0 1 0 0 0 1 0 0 1 0 1 1 0 0 0 1 1 1 1 0 0 1 1 1 1 1 1 1 0 1 0 0 0 1 1 0 0 0 0 0 1", "output": "1" }, { "input": "99\n21 74 25 44 71 80 46 28 96 1 74 24 81 83 16 55 31 1 27 36 56 38 17 10 78 5 39 67 67 15 39 62 92 48 90 9 54 67 30 79 56 17 33 27 75 54 20 79 21 44 10 66 66 73 90 3 34 33 64 79 20 94 0 51 24 30 1 52 95 21 88 98 6 65 31 1 67 32 74 91 83 9 93 27 53 11 8 79 42 20 50 91 19 96 6 24 66 16 37", "output": "61" }, { "input": "2\n0 1", "output": "1" }, { "input": "2\n0 600", "output": "1" }, { "input": "4\n1 1 1 2", "output": "2" }, { "input": "4\n0 0 1 2", "output": "2" }, { "input": "1\n5", "output": "1" }, { "input": "2\n0 5", "output": "1" }, { "input": "5\n1 0 0 1 2", "output": "2" } ]

1,668,450,242

2,147,483,647

PyPy 3-64

OK

TESTS

21

61

0

n = int(input()) arr = [int(x) for x in input().split() if x!='0'] print(len(set(arr)))

Title: Olympiad Time Limit: None seconds Memory Limit: None megabytes Problem Description: The recent All-Berland Olympiad in Informatics featured *n* participants with each scoring a certain amount of points. As the head of the programming committee, you are to determine the set of participants to be awarded with diplomas with respect to the following criteria: - At least one participant should get a diploma. - None of those with score equal to zero should get awarded. - When someone is awarded, all participants with score not less than his score should also be awarded. Determine the number of ways to choose a subset of participants that will receive the diplomas. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants. The next line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=600) — participants' scores. It's guaranteed that at least one participant has non-zero score. Output Specification: Print a single integer — the desired number of ways. Demo Input: ['4\n1 3 3 2\n', '3\n1 1 1\n', '4\n42 0 0 42\n'] Demo Output: ['3\n', '1\n', '1\n'] Note: There are three ways to choose a subset in sample case one. 1. Only participants with 3 points will get diplomas. 1. Participants with 2 or 3 points will get diplomas. 1. Everyone will get a diploma! The only option in sample case two is to award everyone. Note that in sample case three participants with zero scores cannot get anything.

```python n = int(input()) arr = [int(x) for x in input().split() if x!='0'] print(len(set(arr))) ```

3

165

B

Burning Midnight Oil

PROGRAMMING

1,500

[ "binary search", "implementation" ]

null

One day a highly important task was commissioned to Vasya — writing a program in a night. The program consists of *n* lines of code. Vasya is already exhausted, so he works like that: first he writes *v* lines of code, drinks a cup of tea, then he writes as much as lines, drinks another cup of tea, then he writes lines and so on: , , , ... The expression is regarded as the integral part from dividing number *a* by number *b*. The moment the current value equals 0, Vasya immediately falls asleep and he wakes up only in the morning, when the program should already be finished. Vasya is wondering, what minimum allowable value *v* can take to let him write not less than *n* lines of code before he falls asleep.

The input consists of two integers *n* and *k*, separated by spaces — the size of the program in lines and the productivity reduction coefficient, 1<=≤<=*n*<=≤<=109, 2<=≤<=*k*<=≤<=10.

Print the only integer — the minimum value of *v* that lets Vasya write the program in one night.

[ "7 2\n", "59 9\n" ]

[ "4\n", "54\n" ]

In the first sample the answer is *v* = 4. Vasya writes the code in the following portions: first 4 lines, then 2, then 1, and then Vasya falls asleep. Thus, he manages to write 4 + 2 + 1 = 7 lines in a night and complete the task. In the second sample the answer is *v* = 54. Vasya writes the code in the following portions: 54, 6. The total sum is 54 + 6 = 60, that's even more than *n* = 59.

1,000

[ { "input": "7 2", "output": "4" }, { "input": "59 9", "output": "54" }, { "input": "1 9", "output": "1" }, { "input": "11 2", "output": "7" }, { "input": "747 2", "output": "376" }, { "input": "6578 2", "output": "3293" }, { "input": "37212 2", "output": "18609" }, { "input": "12357 2", "output": "6181" }, { "input": "7998332 2", "output": "3999172" }, { "input": "86275251 2", "output": "43137632" }, { "input": "75584551 2", "output": "37792280" }, { "input": "6 3", "output": "5" }, { "input": "43 4", "output": "33" }, { "input": "811 3", "output": "543" }, { "input": "3410 4", "output": "2560" }, { "input": "21341 4", "output": "16009" }, { "input": "696485 4", "output": "522368" }, { "input": "8856748 3", "output": "5904504" }, { "input": "2959379 4", "output": "2219538" }, { "input": "831410263 3", "output": "554273516" }, { "input": "2 5", "output": "2" }, { "input": "19 6", "output": "17" }, { "input": "715 7", "output": "615" }, { "input": "9122 5", "output": "7300" }, { "input": "89117 6", "output": "74268" }, { "input": "689973 7", "output": "591408" }, { "input": "3024524 5", "output": "2419624" }, { "input": "67127156 6", "output": "55939302" }, { "input": "412262167 7", "output": "353367574" }, { "input": "6 8", "output": "6" }, { "input": "59 9", "output": "54" }, { "input": "246 10", "output": "222" }, { "input": "5314 8", "output": "4651" }, { "input": "15309 9", "output": "13609" }, { "input": "35648 10", "output": "32085" }, { "input": "3018012 8", "output": "2640764" }, { "input": "92153348 9", "output": "81914089" }, { "input": "177583558 10", "output": "159825206" }, { "input": "1000000000 2", "output": "500000008" }, { "input": "1000000000 3", "output": "666666672" }, { "input": "1000000000 4", "output": "750000005" }, { "input": "1000000000 5", "output": "800000003" }, { "input": "1000000000 6", "output": "833333338" }, { "input": "1000000000 7", "output": "857142861" }, { "input": "1000000000 8", "output": "875000004" }, { "input": "1000000000 9", "output": "888888894" }, { "input": "1000000000 10", "output": "900000001" }, { "input": "1 4", "output": "1" }, { "input": "2 10", "output": "2" }, { "input": "1 2", "output": "1" }, { "input": "6 8", "output": "6" }, { "input": "987862820 9", "output": "878100288" }, { "input": "979591791 9", "output": "870748262" }, { "input": "948889213 9", "output": "843457081" }, { "input": "8 9", "output": "8" }, { "input": "999999999 10", "output": "900000000" } ]

1,601,590,029

2,147,483,647

Python 3

WRONG_ANSWER

TESTS

2

184

307,200

def works(v, n, k): total = 0 incr = v + (v//k) while incr != 0: total += incr k = (k * k) incr = v // k return total >= n def find_working(n, k): possible_v = 1 while possible_v < n: if works(possible_v, n, k): return possible_v possible_v += 1 n_k = input().split() n = int(n_k[0]) k = int(n_k[1]) print(find_working(n, k))

Title: Burning Midnight Oil Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day a highly important task was commissioned to Vasya — writing a program in a night. The program consists of *n* lines of code. Vasya is already exhausted, so he works like that: first he writes *v* lines of code, drinks a cup of tea, then he writes as much as lines, drinks another cup of tea, then he writes lines and so on: , , , ... The expression is regarded as the integral part from dividing number *a* by number *b*. The moment the current value equals 0, Vasya immediately falls asleep and he wakes up only in the morning, when the program should already be finished. Vasya is wondering, what minimum allowable value *v* can take to let him write not less than *n* lines of code before he falls asleep. Input Specification: The input consists of two integers *n* and *k*, separated by spaces — the size of the program in lines and the productivity reduction coefficient, 1<=≤<=*n*<=≤<=109, 2<=≤<=*k*<=≤<=10. Output Specification: Print the only integer — the minimum value of *v* that lets Vasya write the program in one night. Demo Input: ['7 2\n', '59 9\n'] Demo Output: ['4\n', '54\n'] Note: In the first sample the answer is *v* = 4. Vasya writes the code in the following portions: first 4 lines, then 2, then 1, and then Vasya falls asleep. Thus, he manages to write 4 + 2 + 1 = 7 lines in a night and complete the task. In the second sample the answer is *v* = 54. Vasya writes the code in the following portions: 54, 6. The total sum is 54 + 6 = 60, that's even more than *n* = 59.

```python def works(v, n, k): total = 0 incr = v + (v//k) while incr != 0: total += incr k = (k * k) incr = v // k return total >= n def find_working(n, k): possible_v = 1 while possible_v < n: if works(possible_v, n, k): return possible_v possible_v += 1 n_k = input().split() n = int(n_k[0]) k = int(n_k[1]) print(find_working(n, k)) ```

0

821

A

Okabe and Future Gadget Laboratory

PROGRAMMING

800

[ "implementation" ]

null

Okabe needs to renovate the Future Gadget Laboratory after he tried doing some crazy experiments! The lab is represented as an *n* by *n* square grid of integers. A good lab is defined as a lab in which every number not equal to 1 can be expressed as the sum of a number in the same row and a number in the same column. In other words, for every *x*,<=*y* such that 1<=≤<=*x*,<=*y*<=≤<=*n* and *a**x*,<=*y*<=≠<=1, there should exist two indices *s* and *t* so that *a**x*,<=*y*<==<=*a**x*,<=*s*<=+<=*a**t*,<=*y*, where *a**i*,<=*j* denotes the integer in *i*-th row and *j*-th column. Help Okabe determine whether a given lab is good!

The first line of input contains the integer *n* (1<=≤<=*n*<=≤<=50) — the size of the lab. The next *n* lines contain *n* space-separated integers denoting a row of the grid. The *j*-th integer in the *i*-th row is *a**i*,<=*j* (1<=≤<=*a**i*,<=*j*<=≤<=105).

Print "Yes" if the given lab is good and "No" otherwise. You can output each letter in upper or lower case.

[ "3\n1 1 2\n2 3 1\n6 4 1\n", "3\n1 5 2\n1 1 1\n1 2 3\n" ]

[ "Yes\n", "No\n" ]

In the first sample test, the 6 in the bottom left corner is valid because it is the sum of the 2 above it and the 4 on the right. The same holds for every number not equal to 1 in this table, so the answer is "Yes". In the second sample test, the 5 cannot be formed as the sum of an integer in the same row and an integer in the same column. Thus the answer is "No".

500

[ { "input": "3\n1 1 2\n2 3 1\n6 4 1", "output": "Yes" }, { "input": "3\n1 5 2\n1 1 1\n1 2 3", "output": "No" }, { "input": "1\n1", "output": "Yes" }, { "input": "4\n1 1 1 1\n1 11 1 2\n2 5 1 4\n3 9 4 1", "output": "Yes" }, { "input": "4\n1 1 1 1\n1 7 1 1\n1 3 1 2\n2 6 3 1", "output": "Yes" }, { "input": "4\n1 1 1 1\n1 12 1 2\n4 4 1 3\n5 10 6 1", "output": "Yes" }, { "input": "4\n1 1 1 1\n1 13 1 2\n4 5 1 3\n5 11 6 1", "output": "Yes" }, { "input": "4\n1 1 1 1\n1 13 1 2\n4 5 1 3\n7 11 6 1", "output": "No" }, { "input": "4\n1 1 1 1\n1 14 1 6\n4 5 1 5\n3 8 2 1", "output": "Yes" }, { "input": "10\n3 2 6 5 1 2 1 1 2 1\n1 2 2 3 1 4 1 1 1 1\n1 1 3 1 2 2 2 1 1 1\n1 3 1 2 1 2 1 1 1 1\n12 1 4 3 3 1 1 1 2 1\n8 1 1 1 1 3 6 5 1 3\n1 1 1 2 4 1 3 2 1 1\n1 1 1 1 1 1 1 2 1 1\n1 2 1 1 1 1 1 1 1 1\n2 1 1 1 1 1 1 1 1 2", "output": "Yes" }, { "input": "4\n1 2 3 5\n1 1 1 1\n1 1 1 1\n1 1 1 1", "output": "No" }, { "input": "1\n2", "output": "No" }, { "input": "3\n1 1 4\n1 1 2\n1 1 2", "output": "No" }, { "input": "1\n5", "output": "No" }, { "input": "3\n1 2 1\n2 2 3\n1 3 1", "output": "No" }, { "input": "3\n2 1 1\n2 1 1\n2 1 1", "output": "No" }, { "input": "1\n60000", "output": "No" } ]

1,501,636,263

2,147,483,647

Python 3

OK

TESTS

31

389

4,608,000

n = int(input().split()[0]) tab = [[] for _ in range(n)] for i in range(n): for inp in input().rstrip().split(): tab[i].append(int(inp)) tabt = list(map(list,zip(*tab))) cnt = 0 for i, line in enumerate(tab): for j, column in enumerate(tabt): for a in line: for b in column: if tab[i][j] == 1 or tab[i][j] == a + b: cnt += 1 break else: continue break if cnt == n*n: print("YES") else: print("NO")

Title: Okabe and Future Gadget Laboratory Time Limit: None seconds Memory Limit: None megabytes Problem Description: Okabe needs to renovate the Future Gadget Laboratory after he tried doing some crazy experiments! The lab is represented as an *n* by *n* square grid of integers. A good lab is defined as a lab in which every number not equal to 1 can be expressed as the sum of a number in the same row and a number in the same column. In other words, for every *x*,<=*y* such that 1<=≤<=*x*,<=*y*<=≤<=*n* and *a**x*,<=*y*<=≠<=1, there should exist two indices *s* and *t* so that *a**x*,<=*y*<==<=*a**x*,<=*s*<=+<=*a**t*,<=*y*, where *a**i*,<=*j* denotes the integer in *i*-th row and *j*-th column. Help Okabe determine whether a given lab is good! Input Specification: The first line of input contains the integer *n* (1<=≤<=*n*<=≤<=50) — the size of the lab. The next *n* lines contain *n* space-separated integers denoting a row of the grid. The *j*-th integer in the *i*-th row is *a**i*,<=*j* (1<=≤<=*a**i*,<=*j*<=≤<=105). Output Specification: Print "Yes" if the given lab is good and "No" otherwise. You can output each letter in upper or lower case. Demo Input: ['3\n1 1 2\n2 3 1\n6 4 1\n', '3\n1 5 2\n1 1 1\n1 2 3\n'] Demo Output: ['Yes\n', 'No\n'] Note: In the first sample test, the 6 in the bottom left corner is valid because it is the sum of the 2 above it and the 4 on the right. The same holds for every number not equal to 1 in this table, so the answer is "Yes". In the second sample test, the 5 cannot be formed as the sum of an integer in the same row and an integer in the same column. Thus the answer is "No".

```python n = int(input().split()[0]) tab = [[] for _ in range(n)] for i in range(n): for inp in input().rstrip().split(): tab[i].append(int(inp)) tabt = list(map(list,zip(*tab))) cnt = 0 for i, line in enumerate(tab): for j, column in enumerate(tabt): for a in line: for b in column: if tab[i][j] == 1 or tab[i][j] == a + b: cnt += 1 break else: continue break if cnt == n*n: print("YES") else: print("NO") ```

3

116

A

Tram

PROGRAMMING

800

[ "implementation" ]

null

Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty. Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram.

The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops. Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement. - The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0.

Print a single integer denoting the minimum possible capacity of the tram (0 is allowed).

[ "4\n0 3\n2 5\n4 2\n4 0\n" ]

[ "6\n" ]

For the first example, a capacity of 6 is sufficient: - At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints. Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.

500

[ { "input": "4\n0 3\n2 5\n4 2\n4 0", "output": "6" }, { "input": "5\n0 4\n4 6\n6 5\n5 4\n4 0", "output": "6" }, { "input": "10\n0 5\n1 7\n10 8\n5 3\n0 5\n3 3\n8 8\n0 6\n10 1\n9 0", "output": "18" }, { "input": "3\n0 1\n1 1\n1 0", "output": "1" }, { "input": "4\n0 1\n0 1\n1 0\n1 0", "output": "2" }, { "input": "3\n0 0\n0 0\n0 0", "output": "0" }, { "input": "3\n0 1000\n1000 1000\n1000 0", "output": "1000" }, { "input": "5\n0 73\n73 189\n189 766\n766 0\n0 0", "output": "766" }, { "input": "5\n0 0\n0 0\n0 0\n0 1\n1 0", "output": "1" }, { "input": "5\n0 917\n917 923\n904 992\n1000 0\n11 0", "output": "1011" }, { "input": "5\n0 1\n1 2\n2 1\n1 2\n2 0", "output": "2" }, { "input": "5\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "20\n0 7\n2 1\n2 2\n5 7\n2 6\n6 10\n2 4\n0 4\n7 4\n8 0\n10 6\n2 1\n6 1\n1 7\n0 3\n8 7\n6 3\n6 3\n1 1\n3 0", "output": "22" }, { "input": "5\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0", "output": "1000" }, { "input": "10\n0 592\n258 598\n389 203\n249 836\n196 635\n478 482\n994 987\n1000 0\n769 0\n0 0", "output": "1776" }, { "input": "10\n0 1\n1 0\n0 0\n0 0\n0 0\n0 1\n1 1\n0 1\n1 0\n1 0", "output": "2" }, { "input": "10\n0 926\n926 938\n938 931\n931 964\n937 989\n983 936\n908 949\n997 932\n945 988\n988 0", "output": "1016" }, { "input": "10\n0 1\n1 2\n1 2\n2 2\n2 2\n2 2\n1 1\n1 1\n2 1\n2 0", "output": "3" }, { "input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "10\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0", "output": "1000" }, { "input": "50\n0 332\n332 268\n268 56\n56 711\n420 180\n160 834\n149 341\n373 777\n763 93\n994 407\n86 803\n700 132\n471 608\n429 467\n75 5\n638 305\n405 853\n316 478\n643 163\n18 131\n648 241\n241 766\n316 847\n640 380\n923 759\n789 41\n125 421\n421 9\n9 388\n388 829\n408 108\n462 856\n816 411\n518 688\n290 7\n405 912\n397 772\n396 652\n394 146\n27 648\n462 617\n514 433\n780 35\n710 705\n460 390\n194 508\n643 56\n172 469\n1000 0\n194 0", "output": "2071" }, { "input": "50\n0 0\n0 1\n1 1\n0 1\n0 0\n1 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 1\n1 0\n0 1\n0 0\n1 1\n1 0\n0 1\n0 0\n1 1\n0 1\n1 0\n1 1\n1 0\n0 0\n1 1\n1 0\n0 1\n0 0\n0 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 0\n0 1\n1 0\n0 0\n0 1\n1 1\n1 1\n0 1\n0 0\n1 0\n1 0", "output": "3" }, { "input": "50\n0 926\n926 971\n915 980\n920 965\n954 944\n928 952\n955 980\n916 980\n906 935\n944 913\n905 923\n912 922\n965 934\n912 900\n946 930\n931 983\n979 905\n925 969\n924 926\n910 914\n921 977\n934 979\n962 986\n942 909\n976 903\n982 982\n991 941\n954 929\n902 980\n947 983\n919 924\n917 943\n916 905\n907 913\n964 977\n984 904\n905 999\n950 970\n986 906\n993 970\n960 994\n963 983\n918 986\n980 900\n931 986\n993 997\n941 909\n907 909\n1000 0\n278 0", "output": "1329" }, { "input": "2\n0 863\n863 0", "output": "863" }, { "input": "50\n0 1\n1 2\n2 2\n1 1\n1 1\n1 2\n1 2\n1 1\n1 2\n1 1\n1 1\n1 2\n1 2\n1 1\n2 1\n2 2\n1 2\n2 2\n1 2\n2 1\n2 1\n2 2\n2 1\n1 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n2 2\n2 1\n1 2\n2 2\n1 2\n1 1\n1 1\n2 1\n2 1\n2 2\n2 1\n2 1\n1 2\n1 2\n1 2\n1 2\n2 0\n2 0\n2 0\n0 0", "output": "8" }, { "input": "50\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "100\n0 1\n0 0\n0 0\n1 0\n0 0\n0 1\n0 1\n1 1\n0 0\n0 0\n1 1\n0 0\n1 1\n0 1\n1 1\n0 1\n1 1\n1 0\n1 0\n0 0\n1 0\n0 1\n1 0\n0 0\n0 0\n1 1\n1 1\n0 1\n0 0\n1 0\n1 1\n0 1\n1 0\n1 1\n0 1\n1 1\n1 0\n0 0\n0 0\n0 1\n0 0\n0 1\n1 1\n0 0\n1 1\n1 1\n0 0\n0 1\n1 0\n0 1\n0 0\n0 1\n0 1\n1 1\n1 1\n1 1\n0 0\n0 0\n1 1\n0 1\n0 1\n1 0\n0 0\n0 0\n1 1\n0 1\n0 1\n1 1\n1 1\n0 1\n1 1\n1 1\n0 0\n1 0\n0 1\n0 0\n0 0\n1 1\n1 1\n1 1\n1 1\n0 1\n1 0\n1 0\n1 0\n1 0\n1 0\n0 0\n1 0\n1 0\n0 0\n1 0\n0 0\n0 1\n1 0\n0 1\n1 0\n1 0\n1 0\n1 0", "output": "11" }, { "input": "100\n0 2\n1 2\n2 1\n1 2\n1 2\n2 1\n2 2\n1 1\n1 1\n2 1\n1 2\n2 1\n1 2\n2 2\n2 2\n2 2\n1 2\n2 2\n2 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 2\n1 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n1 1\n2 2\n2 1\n1 2\n1 1\n1 2\n2 1\n2 2\n1 1\n2 1\n1 1\n2 1\n1 1\n1 2\n2 2\n2 2\n1 1\n2 2\n1 2\n2 1\n2 1\n1 1\n1 1\n1 2\n1 2\n1 1\n1 1\n2 1\n1 2\n1 2\n2 1\n2 2\n2 2\n2 2\n2 1\n2 2\n1 1\n1 2\n1 2\n1 1\n2 2\n2 2\n1 1\n2 1\n1 1\n1 2\n1 2\n1 2\n1 1\n1 1\n2 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 1\n2 2\n1 2\n2 0\n2 0\n2 0\n1 0", "output": "7" }, { "input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "2\n0 1\n1 0", "output": "1" }, { "input": "2\n0 900\n900 0", "output": "900" }, { "input": "2\n0 1\n1 0", "output": "1" }, { "input": "2\n0 0\n0 0", "output": "0" }, { "input": "2\n0 1000\n1000 0", "output": "1000" }, { "input": "3\n0 802\n175 188\n815 0", "output": "815" }, { "input": "3\n0 910\n910 976\n976 0", "output": "976" }, { "input": "3\n0 2\n2 1\n1 0", "output": "2" } ]

1,693,742,256

2,147,483,647

Python 3

OK

TESTS

71

92

0

n = int(input()) count=0 passengers = 0 for i in range(n): a, b = map(int, input().split()) passengers = passengers-a+b count=max(count, passengers) print(count)

Title: Tram Time Limit: None seconds Memory Limit: None megabytes Problem Description: Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty. Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram. Input Specification: The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops. Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement. - The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0. Output Specification: Print a single integer denoting the minimum possible capacity of the tram (0 is allowed). Demo Input: ['4\n0 3\n2 5\n4 2\n4 0\n'] Demo Output: ['6\n'] Note: For the first example, a capacity of 6 is sufficient: - At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints. Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.

```python n = int(input()) count=0 passengers = 0 for i in range(n): a, b = map(int, input().split()) passengers = passengers-a+b count=max(count, passengers) print(count) ```

3

41

A

Translation

PROGRAMMING

800

[ "implementation", "strings" ]

A. Translation

2

256

The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.

The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.

If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.

[ "code\nedoc\n", "abb\naba\n", "code\ncode\n" ]

[ "YES\n", "NO\n", "NO\n" ]

none

500

[ { "input": "code\nedoc", "output": "YES" }, { "input": "abb\naba", "output": "NO" }, { "input": "code\ncode", "output": "NO" }, { "input": "abacaba\nabacaba", "output": "YES" }, { "input": "q\nq", "output": "YES" }, { "input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk", "output": "NO" }, { "input": "z\na", "output": "NO" }, { "input": "asd\ndsa", "output": "YES" }, { "input": "abcdef\nfecdba", "output": "NO" }, { "input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu", "output": "NO" }, { "input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf", "output": "NO" }, { "input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp", "output": "NO" }, { "input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb", "output": "NO" }, { "input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom", "output": "NO" }, { "input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh", "output": "NO" }, { "input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy", "output": "NO" }, { "input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko", "output": "NO" }, { "input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv", "output": "NO" }, { "input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd", "output": "NO" }, { "input": "w\nw", "output": "YES" }, { "input": "vz\nzv", "output": "YES" }, { "input": "ry\nyr", "output": "YES" }, { "input": "xou\nuox", "output": "YES" }, { "input": "axg\ngax", "output": "NO" }, { "input": "zdsl\nlsdz", "output": "YES" }, { "input": "kudl\nldku", "output": "NO" }, { "input": "zzlzwnqlcl\nlclqnwzlzz", "output": "YES" }, { "input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv", "output": "YES" }, { "input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar", "output": "NO" }, { "input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn", "output": "YES" }, { "input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum", "output": "YES" }, { "input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv", "output": "YES" }, { "input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm", "output": "NO" }, { "input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd", "output": "NO" }, { "input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg", "output": "YES" }, { "input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis", "output": "YES" }, { "input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy", "output": "NO" }, { "input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw", "output": "YES" }, { "input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi", "output": "YES" }, { "input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib", "output": "YES" } ]

1,614,154,015

2,147,483,647

Python 3

OK

TESTS

40

124

0

s=input() x=input() m=s[::-1] if x==m: print('YES') else: print('NO')

Title: Translation Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. Input Specification: The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. Output Specification: If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. Demo Input: ['code\nedoc\n', 'abb\naba\n', 'code\ncode\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none

```python s=input() x=input() m=s[::-1] if x==m: print('YES') else: print('NO') ```

3.969

805

A

Fake NP

PROGRAMMING

1,000

[ "greedy", "math" ]

null

Tavak and Seyyed are good friends. Seyyed is very funny and he told Tavak to solve the following problem instead of longest-path. You are given *l* and *r*. For all integers from *l* to *r*, inclusive, we wrote down all of their integer divisors except 1. Find the integer that we wrote down the maximum number of times. Solve the problem to show that it's not a NP problem.

The first line contains two integers *l* and *r* (2<=≤<=*l*<=≤<=*r*<=≤<=109).

Print single integer, the integer that appears maximum number of times in the divisors. If there are multiple answers, print any of them.

[ "19 29\n", "3 6\n" ]

[ "2\n", "3\n" ]

Definition of a divisor: [https://www.mathsisfun.com/definitions/divisor-of-an-integer-.html](https://www.mathsisfun.com/definitions/divisor-of-an-integer-.html) The first example: from 19 to 29 these numbers are divisible by 2: {20, 22, 24, 26, 28}. The second example: from 3 to 6 these numbers are divisible by 3: {3, 6}.

500

[ { "input": "19 29", "output": "2" }, { "input": "3 6", "output": "2" }, { "input": "39 91", "output": "2" }, { "input": "76 134", "output": "2" }, { "input": "93 95", "output": "2" }, { "input": "17 35", "output": "2" }, { "input": "94 95", "output": "2" }, { "input": "51 52", "output": "2" }, { "input": "47 52", "output": "2" }, { "input": "38 98", "output": "2" }, { "input": "30 37", "output": "2" }, { "input": "56 92", "output": "2" }, { "input": "900000000 1000000000", "output": "2" }, { "input": "37622224 162971117", "output": "2" }, { "input": "760632746 850720703", "output": "2" }, { "input": "908580370 968054552", "output": "2" }, { "input": "951594860 953554446", "output": "2" }, { "input": "347877978 913527175", "output": "2" }, { "input": "620769961 988145114", "output": "2" }, { "input": "820844234 892579936", "output": "2" }, { "input": "741254764 741254768", "output": "2" }, { "input": "80270976 80270977", "output": "2" }, { "input": "392602363 392602367", "output": "2" }, { "input": "519002744 519002744", "output": "519002744" }, { "input": "331900277 331900277", "output": "331900277" }, { "input": "419873015 419873018", "output": "2" }, { "input": "349533413 349533413", "output": "349533413" }, { "input": "28829775 28829776", "output": "2" }, { "input": "568814539 568814539", "output": "568814539" }, { "input": "720270740 720270743", "output": "2" }, { "input": "871232720 871232722", "output": "2" }, { "input": "305693653 305693653", "output": "305693653" }, { "input": "634097178 634097179", "output": "2" }, { "input": "450868287 450868290", "output": "2" }, { "input": "252662256 252662260", "output": "2" }, { "input": "575062045 575062049", "output": "2" }, { "input": "273072892 273072894", "output": "2" }, { "input": "770439256 770439256", "output": "770439256" }, { "input": "2 1000000000", "output": "2" }, { "input": "6 8", "output": "2" }, { "input": "2 879190747", "output": "2" }, { "input": "5 5", "output": "5" }, { "input": "999999937 999999937", "output": "999999937" }, { "input": "3 3", "output": "3" }, { "input": "5 100", "output": "2" }, { "input": "2 2", "output": "2" }, { "input": "3 18", "output": "2" }, { "input": "7 7", "output": "7" }, { "input": "39916801 39916801", "output": "39916801" }, { "input": "3 8", "output": "2" }, { "input": "13 13", "output": "13" }, { "input": "4 8", "output": "2" }, { "input": "3 12", "output": "2" }, { "input": "6 12", "output": "2" }, { "input": "999999103 999999103", "output": "999999103" }, { "input": "100000007 100000007", "output": "100000007" }, { "input": "3 99", "output": "2" }, { "input": "999999733 999999733", "output": "999999733" }, { "input": "5 10", "output": "2" }, { "input": "982451653 982451653", "output": "982451653" }, { "input": "999900001 1000000000", "output": "2" }, { "input": "999727999 999727999", "output": "999727999" }, { "input": "2 999999999", "output": "2" }, { "input": "242 244", "output": "2" }, { "input": "3 10", "output": "2" }, { "input": "15 27", "output": "2" }, { "input": "998244353 998244353", "output": "998244353" }, { "input": "5 15", "output": "2" }, { "input": "999999797 999999797", "output": "999999797" }, { "input": "2 3", "output": "2" }, { "input": "999999929 999999929", "output": "999999929" }, { "input": "3 111111", "output": "2" }, { "input": "12 18", "output": "2" }, { "input": "479001599 479001599", "output": "479001599" }, { "input": "10000019 10000019", "output": "10000019" }, { "input": "715827883 715827883", "output": "715827883" }, { "input": "999992977 999992977", "output": "999992977" }, { "input": "11 11", "output": "11" }, { "input": "29 29", "output": "29" }, { "input": "1000003 1000003", "output": "1000003" }, { "input": "6 15", "output": "2" }, { "input": "1200007 1200007", "output": "1200007" }, { "input": "3 1000000000", "output": "2" }, { "input": "990000023 990000023", "output": "990000023" }, { "input": "1717 1717", "output": "1717" }, { "input": "141650963 141650963", "output": "141650963" }, { "input": "1002523 1002523", "output": "1002523" }, { "input": "900000011 900000011", "output": "900000011" }, { "input": "104729 104729", "output": "104729" }, { "input": "4 12", "output": "2" }, { "input": "100003 100003", "output": "100003" }, { "input": "17 17", "output": "17" }, { "input": "10 100", "output": "2" } ]

1,627,483,548

2,147,483,647

PyPy 3

OK

TESTS

93

108

20,172,800

r, l = map(int, input().split()) if r == l: print(r) else: print(2)

Title: Fake NP Time Limit: None seconds Memory Limit: None megabytes Problem Description: Tavak and Seyyed are good friends. Seyyed is very funny and he told Tavak to solve the following problem instead of longest-path. You are given *l* and *r*. For all integers from *l* to *r*, inclusive, we wrote down all of their integer divisors except 1. Find the integer that we wrote down the maximum number of times. Solve the problem to show that it's not a NP problem. Input Specification: The first line contains two integers *l* and *r* (2<=≤<=*l*<=≤<=*r*<=≤<=109). Output Specification: Print single integer, the integer that appears maximum number of times in the divisors. If there are multiple answers, print any of them. Demo Input: ['19 29\n', '3 6\n'] Demo Output: ['2\n', '3\n'] Note: Definition of a divisor: [https://www.mathsisfun.com/definitions/divisor-of-an-integer-.html](https://www.mathsisfun.com/definitions/divisor-of-an-integer-.html) The first example: from 19 to 29 these numbers are divisible by 2: {20, 22, 24, 26, 28}. The second example: from 3 to 6 these numbers are divisible by 3: {3, 6}.

```python r, l = map(int, input().split()) if r == l: print(r) else: print(2) ```

3

725

A

Jumping Ball

PROGRAMMING

1,000

[ "implementation" ]

null

In a new version of the famous Pinball game, one of the most important parts of the game field is a sequence of *n* bumpers. The bumpers are numbered with integers from 1 to *n* from left to right. There are two types of bumpers. They are denoted by the characters '<' and '>'. When the ball hits the bumper at position *i* it goes one position to the right (to the position *i*<=+<=1) if the type of this bumper is '>', or one position to the left (to *i*<=-<=1) if the type of the bumper at position *i* is '<'. If there is no such position, in other words if *i*<=-<=1<=<<=1 or *i*<=+<=1<=><=*n*, the ball falls from the game field. Depending on the ball's starting position, the ball may eventually fall from the game field or it may stay there forever. You are given a string representing the bumpers' types. Calculate the number of positions such that the ball will eventually fall from the game field if it starts at that position.

The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the length of the sequence of bumpers. The second line contains the string, which consists of the characters '<' and '>'. The character at the *i*-th position of this string corresponds to the type of the *i*-th bumper.

Print one integer — the number of positions in the sequence such that the ball will eventually fall from the game field if it starts at that position.

[ "4\n<<><\n", "5\n>>>>>\n", "4\n>><<\n" ]

[ "2", "5", "0" ]

In the first sample, the ball will fall from the field if starts at position 1 or position 2. In the second sample, any starting position will result in the ball falling from the field.

500

[ { "input": "4\n<<><", "output": "2" }, { "input": "5\n>>>>>", "output": "5" }, { "input": "4\n>><<", "output": "0" }, { "input": "3\n<<>", "output": "3" }, { "input": "3\n<<<", "output": "3" }, { "input": "3\n><<", "output": "0" }, { "input": "1\n<", "output": "1" }, { "input": "2\n<>", "output": "2" }, { "input": "3\n<>>", "output": "3" }, { "input": "3\n><>", "output": "1" }, { "input": "2\n><", "output": "0" }, { "input": "2\n>>", "output": "2" }, { "input": "2\n<<", "output": "2" }, { "input": "1\n>", "output": "1" }, { "input": "3\n>><", "output": "0" }, { "input": "3\n>>>", "output": "3" }, { "input": "3\n<><", "output": "1" }, { "input": "10\n<<<><<<>>>", "output": "6" }, { "input": "20\n><><<><<<>>>>>>>>>>>", "output": "11" }, { "input": "20\n<<<<<<<<<<><<<<>>>>>", "output": "15" }, { "input": "50\n<<<<<<<<<<<<<<<<<<<<<<<<<>>>>>>>>>>>>>>>>>>>>>>>>>", "output": "50" }, { "input": "100\n<<<<<<<<<<<<<<<<<<<<<<<<>><<>><<<<<>><>><<<>><><<>>><<>>><<<<><><><<><<<<><>>>>>>>>>>>>>>>>>>>>>>>>>", "output": "49" }, { "input": "100\n<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<>>>><<>><>><>><<><><><><>>>><><<<>>>><<<>>>>>>><><", "output": "50" }, { "input": "100\n<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<", "output": "100" }, { "input": "100\n>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>", "output": "100" }, { "input": "12\n<<>><<>><<>>", "output": "4" }, { "input": "6\n<<><>>", "output": "4" }, { "input": "6\n><>>>>", "output": "4" }, { "input": "8\n>>>><<<>", "output": "1" }, { "input": "4\n<><>", "output": "2" }, { "input": "4\n><><", "output": "0" }, { "input": "7\n<<>>><>", "output": "3" }, { "input": "10\n><><>>>>>>", "output": "6" }, { "input": "5\n<><>>", "output": "3" }, { "input": "12\n<><<<<>>>>>>", "output": "7" }, { "input": "6\n<>><<>", "output": "2" }, { "input": "6\n>>><>>", "output": "2" }, { "input": "10\n><><>>>><>", "output": "1" }, { "input": "5\n><>>>", "output": "3" }, { "input": "5\n<<><>", "output": "3" }, { "input": "5\n<><<<", "output": "1" }, { "input": "4\n<><<", "output": "1" }, { "input": "8\n<<>><<>>", "output": "4" }, { "input": "7\n<<><>>>", "output": "5" }, { "input": "5\n><<>>", "output": "2" }, { "input": "10\n<<<<<>>>>>", "output": "10" }, { "input": "6\n><<<<<", "output": "0" }, { "input": "8\n<<><><>>", "output": "4" }, { "input": "10\n<<<<><<<><", "output": "4" }, { "input": "12\n<<<>>>><<>>>", "output": "6" }, { "input": "4\n><>>", "output": "2" }, { "input": "11\n<<><<>><<>>", "output": "4" } ]

1,605,863,841

2,147,483,647

Python 3

RUNTIME_ERROR

TESTS

0

124

716,800

import re n = int(input()) s = input() res = re.findall('>+$|^<+', s) print(len(res[0]) + len(res[1]))

Title: Jumping Ball Time Limit: None seconds Memory Limit: None megabytes Problem Description: In a new version of the famous Pinball game, one of the most important parts of the game field is a sequence of *n* bumpers. The bumpers are numbered with integers from 1 to *n* from left to right. There are two types of bumpers. They are denoted by the characters '<' and '>'. When the ball hits the bumper at position *i* it goes one position to the right (to the position *i*<=+<=1) if the type of this bumper is '>', or one position to the left (to *i*<=-<=1) if the type of the bumper at position *i* is '<'. If there is no such position, in other words if *i*<=-<=1<=<<=1 or *i*<=+<=1<=><=*n*, the ball falls from the game field. Depending on the ball's starting position, the ball may eventually fall from the game field or it may stay there forever. You are given a string representing the bumpers' types. Calculate the number of positions such that the ball will eventually fall from the game field if it starts at that position. Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the length of the sequence of bumpers. The second line contains the string, which consists of the characters '<' and '>'. The character at the *i*-th position of this string corresponds to the type of the *i*-th bumper. Output Specification: Print one integer — the number of positions in the sequence such that the ball will eventually fall from the game field if it starts at that position. Demo Input: ['4\n<<><\n', '5\n>>>>>\n', '4\n>><<\n'] Demo Output: ['2', '5', '0'] Note: In the first sample, the ball will fall from the field if starts at position 1 or position 2. In the second sample, any starting position will result in the ball falling from the field.

```python import re n = int(input()) s = input() res = re.findall('>+$|^<+', s) print(len(res[0]) + len(res[1])) ```

-1

208

A

Dubstep

PROGRAMMING

900

[ "strings" ]

null

Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them. Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club. For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX". Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.

The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.

Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.

[ "WUBWUBABCWUB\n", "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n" ]

[ "ABC ", "WE ARE THE CHAMPIONS MY FRIEND " ]

In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya. In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".

500

[ { "input": "WUBWUBABCWUB", "output": "ABC " }, { "input": "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB", "output": "WE ARE THE CHAMPIONS MY FRIEND " }, { "input": "WUBWUBWUBSR", "output": "SR " }, { "input": "RWUBWUBWUBLWUB", "output": "R L " }, { "input": "ZJWUBWUBWUBJWUBWUBWUBL", "output": "ZJ J L " }, { "input": "CWUBBWUBWUBWUBEWUBWUBWUBQWUBWUBWUB", "output": "C B E Q " }, { "input": "WUBJKDWUBWUBWBIRAQKFWUBWUBYEWUBWUBWUBWVWUBWUB", "output": "JKD WBIRAQKF YE WV " }, { "input": "WUBKSDHEMIXUJWUBWUBRWUBWUBWUBSWUBWUBWUBHWUBWUBWUB", "output": "KSDHEMIXUJ R S H " }, { "input": "OGWUBWUBWUBXWUBWUBWUBIWUBWUBWUBKOWUBWUB", "output": "OG X I KO " }, { "input": "QWUBQQWUBWUBWUBIWUBWUBWWWUBWUBWUBJOPJPBRH", "output": "Q QQ I WW JOPJPBRH " }, { "input": "VSRNVEATZTLGQRFEGBFPWUBWUBWUBAJWUBWUBWUBPQCHNWUBCWUB", "output": "VSRNVEATZTLGQRFEGBFP AJ PQCHN C " }, { "input": "WUBWUBEWUBWUBWUBIQMJNIQWUBWUBWUBGZZBQZAUHYPWUBWUBWUBPMRWUBWUBWUBDCV", "output": "E IQMJNIQ GZZBQZAUHYP PMR DCV " }, { "input": "WUBWUBWUBFVWUBWUBWUBBPSWUBWUBWUBRXNETCJWUBWUBWUBJDMBHWUBWUBWUBBWUBWUBVWUBWUBB", "output": "FV BPS RXNETCJ JDMBH B V B " }, { "input": "WUBWUBWUBFBQWUBWUBWUBIDFSYWUBWUBWUBCTWDMWUBWUBWUBSXOWUBWUBWUBQIWUBWUBWUBL", "output": "FBQ IDFSY CTWDM SXO QI L " }, { "input": "IWUBWUBQLHDWUBYIIKZDFQWUBWUBWUBCXWUBWUBUWUBWUBWUBKWUBWUBWUBNL", "output": "I QLHD YIIKZDFQ CX U K NL " }, { "input": "KWUBUPDYXGOKUWUBWUBWUBAGOAHWUBIZDWUBWUBWUBIYWUBWUBWUBVWUBWUBWUBPWUBWUBWUBE", "output": "K UPDYXGOKU AGOAH IZD IY V P E " }, { "input": "WUBWUBOWUBWUBWUBIPVCQAFWYWUBWUBWUBQWUBWUBWUBXHDKCPYKCTWWYWUBWUBWUBVWUBWUBWUBFZWUBWUB", "output": "O IPVCQAFWY Q XHDKCPYKCTWWY V FZ " }, { "input": "PAMJGYWUBWUBWUBXGPQMWUBWUBWUBTKGSXUYWUBWUBWUBEWUBWUBWUBNWUBWUBWUBHWUBWUBWUBEWUBWUB", "output": "PAMJGY XGPQM TKGSXUY E N H E " }, { "input": "WUBYYRTSMNWUWUBWUBWUBCWUBWUBWUBCWUBWUBWUBFSYUINDWOBVWUBWUBWUBFWUBWUBWUBAUWUBWUBWUBVWUBWUBWUBJB", "output": "YYRTSMNWU C C FSYUINDWOBV F AU V JB " }, { "input": "WUBWUBYGPYEYBNRTFKOQCWUBWUBWUBUYGRTQEGWLFYWUBWUBWUBFVWUBHPWUBWUBWUBXZQWUBWUBWUBZDWUBWUBWUBM", "output": "YGPYEYBNRTFKOQC UYGRTQEGWLFY FV HP XZQ ZD M " }, { "input": "WUBZVMJWUBWUBWUBFOIMJQWKNZUBOFOFYCCWUBWUBWUBAUWWUBRDRADWUBWUBWUBCHQVWUBWUBWUBKFTWUBWUBWUBW", "output": "ZVMJ FOIMJQWKNZUBOFOFYCC AUW RDRAD CHQV KFT W " }, { "input": "WUBWUBZBKOKHQLGKRVIMZQMQNRWUBWUBWUBDACWUBWUBNZHFJMPEYKRVSWUBWUBWUBPPHGAVVPRZWUBWUBWUBQWUBWUBAWUBG", "output": "ZBKOKHQLGKRVIMZQMQNR DAC NZHFJMPEYKRVS PPHGAVVPRZ Q A G " }, { "input": "WUBWUBJWUBWUBWUBNFLWUBWUBWUBGECAWUBYFKBYJWTGBYHVSSNTINKWSINWSMAWUBWUBWUBFWUBWUBWUBOVWUBWUBLPWUBWUBWUBN", "output": "J NFL GECA YFKBYJWTGBYHVSSNTINKWSINWSMA F OV LP N " }, { "input": "WUBWUBLCWUBWUBWUBZGEQUEATJVIXETVTWUBWUBWUBEXMGWUBWUBWUBRSWUBWUBWUBVWUBWUBWUBTAWUBWUBWUBCWUBWUBWUBQG", "output": "LC ZGEQUEATJVIXETVT EXMG RS V TA C QG " }, { "input": "WUBMPWUBWUBWUBORWUBWUBDLGKWUBWUBWUBVVZQCAAKVJTIKWUBWUBWUBTJLUBZJCILQDIFVZWUBWUBYXWUBWUBWUBQWUBWUBWUBLWUB", "output": "MP OR DLGK VVZQCAAKVJTIK TJLUBZJCILQDIFVZ YX Q L " }, { "input": "WUBNXOLIBKEGXNWUBWUBWUBUWUBGITCNMDQFUAOVLWUBWUBWUBAIJDJZJHFMPVTPOXHPWUBWUBWUBISCIOWUBWUBWUBGWUBWUBWUBUWUB", "output": "NXOLIBKEGXN U GITCNMDQFUAOVL AIJDJZJHFMPVTPOXHP ISCIO G U " }, { "input": "WUBWUBNMMWCZOLYPNBELIYVDNHJUNINWUBWUBWUBDXLHYOWUBWUBWUBOJXUWUBWUBWUBRFHTGJCEFHCGWARGWUBWUBWUBJKWUBWUBSJWUBWUB", "output": "NMMWCZOLYPNBELIYVDNHJUNIN DXLHYO OJXU RFHTGJCEFHCGWARG JK SJ " }, { "input": "SGWLYSAUJOJBNOXNWUBWUBWUBBOSSFWKXPDPDCQEWUBWUBWUBDIRZINODWUBWUBWUBWWUBWUBWUBPPHWUBWUBWUBRWUBWUBWUBQWUBWUBWUBJWUB", "output": "SGWLYSAUJOJBNOXN BOSSFWKXPDPDCQE DIRZINOD W PPH R Q J " }, { "input": "TOWUBWUBWUBGBTBNWUBWUBWUBJVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSAWUBWUBWUBSWUBWUBWUBTOLVXWUBWUBWUBNHWUBWUBWUBO", "output": "TO GBTBN JVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSA S TOLVX NH O " }, { "input": "WUBWUBWSPLAYSZSAUDSWUBWUBWUBUWUBWUBWUBKRWUBWUBWUBRSOKQMZFIYZQUWUBWUBWUBELSHUWUBWUBWUBUKHWUBWUBWUBQXEUHQWUBWUBWUBBWUBWUBWUBR", "output": "WSPLAYSZSAUDS U KR RSOKQMZFIYZQU ELSHU UKH QXEUHQ B R " }, { "input": "WUBXEMWWVUHLSUUGRWUBWUBWUBAWUBXEGILZUNKWUBWUBWUBJDHHKSWUBWUBWUBDTSUYSJHWUBWUBWUBPXFWUBMOHNJWUBWUBWUBZFXVMDWUBWUBWUBZMWUBWUB", "output": "XEMWWVUHLSUUGR A XEGILZUNK JDHHKS DTSUYSJH PXF MOHNJ ZFXVMD ZM " }, { "input": "BMBWUBWUBWUBOQKWUBWUBWUBPITCIHXHCKLRQRUGXJWUBWUBWUBVWUBWUBWUBJCWUBWUBWUBQJPWUBWUBWUBBWUBWUBWUBBMYGIZOOXWUBWUBWUBTAGWUBWUBHWUB", "output": "BMB OQK PITCIHXHCKLRQRUGXJ V JC QJP B BMYGIZOOX TAG H " }, { "input": "CBZNWUBWUBWUBNHWUBWUBWUBYQSYWUBWUBWUBMWUBWUBWUBXRHBTMWUBWUBWUBPCRCWUBWUBWUBTZUYLYOWUBWUBWUBCYGCWUBWUBWUBCLJWUBWUBWUBSWUBWUBWUB", "output": "CBZN NH YQSY M XRHBTM PCRC TZUYLYO CYGC CLJ S " }, { "input": "DPDWUBWUBWUBEUQKWPUHLTLNXHAEKGWUBRRFYCAYZFJDCJLXBAWUBWUBWUBHJWUBOJWUBWUBWUBNHBJEYFWUBWUBWUBRWUBWUBWUBSWUBWWUBWUBWUBXDWUBWUBWUBJWUB", "output": "DPD EUQKWPUHLTLNXHAEKG RRFYCAYZFJDCJLXBA HJ OJ NHBJEYF R S W XD J " }, { "input": "WUBWUBWUBISERPQITVIYERSCNWUBWUBWUBQWUBWUBWUBDGSDIPWUBWUBWUBCAHKDZWEXBIBJVVSKKVQJWUBWUBWUBKIWUBWUBWUBCWUBWUBWUBAWUBWUBWUBPWUBWUBWUBHWUBWUBWUBF", "output": "ISERPQITVIYERSCN Q DGSDIP CAHKDZWEXBIBJVVSKKVQJ KI C A P H F " }, { "input": "WUBWUBWUBIWUBWUBLIKNQVWUBWUBWUBPWUBWUBWUBHWUBWUBWUBMWUBWUBWUBDPRSWUBWUBWUBBSAGYLQEENWXXVWUBWUBWUBXMHOWUBWUBWUBUWUBWUBWUBYRYWUBWUBWUBCWUBWUBWUBY", "output": "I LIKNQV P H M DPRS BSAGYLQEENWXXV XMHO U YRY C Y " }, { "input": "WUBWUBWUBMWUBWUBWUBQWUBWUBWUBITCFEYEWUBWUBWUBHEUWGNDFNZGWKLJWUBWUBWUBMZPWUBWUBWUBUWUBWUBWUBBWUBWUBWUBDTJWUBHZVIWUBWUBWUBPWUBFNHHWUBWUBWUBVTOWUB", "output": "M Q ITCFEYE HEUWGNDFNZGWKLJ MZP U B DTJ HZVI P FNHH VTO " }, { "input": "WUBWUBNDNRFHYJAAUULLHRRDEDHYFSRXJWUBWUBWUBMUJVDTIRSGYZAVWKRGIFWUBWUBWUBHMZWUBWUBWUBVAIWUBWUBWUBDDKJXPZRGWUBWUBWUBSGXWUBWUBWUBIFKWUBWUBWUBUWUBWUBWUBW", "output": "NDNRFHYJAAUULLHRRDEDHYFSRXJ MUJVDTIRSGYZAVWKRGIF HMZ VAI DDKJXPZRG SGX IFK U W " }, { "input": "WUBOJMWRSLAXXHQRTPMJNCMPGWUBWUBWUBNYGMZIXNLAKSQYWDWUBWUBWUBXNIWUBWUBWUBFWUBWUBWUBXMBWUBWUBWUBIWUBWUBWUBINWUBWUBWUBWDWUBWUBWUBDDWUBWUBWUBD", "output": "OJMWRSLAXXHQRTPMJNCMPG NYGMZIXNLAKSQYWD XNI F XMB I IN WD DD D " }, { "input": "WUBWUBWUBREHMWUBWUBWUBXWUBWUBWUBQASNWUBWUBWUBNLSMHLCMTICWUBWUBWUBVAWUBWUBWUBHNWUBWUBWUBNWUBWUBWUBUEXLSFOEULBWUBWUBWUBXWUBWUBWUBJWUBWUBWUBQWUBWUBWUBAWUBWUB", "output": "REHM X QASN NLSMHLCMTIC VA HN N UEXLSFOEULB X J Q A " }, { "input": "WUBWUBWUBSTEZTZEFFIWUBWUBWUBSWUBWUBWUBCWUBFWUBHRJPVWUBWUBWUBDYJUWUBWUBWUBPWYDKCWUBWUBWUBCWUBWUBWUBUUEOGCVHHBWUBWUBWUBEXLWUBWUBWUBVCYWUBWUBWUBMWUBWUBWUBYWUB", "output": "STEZTZEFFI S C F HRJPV DYJU PWYDKC C UUEOGCVHHB EXL VCY M Y " }, { "input": "WPPNMSQOQIWUBWUBWUBPNQXWUBWUBWUBHWUBWUBWUBNFLWUBWUBWUBGWSGAHVJFNUWUBWUBWUBFWUBWUBWUBWCMLRICFSCQQQTNBWUBWUBWUBSWUBWUBWUBKGWUBWUBWUBCWUBWUBWUBBMWUBWUBWUBRWUBWUB", "output": "WPPNMSQOQI PNQX H NFL GWSGAHVJFNU F WCMLRICFSCQQQTNB S KG C BM R " }, { "input": "YZJOOYITZRARKVFYWUBWUBRZQGWUBWUBWUBUOQWUBWUBWUBIWUBWUBWUBNKVDTBOLETKZISTWUBWUBWUBWLWUBQQFMMGSONZMAWUBZWUBWUBWUBQZUXGCWUBWUBWUBIRZWUBWUBWUBLTTVTLCWUBWUBWUBY", "output": "YZJOOYITZRARKVFY RZQG UOQ I NKVDTBOLETKZIST WL QQFMMGSONZMA Z QZUXGC IRZ LTTVTLC Y " }, { "input": "WUBCAXNCKFBVZLGCBWCOAWVWOFKZVQYLVTWUBWUBWUBNLGWUBWUBWUBAMGDZBDHZMRMQMDLIRMIWUBWUBWUBGAJSHTBSWUBWUBWUBCXWUBWUBWUBYWUBZLXAWWUBWUBWUBOHWUBWUBWUBZWUBWUBWUBGBWUBWUBWUBE", "output": "CAXNCKFBVZLGCBWCOAWVWOFKZVQYLVT NLG AMGDZBDHZMRMQMDLIRMI GAJSHTBS CX Y ZLXAW OH Z GB E " }, { "input": "WUBWUBCHXSOWTSQWUBWUBWUBCYUZBPBWUBWUBWUBSGWUBWUBWKWORLRRLQYUUFDNWUBWUBWUBYYGOJNEVEMWUBWUBWUBRWUBWUBWUBQWUBWUBWUBIHCKWUBWUBWUBKTWUBWUBWUBRGSNTGGWUBWUBWUBXCXWUBWUBWUBS", "output": "CHXSOWTSQ CYUZBPB SG WKWORLRRLQYUUFDN YYGOJNEVEM R Q IHCK KT RGSNTGG XCX S " }, { "input": "WUBWUBWUBHJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQWUBWUBWUBXTZKGIITWUBWUBWUBAWUBWUBWUBVNCXPUBCQWUBWUBWUBIDPNAWUBWUBWUBOWUBWUBWUBYGFWUBWUBWUBMQOWUBWUBWUBKWUBWUBWUBAZVWUBWUBWUBEP", "output": "HJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQ XTZKGIIT A VNCXPUBCQ IDPNA O YGF MQO K AZV EP " }, { "input": "WUBKYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTVWUBWUBWUBLRMIIWUBWUBWUBGWUBWUBWUBADPSWUBWUBWUBANBWUBWUBPCWUBWUBWUBPWUBWUBWUBGPVNLSWIRFORYGAABUXMWUBWUBWUBOWUBWUBWUBNWUBWUBWUBYWUBWUB", "output": "KYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTV LRMII G ADPS ANB PC P GPVNLSWIRFORYGAABUXM O N Y " }, { "input": "REWUBWUBWUBJDWUBWUBWUBNWUBWUBWUBTWWUBWUBWUBWZDOCKKWUBWUBWUBLDPOVBFRCFWUBWUBAKZIBQKEUAZEEWUBWUBWUBLQYPNPFWUBYEWUBWUBWUBFWUBWUBWUBBPWUBWUBWUBAWWUBWUBWUBQWUBWUBWUBBRWUBWUBWUBXJL", "output": "RE JD N TW WZDOCKK LDPOVBFRCF AKZIBQKEUAZEE LQYPNPF YE F BP AW Q BR XJL " }, { "input": "CUFGJDXGMWUBWUBWUBOMWUBWUBWUBSIEWUBWUBWUBJJWKNOWUBWUBWUBYBHVNRNORGYWUBWUBWUBOAGCAWUBWUBWUBSBLBKTPFKPBIWUBWUBWUBJBWUBWUBWUBRMFCJPGWUBWUBWUBDWUBWUBWUBOJOWUBWUBWUBZPWUBWUBWUBMWUBRWUBWUBWUBFXWWUBWUBWUBO", "output": "CUFGJDXGM OM SIE JJWKNO YBHVNRNORGY OAGCA SBLBKTPFKPBI JB RMFCJPG D OJO ZP M R FXW O " }, { "input": "WUBJZGAEXFMFEWMAKGQLUWUBWUBWUBICYTPQWGENELVYWANKUOJYWUBWUBWUBGWUBWUBWUBHYCJVLPHTUPNEGKCDGQWUBWUBWUBOFWUBWUBWUBCPGSOGZBRPRPVJJEWUBWUBWUBDQBCWUBWUBWUBHWUBWUBWUBMHOHYBMATWUBWUBWUBVWUBWUBWUBSWUBWUBWUBKOWU", "output": "JZGAEXFMFEWMAKGQLU ICYTPQWGENELVYWANKUOJY G HYCJVLPHTUPNEGKCDGQ OF CPGSOGZBRPRPVJJE DQBC H MHOHYBMAT V S KOWU " }, { "input": "A", "output": "A " }, { "input": "WUBA", "output": "A " }, { "input": "WUBWUBA", "output": "A " }, { "input": "AWUBWUBWUB", "output": "A " }, { "input": "AWUBBWUBCWUBD", "output": "A B C D " }, { "input": "WUBWWUBWUBWUBUWUBWUBBWUB", "output": "W U B " }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA " }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAWUBAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA " }, { "input": "WUWUBBWWUBUB", "output": "WU BW UB " }, { "input": "WUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUABWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUB", "output": "WUAB " }, { "input": "ZWUB", "output": "Z " }, { "input": "WU", "output": "WU " }, { "input": "UB", "output": "UB " }, { "input": "U", "output": "U " }, { "input": "WUBW", "output": "W " }, { "input": "WUBWU", "output": "WU " }, { "input": "WUWUB", "output": "WU " }, { "input": "UBWUB", "output": "UB " }, { "input": "WUWUBUBWUBUWUB", "output": "WU UB U " }, { "input": "WUBWWUBAWUB", "output": "W A " }, { "input": "WUUUUU", "output": "WUUUUU " } ]

1,677,949,318

2,147,483,647

PyPy 3-64

WRONG_ANSWER

TESTS

0

92

0

inp = input() inp = inp.lower() inp = inp.replace('wubwubwub',' ') inp = inp.replace('wubwub',' ') inp = inp.replace('wub',' ') inp = inp[1:-1] print(inp)

Title: Dubstep Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them. Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club. For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX". Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song. Input Specification: The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word. Output Specification: Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space. Demo Input: ['WUBWUBABCWUB\n', 'WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n'] Demo Output: ['ABC ', 'WE ARE THE CHAMPIONS MY FRIEND '] Note: In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya. In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".

```python inp = input() inp = inp.lower() inp = inp.replace('wubwubwub',' ') inp = inp.replace('wubwub',' ') inp = inp.replace('wub',' ') inp = inp[1:-1] print(inp) ```

0

none

0

[ "none" ]

null

Today on a lecture about strings Gerald learned a new definition of string equivalency. Two strings *a* and *b* of equal length are called equivalent in one of the two cases: 1. They are equal. 1. If we split string *a* into two halves of the same size *a*1 and *a*2, and string *b* into two halves of the same size *b*1 and *b*2, then one of the following is correct: *a*1 is equivalent to *b*1, and *a*2 is equivalent to *b*2 1. *a*1 is equivalent to *b*2, and *a*2 is equivalent to *b*1 As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent. Gerald has already completed this home task. Now it's your turn!

The first two lines of the input contain two strings given by the teacher. Each of them has the length from 1 to 200<=000 and consists of lowercase English letters. The strings have the same length.

Print "YES" (without the quotes), if these two strings are equivalent, and "NO" (without the quotes) otherwise.

[ "aaba\nabaa\n", "aabb\nabab\n" ]

[ "YES\n", "NO\n" ]

In the first sample you should split the first string into strings "aa" and "ba", the second one — into strings "ab" and "aa". "aa" is equivalent to "aa"; "ab" is equivalent to "ba" as "ab" = "a" + "b", "ba" = "b" + "a". In the second sample the first string can be splitted into strings "aa" and "bb", that are equivalent only to themselves. That's why string "aabb" is equivalent only to itself and to string "bbaa".

0

[ { "input": "aaba\nabaa", "output": "YES" }, { "input": "aabb\nabab", "output": "NO" }, { "input": "a\na", "output": "YES" }, { "input": "a\nb", "output": "NO" }, { "input": "ab\nab", "output": "YES" }, { "input": "ab\nba", "output": "YES" }, { "input": "ab\nbb", "output": "NO" }, { "input": "zzaa\naazz", "output": "YES" }, { "input": "azza\nzaaz", "output": "YES" }, { "input": "abc\nabc", "output": "YES" }, { "input": "abc\nacb", "output": "NO" }, { "input": "azzz\nzzaz", "output": "YES" }, { "input": "abcd\ndcab", "output": "YES" }, { "input": "abcd\ncdab", "output": "YES" }, { "input": "abcd\ndcba", "output": "YES" }, { "input": "abcd\nacbd", "output": "NO" }, { "input": "oloaxgddgujq\noloaxgujqddg", "output": "YES" }, { "input": "uwzwdxfmosmqatyv\ndxfmzwwusomqvyta", "output": "YES" }, { "input": "hagnzomowtledfdotnll\nledfdotnllomowthagnz", "output": "YES" }, { "input": "snyaydaeobufdg\nsnyaydaeobufdg", "output": "YES" }, { "input": "baaaaa\nabaaaa", "output": "NO" }, { "input": "hhiisug\nmzdjwju", "output": "NO" }, { "input": "bbbabbabaaab\naaaabbabbbbb", "output": "NO" }, { "input": "bbaaab\naababb", "output": "NO" }, { "input": "aabbaaaa\naaaaabab", "output": "NO" }, { "input": "aab\naba", "output": "NO" }, { "input": "abcddd\nbacddd", "output": "NO" }, { "input": "qgiufelsfhanx\naaaaaaaaaaaaa", "output": "NO" }, { "input": "aabaababaaba\naababaaababa", "output": "NO" }, { "input": "nocdqzdriyyil\naaaaaaaaaaaaa", "output": "NO" }, { "input": "zdmctxl\nkojqhgw", "output": "NO" }, { "input": "yhwepqwyhwepqwyhwepqweahnqtueahnqtueahnqtuyhwepqwyhwepqwyhwepqwyhwepqweahnqtueahnqtuyhwepqweahnqtueahnqtueahnqtueahnqtueahnqtueahnqtu\neahnqtueahnqtueahnqtuyhwepqweahnqtuyhwepqwyhwepqweahnqtuyhwepqweahnqtuyhwepqweahnqtueahnqtuyhwepqweahnqtueahnqtuyhwepqwyhwepqwyhwepqw", "output": "NO" }, { "input": "abc\nbac", "output": "NO" }, { "input": "ottceez\npcstdvz", "output": "NO" } ]

1,437,652,160

2,147,483,647

Python 3

WRONG_ANSWER

TESTS

24

857

1,024,000

sa = input().strip() sb = input().strip() def check(p1, p2, ln): global sa, sb if sa[p1:p1 + ln] == sb[p2:p2 + ln]: return True if ln == 1: return False nln = ln // 2 return (check(p1, p2, nln) and check(p1 + nln, p2 + nln, nln)) or (check(p1, p2 + nln, nln) and check(p1 + nln, p2, nln)) print("YES" if check(0, 0, len(sa)) else "NO")

Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Today on a lecture about strings Gerald learned a new definition of string equivalency. Two strings *a* and *b* of equal length are called equivalent in one of the two cases: 1. They are equal. 1. If we split string *a* into two halves of the same size *a*1 and *a*2, and string *b* into two halves of the same size *b*1 and *b*2, then one of the following is correct: *a*1 is equivalent to *b*1, and *a*2 is equivalent to *b*2 1. *a*1 is equivalent to *b*2, and *a*2 is equivalent to *b*1 As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent. Gerald has already completed this home task. Now it's your turn! Input Specification: The first two lines of the input contain two strings given by the teacher. Each of them has the length from 1 to 200<=000 and consists of lowercase English letters. The strings have the same length. Output Specification: Print "YES" (without the quotes), if these two strings are equivalent, and "NO" (without the quotes) otherwise. Demo Input: ['aaba\nabaa\n', 'aabb\nabab\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample you should split the first string into strings "aa" and "ba", the second one — into strings "ab" and "aa". "aa" is equivalent to "aa"; "ab" is equivalent to "ba" as "ab" = "a" + "b", "ba" = "b" + "a". In the second sample the first string can be splitted into strings "aa" and "bb", that are equivalent only to themselves. That's why string "aabb" is equivalent only to itself and to string "bbaa".

```python sa = input().strip() sb = input().strip() def check(p1, p2, ln): global sa, sb if sa[p1:p1 + ln] == sb[p2:p2 + ln]: return True if ln == 1: return False nln = ln // 2 return (check(p1, p2, nln) and check(p1 + nln, p2 + nln, nln)) or (check(p1, p2 + nln, nln) and check(p1 + nln, p2, nln)) print("YES" if check(0, 0, len(sa)) else "NO") ```

0

439

A

Devu, the Singer and Churu, the Joker

PROGRAMMING

900

[ "greedy", "implementation" ]

null

Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited. Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly. The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly. People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest. You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions: - The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible. If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event.

The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100).

If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event.

[ "3 30\n2 2 1\n", "3 20\n2 1 1\n" ]

[ "5\n", "-1\n" ]

Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way: - First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes. Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes. Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.

500

[ { "input": "3 30\n2 2 1", "output": "5" }, { "input": "3 20\n2 1 1", "output": "-1" }, { "input": "50 10000\n5 4 10 9 9 6 7 7 7 3 3 7 7 4 7 4 10 10 1 7 10 3 1 4 5 7 2 10 10 10 2 3 4 7 6 1 8 4 7 3 8 8 4 10 1 1 9 2 6 1", "output": "1943" }, { "input": "50 10000\n4 7 15 9 11 12 20 9 14 14 10 13 6 13 14 17 6 8 20 12 10 15 13 17 5 12 13 11 7 5 5 2 3 15 13 7 14 14 19 2 13 14 5 15 3 19 15 16 4 1", "output": "1891" }, { "input": "100 9000\n5 2 3 1 1 3 4 9 9 6 7 10 10 10 2 10 6 8 8 6 7 9 9 5 6 2 1 10 10 9 4 5 9 2 4 3 8 5 6 1 1 5 3 6 2 6 6 6 5 8 3 6 7 3 1 10 9 1 8 3 10 9 5 6 3 4 1 1 10 10 2 3 4 8 10 10 5 1 5 3 6 8 10 6 10 2 1 8 10 1 7 6 9 10 5 2 3 5 3 2", "output": "1688" }, { "input": "100 8007\n5 19 14 18 9 6 15 8 1 14 11 20 3 17 7 12 2 6 3 17 7 20 1 14 20 17 2 10 13 7 18 18 9 10 16 8 1 11 11 9 13 18 9 20 12 12 7 15 12 17 11 5 11 15 9 2 15 1 18 3 18 16 15 4 10 5 18 13 13 12 3 8 17 2 12 2 13 3 1 13 2 4 9 10 18 10 14 4 4 17 12 19 2 9 6 5 5 20 18 12", "output": "1391" }, { "input": "39 2412\n1 1 1 1 1 1 26 1 1 1 99 1 1 1 1 1 1 1 1 1 1 88 7 1 1 1 1 76 1 1 1 93 40 1 13 1 68 1 32", "output": "368" }, { "input": "39 2617\n47 1 1 1 63 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 70 1 99 63 1 1 1 1 1 1 1 1 64 1 1", "output": "435" }, { "input": "39 3681\n83 77 1 94 85 47 1 98 29 16 1 1 1 71 96 85 31 97 96 93 40 50 98 1 60 51 1 96 100 72 1 1 1 89 1 93 1 92 100", "output": "326" }, { "input": "45 894\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 28 28 1 1 1 1 1 1 1 1 1 1 1 1 1 1 99 3 1 1", "output": "139" }, { "input": "45 4534\n1 99 65 99 4 46 54 80 51 30 96 1 28 30 44 70 78 1 1 100 1 62 1 1 1 85 1 1 1 61 1 46 75 1 61 77 97 26 67 1 1 63 81 85 86", "output": "514" }, { "input": "72 3538\n52 1 8 1 1 1 7 1 1 1 1 48 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 40 1 1 38 1 1 1 1 1 1 1 1 1 1 1 35 1 93 79 1 1 1 1 1 1 1 1 1 51 1 1 1 1 1 1 1 1 1 1 1 1 96 1", "output": "586" }, { "input": "81 2200\n1 59 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 93 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 50 1 1 1 1 1 1 1 1 1 1 1", "output": "384" }, { "input": "81 2577\n85 91 1 1 2 1 1 100 1 80 1 1 17 86 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 37 1 66 24 1 1 96 49 1 66 1 44 1 1 1 1 98 1 1 1 1 35 1 37 3 35 1 1 87 64 1 24 1 58 1 1 42 83 5 1 1 1 1 1 95 1 94 1 50 1 1", "output": "174" }, { "input": "81 4131\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 16 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "807" }, { "input": "81 6315\n1 1 67 100 1 99 36 1 92 5 1 96 42 12 1 57 91 1 1 66 41 30 74 95 1 37 1 39 91 69 1 52 77 47 65 1 1 93 96 74 90 35 85 76 71 92 92 1 1 67 92 74 1 1 86 76 35 1 56 16 27 57 37 95 1 40 20 100 51 1 80 60 45 79 95 1 46 1 25 100 96", "output": "490" }, { "input": "96 1688\n1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 25 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 71 1 1 1 30 1 1 1", "output": "284" }, { "input": "96 8889\n1 1 18 1 1 1 1 1 1 1 1 1 99 1 1 1 1 88 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 96 1 1 1 1 21 1 1 1 1 1 1 1 73 1 1 1 1 1 10 1 1 1 1 1 1 1 46 43 1 1 1 1 1 98 1 1 1 1 1 1 6 1 1 1 1 1 74 1 25 1 55 1 1 1 13 1 1 54 1 1 1", "output": "1589" }, { "input": "10 100\n1 1 1 1 1 1 1 1 1 1", "output": "18" }, { "input": "100 10000\n54 46 72 94 79 83 91 54 73 3 24 55 54 31 28 20 19 6 25 19 47 23 1 70 15 87 51 39 54 77 55 5 60 3 15 99 56 88 22 78 79 21 38 27 28 86 7 88 12 59 55 70 25 1 70 49 1 45 69 72 50 17 4 56 8 100 90 34 35 20 61 76 88 79 4 74 65 68 75 26 40 72 59 94 10 67 96 85 29 90 47 24 44 1 66 93 55 36 1 99", "output": "1017" }, { "input": "100 6000\n41 31 23 17 24 78 26 96 93 48 46 2 49 33 35 9 73 100 34 48 83 36 33 69 43 24 3 74 8 81 27 33 94 38 77 9 76 90 62 90 21 67 22 22 12 2 17 27 61 18 72 85 59 65 71 38 90 75 74 66 60 47 58 50 90 95 75 10 5 100 97 29 83 88 65 26 93 90 22 98 36 55 70 38 50 92 88 72 99 96 25 14 74 16 25 92 67 94 77 96", "output": "-1" }, { "input": "1 1\n1", "output": "0" }, { "input": "1 6\n1", "output": "1" }, { "input": "1 5\n1", "output": "0" }, { "input": "1 3\n4", "output": "-1" }, { "input": "3 24\n2 1 2", "output": "-1" } ]

1,641,723,274

2,147,483,647

Python 3

WRONG_ANSWER

TESTS

0

31

0

n,d=map(int,input().split()) t=list(map(int,input().split())) if sum(t)+(n-1)*10<=d: count=(d-(sum(t)+(n-1)*10))//5 print(int(count)) else: print(-1)

Title: Devu, the Singer and Churu, the Joker Time Limit: None seconds Memory Limit: None megabytes Problem Description: Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited. Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly. The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly. People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest. You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions: - The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible. If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event. Input Specification: The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100). Output Specification: If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event. Demo Input: ['3 30\n2 2 1\n', '3 20\n2 1 1\n'] Demo Output: ['5\n', '-1\n'] Note: Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way: - First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes. Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes. Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.

```python n,d=map(int,input().split()) t=list(map(int,input().split())) if sum(t)+(n-1)*10<=d: count=(d-(sum(t)+(n-1)*10))//5 print(int(count)) else: print(-1) ```

0

595

A

Vitaly and Night

PROGRAMMING

800

[ "constructive algorithms", "implementation" ]

null

One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment. Vitaly sees a building of *n* floors and 2·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2·*j*<=-<=1 and 2·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on. Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping.

The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of floors in the house and the number of flats on each floor respectively. Next *n* lines describe the floors from top to bottom and contain 2·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'.

Print a single integer — the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping.

[ "2 2\n0 0 0 1\n1 0 1 1\n", "1 3\n1 1 0 1 0 0\n" ]

[ "3\n", "2\n" ]

In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off. In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off.

500

[ { "input": "2 2\n0 0 0 1\n1 0 1 1", "output": "3" }, { "input": "1 3\n1 1 0 1 0 0", "output": "2" }, { "input": "3 3\n1 1 1 1 1 1\n1 1 0 1 1 0\n1 0 0 0 1 1", "output": "8" }, { "input": "1 5\n1 0 1 1 1 0 1 1 1 1", "output": "5" }, { "input": "1 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 0 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "99" }, { "input": "1 100\n0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "6" }, { "input": "1 100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "100 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "100" }, { "input": "100 1\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0", "output": "8" }, { "input": "100 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "1 1\n0 0", "output": "0" }, { "input": "1 1\n0 1", "output": "1" }, { "input": "1 1\n1 0", "output": "1" }, { "input": "1 1\n1 1", "output": "1" } ]

1,588,241,592

2,147,483,647

Python 3

OK

TESTS

36

109

102,400

l = list(input().split()) n = int(l[0]) m = int(l[1]) awaking = 0 for i in range(n): q = list(input().split()) q = [int(j) for j in q] for h in range(0, 2 * m, 2): if (q[h] == 0) and (q[h + 1] == 0): continue else: awaking += 1 print(awaking)

Title: Vitaly and Night Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment. Vitaly sees a building of *n* floors and 2·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2·*j*<=-<=1 and 2·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on. Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping. Input Specification: The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of floors in the house and the number of flats on each floor respectively. Next *n* lines describe the floors from top to bottom and contain 2·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'. Output Specification: Print a single integer — the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping. Demo Input: ['2 2\n0 0 0 1\n1 0 1 1\n', '1 3\n1 1 0 1 0 0\n'] Demo Output: ['3\n', '2\n'] Note: In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off. In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off.

```python l = list(input().split()) n = int(l[0]) m = int(l[1]) awaking = 0 for i in range(n): q = list(input().split()) q = [int(j) for j in q] for h in range(0, 2 * m, 2): if (q[h] == 0) and (q[h + 1] == 0): continue else: awaking += 1 print(awaking) ```

3

233

A

Perfect Permutation

PROGRAMMING

800

[ "implementation", "math" ]

null

A permutation is a sequence of integers *p*1,<=*p*2,<=...,<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. Let's denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size of permutation *p*1,<=*p*2,<=...,<=*p**n*. Nickolas adores permutations. He likes some permutations more than the others. He calls such permutations perfect. A perfect permutation is such permutation *p* that for any *i* (1<=≤<=*i*<=≤<=*n*) (*n* is the permutation size) the following equations hold *p**p**i*<==<=*i* and *p**i*<=≠<=*i*. Nickolas asks you to print any perfect permutation of size *n* for the given *n*.

A single line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the permutation size.

If a perfect permutation of size *n* doesn't exist, print a single integer -1. Otherwise print *n* distinct integers from 1 to *n*, *p*1,<=*p*2,<=...,<=*p**n* — permutation *p*, that is perfect. Separate printed numbers by whitespaces.

[ "1\n", "2\n", "4\n" ]

[ "-1\n", "2 1 \n", "2 1 4 3 \n" ]

none

500

[ { "input": "1", "output": "-1" }, { "input": "2", "output": "2 1 " }, { "input": "4", "output": "2 1 4 3 " }, { "input": "3", "output": "-1" }, { "input": "5", "output": "-1" }, { "input": "6", "output": "2 1 4 3 6 5 " }, { "input": "7", "output": "-1" }, { "input": "20", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 " }, { "input": "8", "output": "2 1 4 3 6 5 8 7 " }, { "input": "9", "output": "-1" }, { "input": "10", "output": "2 1 4 3 6 5 8 7 10 9 " }, { "input": "11", "output": "-1" }, { "input": "21", "output": "-1" }, { "input": "50", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 " }, { "input": "51", "output": "-1" }, { "input": "52", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 " }, { "input": "84", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 " }, { "input": "86", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 " }, { "input": "100", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 " }, { "input": "98", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 " }, { "input": "96", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 " }, { "input": "33", "output": "-1" }, { "input": "34", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 " }, { "input": "36", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 " }, { "input": "38", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 " }, { "input": "40", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 " }, { "input": "42", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 " }, { "input": "44", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 " }, { "input": "46", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 " }, { "input": "48", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 " } ]

1,690,808,452

2,147,483,647

Python 3

OK

TESTS

30

92

0

def f(s): if s%2 != 0 : return -1 seq = [] for i in range(0,s,2): seq.append(i+2) seq.append(i+1) return " ".join([str(i) for i in seq]) t=int(input()) print(f(t))

Title: Perfect Permutation Time Limit: None seconds Memory Limit: None megabytes Problem Description: A permutation is a sequence of integers *p*1,<=*p*2,<=...,<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. Let's denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size of permutation *p*1,<=*p*2,<=...,<=*p**n*. Nickolas adores permutations. He likes some permutations more than the others. He calls such permutations perfect. A perfect permutation is such permutation *p* that for any *i* (1<=≤<=*i*<=≤<=*n*) (*n* is the permutation size) the following equations hold *p**p**i*<==<=*i* and *p**i*<=≠<=*i*. Nickolas asks you to print any perfect permutation of size *n* for the given *n*. Input Specification: A single line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the permutation size. Output Specification: If a perfect permutation of size *n* doesn't exist, print a single integer -1. Otherwise print *n* distinct integers from 1 to *n*, *p*1,<=*p*2,<=...,<=*p**n* — permutation *p*, that is perfect. Separate printed numbers by whitespaces. Demo Input: ['1\n', '2\n', '4\n'] Demo Output: ['-1\n', '2 1 \n', '2 1 4 3 \n'] Note: none

```python def f(s): if s%2 != 0 : return -1 seq = [] for i in range(0,s,2): seq.append(i+2) seq.append(i+1) return " ".join([str(i) for i in seq]) t=int(input()) print(f(t)) ```

3

499

B

Lecture

PROGRAMMING

1,000

[ "implementation", "strings" ]

null

You have a new professor of graph theory and he speaks very quickly. You come up with the following plan to keep up with his lecture and make notes. You know two languages, and the professor is giving the lecture in the first one. The words in both languages consist of lowercase English characters, each language consists of several words. For each language, all words are distinct, i.e. they are spelled differently. Moreover, the words of these languages have a one-to-one correspondence, that is, for each word in each language, there exists exactly one word in the other language having has the same meaning. You can write down every word the professor says in either the first language or the second language. Of course, during the lecture you write down each word in the language in which the word is shorter. In case of equal lengths of the corresponding words you prefer the word of the first language. You are given the text of the lecture the professor is going to read. Find out how the lecture will be recorded in your notes.

The first line contains two integers, *n* and *m* (1<=≤<=*n*<=≤<=3000, 1<=≤<=*m*<=≤<=3000) — the number of words in the professor's lecture and the number of words in each of these languages. The following *m* lines contain the words. The *i*-th line contains two strings *a**i*, *b**i* meaning that the word *a**i* belongs to the first language, the word *b**i* belongs to the second language, and these two words have the same meaning. It is guaranteed that no word occurs in both languages, and each word occurs in its language exactly once. The next line contains *n* space-separated strings *c*1,<=*c*2,<=...,<=*c**n* — the text of the lecture. It is guaranteed that each of the strings *c**i* belongs to the set of strings {*a*1,<=*a*2,<=... *a**m*}. All the strings in the input are non-empty, each consisting of no more than 10 lowercase English letters.

Output exactly *n* words: how you will record the lecture in your notebook. Output the words of the lecture in the same order as in the input.

[ "4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest\n", "5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll\n" ]

[ "codeforces round letter round\n", "hbnyiyc joll joll un joll\n" ]

none

500

[ { "input": "4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest", "output": "codeforces round letter round" }, { "input": "5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll", "output": "hbnyiyc joll joll un joll" }, { "input": "5 5\nqueyqj f\nb vn\ntabzvk qpfzoqx\nytnyonoc hnxsd\njpggvr lchinjmt\nqueyqj jpggvr b ytnyonoc b", "output": "f jpggvr b hnxsd b" }, { "input": "10 22\nazbrll oen\ngh vdyayei\njphveblohx vfglv\nmfyxib jepnvhcuwo\nrpikazqj uam\nl rx\nokjenof qpnyi\nj tixqrno\nod itozmfct\nikkdxmirx ev\nqexftojc p\nkdazb zjs\nmbk ykvqjrxaxu\nhbcwhouzq pwt\nmirpsz zfaegpl\nuhkkvcj rlvwj\nef iqnnwtolrc\npjzfcpmeag ecdayth\nsa qcthz\ncbfhfxi qrnbvdryz\nwqel tj\natx smkbid\nef hbcwhouzq cbfhfxi hbcwhouzq mirpsz cbfhfxi cbfhfxi okjenof pjzfcpmeag kdazb", "output": "ef pwt cbfhfxi pwt mirpsz cbfhfxi cbfhfxi qpnyi ecdayth zjs" }, { "input": "1 1\namit am\namit", "output": "am" }, { "input": "1 1\na c\na", "output": "a" } ]

1,638,505,421

2,147,483,647

PyPy 3-64

WRONG_ANSWER

TESTS

0

31

0

n,m=map(int,input().split()) ans=[] dic={} for i in range(m): a,b=map(str,input().split()) if len(a)<len(b): dic[b]= a elif len(a)==len(b): dic[b]=a else: dic[a]=b for word in input().split(): if word in dic: ans+=dic[word] else: ans+=word print(*ans)

Title: Lecture Time Limit: None seconds Memory Limit: None megabytes Problem Description: You have a new professor of graph theory and he speaks very quickly. You come up with the following plan to keep up with his lecture and make notes. You know two languages, and the professor is giving the lecture in the first one. The words in both languages consist of lowercase English characters, each language consists of several words. For each language, all words are distinct, i.e. they are spelled differently. Moreover, the words of these languages have a one-to-one correspondence, that is, for each word in each language, there exists exactly one word in the other language having has the same meaning. You can write down every word the professor says in either the first language or the second language. Of course, during the lecture you write down each word in the language in which the word is shorter. In case of equal lengths of the corresponding words you prefer the word of the first language. You are given the text of the lecture the professor is going to read. Find out how the lecture will be recorded in your notes. Input Specification: The first line contains two integers, *n* and *m* (1<=≤<=*n*<=≤<=3000, 1<=≤<=*m*<=≤<=3000) — the number of words in the professor's lecture and the number of words in each of these languages. The following *m* lines contain the words. The *i*-th line contains two strings *a**i*, *b**i* meaning that the word *a**i* belongs to the first language, the word *b**i* belongs to the second language, and these two words have the same meaning. It is guaranteed that no word occurs in both languages, and each word occurs in its language exactly once. The next line contains *n* space-separated strings *c*1,<=*c*2,<=...,<=*c**n* — the text of the lecture. It is guaranteed that each of the strings *c**i* belongs to the set of strings {*a*1,<=*a*2,<=... *a**m*}. All the strings in the input are non-empty, each consisting of no more than 10 lowercase English letters. Output Specification: Output exactly *n* words: how you will record the lecture in your notebook. Output the words of the lecture in the same order as in the input. Demo Input: ['4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest\n', '5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll\n'] Demo Output: ['codeforces round letter round\n', 'hbnyiyc joll joll un joll\n'] Note: none

```python n,m=map(int,input().split()) ans=[] dic={} for i in range(m): a,b=map(str,input().split()) if len(a)<len(b): dic[b]= a elif len(a)==len(b): dic[b]=a else: dic[a]=b for word in input().split(): if word in dic: ans+=dic[word] else: ans+=word print(*ans) ```

0

496

B

Secret Combination

PROGRAMMING

1,500

[ "brute force", "constructive algorithms", "implementation" ]

null

You got a box with a combination lock. The lock has a display showing *n* digits. There are two buttons on the box, each button changes digits on the display. You have quickly discovered that the first button adds 1 to all the digits (all digits 9 become digits 0), and the second button shifts all the digits on the display one position to the right (the last digit becomes the first one). For example, if the display is currently showing number 579, then if we push the first button, the display will show 680, and if after that we push the second button, the display will show 068. You know that the lock will open if the display is showing the smallest possible number that can be obtained by pushing the buttons in some order. The leading zeros are ignored while comparing numbers. Now your task is to find the desired number.

The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of digits on the display. The second line contains *n* digits — the initial state of the display.

Print a single line containing *n* digits — the desired state of the display containing the smallest possible number.

[ "3\n579\n", "4\n2014\n" ]

[ "024\n", "0142\n" ]

none

1,000

[ { "input": "3\n579", "output": "024" }, { "input": "4\n2014", "output": "0142" }, { "input": "1\n1", "output": "0" }, { "input": "3\n039", "output": "014" }, { "input": "4\n4444", "output": "0000" }, { "input": "5\n46802", "output": "02468" }, { "input": "10\n4447444444", "output": "0000000003" }, { "input": "10\n5810438174", "output": "0147609473" }, { "input": "30\n027027027027027027027027027027", "output": "027027027027027027027027027027" }, { "input": "50\n41012516454101251645410125164541012516454101251645", "output": "01076781720107678172010767817201076781720107678172" }, { "input": "72\n464553044645330446455304464553064645530445455304464553044645530446455304", "output": "001011960020119600201196002011960020119600201996002011960020119620201196" }, { "input": "100\n2144315253572020279108092911160072328496568665545836825277616363478721946398140227406814602154768031", "output": "0005996121738545755443472571416650525236761083528703911639570359104365792010332041424619191680979818" }, { "input": "200\n79025531557298703099245700860027432585447902553155729870309924570086002743258544790255315572987030992457008600274325854479025531557298703099245700860027432585447902553155729870309924570086002743258544", "output": "00274325854479025531557298703099245700860027432585447902553155729870309924570086002743258544790255315572987030992457008600274325854479025531557298703099245700860027432585447902553155729870309924570086" }, { "input": "100\n6669666666666666666866266666666666666666666666666666666666666666626666666666666966666766665667666656", "output": "0000000000000000000000000000000000000000006000000000000030000010000900100009000030000000000000002006" }, { "input": "1\n0", "output": "0" } ]

1,589,122,525

2,147,483,647

PyPy 3

OK

TESTS

28

155

23,347,200

def main(): n = int(input()) s = list(input()) t = list(s) if s[0] != '0': k = ord('0') + 10 - ord(s[0]) for i in range(n): t[i] = chr(ord('0') + (ord(s[i]) - ord('0') + k) % 10) curr = ''.join(t) for i in range(1, n): if s[i] == '0': t = s[i:] + s[:i] curr = min(curr, ''.join(t)) else: k = ord('0') + 10 - ord(s[i]) t = s[i:] + s[:i] for j in range(n): t[j] = chr(ord('0') + (ord(t[j]) - ord('0') + k) % 10) curr = min(curr, ''.join(t)) print(curr) if __name__ == '__main__': main()

Title: Secret Combination Time Limit: None seconds Memory Limit: None megabytes Problem Description: You got a box with a combination lock. The lock has a display showing *n* digits. There are two buttons on the box, each button changes digits on the display. You have quickly discovered that the first button adds 1 to all the digits (all digits 9 become digits 0), and the second button shifts all the digits on the display one position to the right (the last digit becomes the first one). For example, if the display is currently showing number 579, then if we push the first button, the display will show 680, and if after that we push the second button, the display will show 068. You know that the lock will open if the display is showing the smallest possible number that can be obtained by pushing the buttons in some order. The leading zeros are ignored while comparing numbers. Now your task is to find the desired number. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of digits on the display. The second line contains *n* digits — the initial state of the display. Output Specification: Print a single line containing *n* digits — the desired state of the display containing the smallest possible number. Demo Input: ['3\n579\n', '4\n2014\n'] Demo Output: ['024\n', '0142\n'] Note: none

```python def main(): n = int(input()) s = list(input()) t = list(s) if s[0] != '0': k = ord('0') + 10 - ord(s[0]) for i in range(n): t[i] = chr(ord('0') + (ord(s[i]) - ord('0') + k) % 10) curr = ''.join(t) for i in range(1, n): if s[i] == '0': t = s[i:] + s[:i] curr = min(curr, ''.join(t)) else: k = ord('0') + 10 - ord(s[i]) t = s[i:] + s[:i] for j in range(n): t[j] = chr(ord('0') + (ord(t[j]) - ord('0') + k) % 10) curr = min(curr, ''.join(t)) print(curr) if __name__ == '__main__': main() ```

3

248

A

Cupboards

PROGRAMMING

800

[ "implementation" ]

null

One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house. Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find. And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open. Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position. Your task is to write a program that will determine the required number of seconds *t*.

The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero. The numbers in the lines are separated by single spaces.

In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs.

[ "5\n0 1\n1 0\n0 1\n1 1\n0 1\n" ]

[ "3\n" ]

none

500

[ { "input": "5\n0 1\n1 0\n0 1\n1 1\n0 1", "output": "3" }, { "input": "2\n0 0\n0 0", "output": "0" }, { "input": "3\n0 1\n1 1\n1 1", "output": "1" }, { "input": "8\n0 1\n1 0\n0 1\n1 1\n0 1\n1 0\n0 1\n1 0", "output": "7" }, { "input": "8\n1 0\n1 0\n1 0\n0 1\n0 1\n1 1\n1 1\n0 1", "output": "6" }, { "input": "15\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "5\n1 0\n1 0\n1 0\n0 1\n0 1", "output": "4" } ]

1,585,164,602

2,147,483,647

PyPy 3

OK

TESTS

57

528

4,403,200

n = int(input()) l = [] r = [] for i in range(n): a = list(map(int, input().rstrip().split())) l += [a[0]] r += [a[1]] print(min(l.count(0), l.count(1)) + min(r.count(0), r.count(1)))

Title: Cupboards Time Limit: None seconds Memory Limit: None megabytes Problem Description: One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house. Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find. And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open. Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position. Your task is to write a program that will determine the required number of seconds *t*. Input Specification: The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero. The numbers in the lines are separated by single spaces. Output Specification: In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs. Demo Input: ['5\n0 1\n1 0\n0 1\n1 1\n0 1\n'] Demo Output: ['3\n'] Note: none

```python n = int(input()) l = [] r = [] for i in range(n): a = list(map(int, input().rstrip().split())) l += [a[0]] r += [a[1]] print(min(l.count(0), l.count(1)) + min(r.count(0), r.count(1))) ```

3

749

A

Bachgold Problem

PROGRAMMING

800

[ "greedy", "implementation", "math", "number theory" ]

null

Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1. Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*.

The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000).

The first line of the output contains a single integer *k* — maximum possible number of primes in representation. The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.

[ "5\n", "6\n" ]

[ "2\n2 3\n", "3\n2 2 2\n" ]

none

500

[ { "input": "5", "output": "2\n2 3" }, { "input": "6", "output": "3\n2 2 2" }, { "input": "2", "output": "1\n2" }, { "input": "3", "output": "1\n3" }, { "input": "99999", "output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "100000", "output": "50000\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "7", "output": "3\n2 2 3" }, { "input": "4", "output": "2\n2 2" }, { "input": "8", "output": "4\n2 2 2 2" }, { "input": "9", "output": "4\n2 2 2 3" }, { "input": "99995", "output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "99996", "output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "10", "output": "5\n2 2 2 2 2" }, { "input": "11", "output": "5\n2 2 2 2 3" }, { "input": "99997", "output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "99998", "output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "12", "output": "6\n2 2 2 2 2 2" }, { "input": "13", "output": "6\n2 2 2 2 2 3" }, { "input": "99993", "output": "49996\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "99994", "output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "14", "output": "7\n2 2 2 2 2 2 2" }, { "input": "15", "output": "7\n2 2 2 2 2 2 3" }, { "input": "53", "output": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3" }, { "input": "57", "output": "28\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3" }, { "input": "61", "output": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3" }, { "input": "774", "output": "387\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "202", "output": "101\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2" }, { "input": "530", "output": "265\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "7166", "output": "3583\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "9294", "output": "4647\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "2422", "output": "1211\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "15326", "output": "7663\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "11454", "output": "5727\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "14878", "output": "7439\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "90672", "output": "45336\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "99544", "output": "49772\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "90472", "output": "45236\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "23", "output": "11\n2 2 2 2 2 2 2 2 2 2 3" }, { "input": "93", "output": "46\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3" }, { "input": "19", "output": "9\n2 2 2 2 2 2 2 2 3" }, { "input": "11110", "output": "5555\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." } ]

1,689,815,290

2,147,483,647

PyPy 3-64

WRONG_ANSWER

TESTS

1

46

0

n=int(input()) print(n//2) print(2*(n//2-1),2+n%2)

Title: Bachgold Problem Time Limit: None seconds Memory Limit: None megabytes Problem Description: Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1. Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*. Input Specification: The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000). Output Specification: The first line of the output contains a single integer *k* — maximum possible number of primes in representation. The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them. Demo Input: ['5\n', '6\n'] Demo Output: ['2\n2 3\n', '3\n2 2 2\n'] Note: none

```python n=int(input()) print(n//2) print(2*(n//2-1),2+n%2) ```

0

937

A

Olympiad

PROGRAMMING

800

[ "implementation", "sortings" ]

null

The recent All-Berland Olympiad in Informatics featured *n* participants with each scoring a certain amount of points. As the head of the programming committee, you are to determine the set of participants to be awarded with diplomas with respect to the following criteria: - At least one participant should get a diploma. - None of those with score equal to zero should get awarded. - When someone is awarded, all participants with score not less than his score should also be awarded. Determine the number of ways to choose a subset of participants that will receive the diplomas.

The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants. The next line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=600) — participants' scores. It's guaranteed that at least one participant has non-zero score.

Print a single integer — the desired number of ways.

[ "4\n1 3 3 2\n", "3\n1 1 1\n", "4\n42 0 0 42\n" ]

[ "3\n", "1\n", "1\n" ]

There are three ways to choose a subset in sample case one. 1. Only participants with 3 points will get diplomas. 1. Participants with 2 or 3 points will get diplomas. 1. Everyone will get a diploma! The only option in sample case two is to award everyone. Note that in sample case three participants with zero scores cannot get anything.

500

[ { "input": "4\n1 3 3 2", "output": "3" }, { "input": "3\n1 1 1", "output": "1" }, { "input": "4\n42 0 0 42", "output": "1" }, { "input": "10\n1 0 1 0 1 0 0 0 0 1", "output": "1" }, { "input": "10\n572 471 540 163 50 30 561 510 43 200", "output": "10" }, { "input": "100\n122 575 426 445 172 81 247 429 97 202 175 325 382 384 417 356 132 502 328 537 57 339 518 211 479 306 140 168 268 16 140 263 593 249 391 310 555 468 231 180 157 18 334 328 276 155 21 280 322 545 111 267 467 274 291 304 235 34 365 180 21 95 501 552 325 331 302 353 296 22 289 399 7 466 32 302 568 333 75 192 284 10 94 128 154 512 9 480 243 521 551 492 420 197 207 125 367 117 438 600", "output": "94" }, { "input": "100\n600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600", "output": "1" }, { "input": "78\n5 4 13 2 5 6 2 10 10 1 2 6 7 9 6 3 5 7 1 10 2 2 7 0 2 11 11 3 1 13 3 10 6 2 0 3 0 5 0 1 4 11 1 1 7 0 12 7 5 12 0 2 12 9 8 3 4 3 4 11 4 10 2 3 10 12 5 6 1 11 2 0 8 7 9 1 3 12", "output": "13" }, { "input": "34\n220 387 408 343 184 447 197 307 337 414 251 319 426 322 347 242 208 412 188 185 241 235 216 259 331 372 322 284 444 384 214 297 389 391", "output": "33" }, { "input": "100\n1 2 1 0 3 0 2 0 0 1 2 0 1 3 0 3 3 1 3 0 0 2 1 2 2 1 3 3 3 3 3 2 0 0 2 1 2 3 2 3 0 1 1 3 3 2 0 3 1 0 2 2 2 1 2 3 2 1 0 3 0 2 0 3 0 2 1 0 3 1 0 2 2 1 3 1 3 0 2 3 3 1 1 3 1 3 0 3 2 0 2 3 3 0 2 0 2 0 1 3", "output": "3" }, { "input": "100\n572 471 540 163 50 30 561 510 43 200 213 387 500 424 113 487 357 333 294 337 435 202 447 494 485 465 161 344 470 559 104 356 393 207 224 213 511 514 60 386 149 216 392 229 429 173 165 401 395 150 127 579 344 390 529 296 225 425 318 79 465 447 177 110 367 212 459 270 41 500 277 567 125 436 178 9 214 342 203 112 144 24 79 155 495 556 40 549 463 281 241 316 2 246 1 396 510 293 332 55", "output": "93" }, { "input": "99\n5 4 13 2 5 6 2 10 10 1 2 6 7 9 6 3 5 7 1 10 2 2 7 0 2 11 11 3 1 13 3 10 6 2 0 3 0 5 0 1 4 11 1 1 7 0 12 7 5 12 0 2 12 9 8 3 4 3 4 11 4 10 2 3 10 12 5 6 1 11 2 0 8 7 9 1 3 12 2 3 9 3 7 13 7 13 0 11 8 12 2 5 9 4 0 6 6 2 13", "output": "13" }, { "input": "99\n1 0 1 0 1 0 0 0 0 1 0 0 1 1 0 1 1 1 1 0 0 0 1 0 0 1 1 1 1 1 1 0 0 0 0 1 0 1 0 1 0 1 1 1 1 0 0 1 1 0 0 0 0 1 0 1 0 1 0 1 0 0 0 1 0 0 1 0 1 1 0 0 0 1 1 1 1 0 0 1 1 1 1 1 1 1 0 1 0 0 0 1 1 0 0 0 0 0 1", "output": "1" }, { "input": "99\n21 74 25 44 71 80 46 28 96 1 74 24 81 83 16 55 31 1 27 36 56 38 17 10 78 5 39 67 67 15 39 62 92 48 90 9 54 67 30 79 56 17 33 27 75 54 20 79 21 44 10 66 66 73 90 3 34 33 64 79 20 94 0 51 24 30 1 52 95 21 88 98 6 65 31 1 67 32 74 91 83 9 93 27 53 11 8 79 42 20 50 91 19 96 6 24 66 16 37", "output": "61" }, { "input": "2\n0 1", "output": "1" }, { "input": "2\n0 600", "output": "1" }, { "input": "4\n1 1 1 2", "output": "2" }, { "input": "4\n0 0 1 2", "output": "2" }, { "input": "1\n5", "output": "1" }, { "input": "2\n0 5", "output": "1" }, { "input": "5\n1 0 0 1 2", "output": "2" } ]

1,574,197,726

2,147,483,647

Python 3

OK

TESTS

21

109

0

n = int(input()) a = set(input().split()) if '0' in a: print(len(a) - 1) else: print(len(a))

Title: Olympiad Time Limit: None seconds Memory Limit: None megabytes Problem Description: The recent All-Berland Olympiad in Informatics featured *n* participants with each scoring a certain amount of points. As the head of the programming committee, you are to determine the set of participants to be awarded with diplomas with respect to the following criteria: - At least one participant should get a diploma. - None of those with score equal to zero should get awarded. - When someone is awarded, all participants with score not less than his score should also be awarded. Determine the number of ways to choose a subset of participants that will receive the diplomas. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants. The next line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=600) — participants' scores. It's guaranteed that at least one participant has non-zero score. Output Specification: Print a single integer — the desired number of ways. Demo Input: ['4\n1 3 3 2\n', '3\n1 1 1\n', '4\n42 0 0 42\n'] Demo Output: ['3\n', '1\n', '1\n'] Note: There are three ways to choose a subset in sample case one. 1. Only participants with 3 points will get diplomas. 1. Participants with 2 or 3 points will get diplomas. 1. Everyone will get a diploma! The only option in sample case two is to award everyone. Note that in sample case three participants with zero scores cannot get anything.

```python n = int(input()) a = set(input().split()) if '0' in a: print(len(a) - 1) else: print(len(a)) ```

3

452

A

Eevee

PROGRAMMING

1,000

[ "brute force", "implementation", "strings" ]

null

You are solving the crossword problem K from IPSC 2014. You solved all the clues except for one: who does Eevee evolve into? You are not very into pokemons, but quick googling helped you find out, that Eevee can evolve into eight different pokemons: Vaporeon, Jolteon, Flareon, Espeon, Umbreon, Leafeon, Glaceon, and Sylveon. You know the length of the word in the crossword, and you already know some letters. Designers of the crossword made sure that the answer is unambiguous, so you can assume that exactly one pokemon out of the 8 that Eevee evolves into fits the length and the letters given. Your task is to find it.

First line contains an integer *n* (6<=≤<=*n*<=≤<=8) – the length of the string. Next line contains a string consisting of *n* characters, each of which is either a lower case english letter (indicating a known letter) or a dot character (indicating an empty cell in the crossword).

Print a name of the pokemon that Eevee can evolve into that matches the pattern in the input. Use lower case letters only to print the name (in particular, do not capitalize the first letter).

[ "7\nj......\n", "7\n...feon\n", "7\n.l.r.o.\n" ]

[ "jolteon\n", "leafeon\n", "flareon\n" ]

Here's a set of names in a form you can paste into your solution: ["vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"] {"vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"}

500

[ { "input": "7\n...feon", "output": "leafeon" }, { "input": "7\n.l.r.o.", "output": "flareon" }, { "input": "6\n.s..o.", "output": "espeon" }, { "input": "7\nglaceon", "output": "glaceon" }, { "input": "8\n.a.o.e.n", "output": "vaporeon" }, { "input": "7\n.laceon", "output": "glaceon" }, { "input": "7\n..lveon", "output": "sylveon" }, { "input": "7\n.l.ceon", "output": "glaceon" }, { "input": "7\n..areon", "output": "flareon" } ]

1,406,480,714

314

Python 3

OK

TESTS

20

62

0

n=int(input()) s=input().strip() a=['vaporeon', 'jolteon', 'flareon', 'espeon', 'umbreon', 'leafeon', 'glaceon','sylveon'] for k in a: b=True if n==len(k): for i in range(n): if s[i]!='.' and s[i]!=k[i]: b=False if b: print(k) exit()

Title: Eevee Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are solving the crossword problem K from IPSC 2014. You solved all the clues except for one: who does Eevee evolve into? You are not very into pokemons, but quick googling helped you find out, that Eevee can evolve into eight different pokemons: Vaporeon, Jolteon, Flareon, Espeon, Umbreon, Leafeon, Glaceon, and Sylveon. You know the length of the word in the crossword, and you already know some letters. Designers of the crossword made sure that the answer is unambiguous, so you can assume that exactly one pokemon out of the 8 that Eevee evolves into fits the length and the letters given. Your task is to find it. Input Specification: First line contains an integer *n* (6<=≤<=*n*<=≤<=8) – the length of the string. Next line contains a string consisting of *n* characters, each of which is either a lower case english letter (indicating a known letter) or a dot character (indicating an empty cell in the crossword). Output Specification: Print a name of the pokemon that Eevee can evolve into that matches the pattern in the input. Use lower case letters only to print the name (in particular, do not capitalize the first letter). Demo Input: ['7\nj......\n', '7\n...feon\n', '7\n.l.r.o.\n'] Demo Output: ['jolteon\n', 'leafeon\n', 'flareon\n'] Note: Here's a set of names in a form you can paste into your solution: ["vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"] {"vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"}

```python n=int(input()) s=input().strip() a=['vaporeon', 'jolteon', 'flareon', 'espeon', 'umbreon', 'leafeon', 'glaceon','sylveon'] for k in a: b=True if n==len(k): for i in range(n): if s[i]!='.' and s[i]!=k[i]: b=False if b: print(k) exit() ```

3

0

none

0

[ "none" ]

null

Little Nastya has a hobby, she likes to remove some letters from word, to obtain another word. But it turns out to be pretty hard for her, because she is too young. Therefore, her brother Sergey always helps her. Sergey gives Nastya the word *t* and wants to get the word *p* out of it. Nastya removes letters in a certain order (one after another, in this order strictly), which is specified by permutation of letters' indices of the word *t*: *a*1... *a*|*t*|. We denote the length of word *x* as |*x*|. Note that after removing one letter, the indices of other letters don't change. For example, if *t*<==<="nastya" and *a*<==<=[4,<=1,<=5,<=3,<=2,<=6] then removals make the following sequence of words "nastya" "nastya" "nastya" "nastya" "nastya" "nastya" "nastya". Sergey knows this permutation. His goal is to stop his sister at some point and continue removing by himself to get the word *p*. Since Nastya likes this activity, Sergey wants to stop her as late as possible. Your task is to determine, how many letters Nastya can remove before she will be stopped by Sergey. It is guaranteed that the word *p* can be obtained by removing the letters from word *t*.

The first and second lines of the input contain the words *t* and *p*, respectively. Words are composed of lowercase letters of the Latin alphabet (1<=≤<=|*p*|<=<<=|*t*|<=≤<=200<=000). It is guaranteed that the word *p* can be obtained by removing the letters from word *t*. Next line contains a permutation *a*1,<=*a*2,<=...,<=*a*|*t*| of letter indices that specifies the order in which Nastya removes letters of *t* (1<=≤<=*a**i*<=≤<=|*t*|, all *a**i* are distinct).

Print a single integer number, the maximum number of letters that Nastya can remove.

[ "ababcba\nabb\n5 3 4 1 7 6 2\n", "bbbabb\nbb\n1 6 3 4 2 5\n" ]

[ "3", "4" ]

In the first sample test sequence of removing made by Nastya looks like this: "ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba" Nastya can not continue, because it is impossible to get word "abb" from word "ababcba". So, Nastya will remove only three letters.

0

[ { "input": "ababcba\nabb\n5 3 4 1 7 6 2", "output": "3" }, { "input": "bbbabb\nbb\n1 6 3 4 2 5", "output": "4" }, { "input": "cacaccccccacccc\ncacc\n10 9 14 5 1 7 15 3 6 12 4 8 11 13 2", "output": "9" }, { "input": "aaaabaaabaabaaaaaaaa\naaaa\n18 5 4 6 13 9 1 3 7 8 16 10 12 19 17 15 14 11 20 2", "output": "16" }, { "input": "aaaaaaaadbaaabbbbbddaaabdadbbbbbdbbabbbabaabdbbdababbbddddbdaabbddbbbbabbbbbabadaadabaaaadbbabbbaddb\naaaaaaaaaaaaaa\n61 52 5 43 53 81 7 96 6 9 34 78 79 12 8 63 22 76 18 46 41 56 3 20 57 21 75 73 100 94 35 69 32 4 70 95 88 44 68 10 71 98 23 89 36 62 28 51 24 30 74 55 27 80 38 48 93 1 19 84 13 11 86 60 87 33 39 29 83 91 67 72 54 2 17 85 82 14 15 90 64 50 99 26 66 65 31 49 40 45 77 37 25 42 97 47 58 92 59 16", "output": "57" } ]

1,610,931,687

2,147,483,647

PyPy 3

TIME_LIMIT_EXCEEDED

TESTS

9

2,000

14,848,000

t = list(input()) p = input() a = input().split(" ") pi = 200001 def StringCrap(t, p, a): for i in a: index = 0 t[int(i) - 1] = " " for o in range(pi if pi <= 200000 else 0, len(t)): if index == len(p): break if t[o] == p[index]: index += 1 if index != len(p): return a.index(i) print(StringCrap(t, p, a))

Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Nastya has a hobby, she likes to remove some letters from word, to obtain another word. But it turns out to be pretty hard for her, because she is too young. Therefore, her brother Sergey always helps her. Sergey gives Nastya the word *t* and wants to get the word *p* out of it. Nastya removes letters in a certain order (one after another, in this order strictly), which is specified by permutation of letters' indices of the word *t*: *a*1... *a*|*t*|. We denote the length of word *x* as |*x*|. Note that after removing one letter, the indices of other letters don't change. For example, if *t*<==<="nastya" and *a*<==<=[4,<=1,<=5,<=3,<=2,<=6] then removals make the following sequence of words "nastya" "nastya" "nastya" "nastya" "nastya" "nastya" "nastya". Sergey knows this permutation. His goal is to stop his sister at some point and continue removing by himself to get the word *p*. Since Nastya likes this activity, Sergey wants to stop her as late as possible. Your task is to determine, how many letters Nastya can remove before she will be stopped by Sergey. It is guaranteed that the word *p* can be obtained by removing the letters from word *t*. Input Specification: The first and second lines of the input contain the words *t* and *p*, respectively. Words are composed of lowercase letters of the Latin alphabet (1<=≤<=|*p*|<=<<=|*t*|<=≤<=200<=000). It is guaranteed that the word *p* can be obtained by removing the letters from word *t*. Next line contains a permutation *a*1,<=*a*2,<=...,<=*a*|*t*| of letter indices that specifies the order in which Nastya removes letters of *t* (1<=≤<=*a**i*<=≤<=|*t*|, all *a**i* are distinct). Output Specification: Print a single integer number, the maximum number of letters that Nastya can remove. Demo Input: ['ababcba\nabb\n5 3 4 1 7 6 2\n', 'bbbabb\nbb\n1 6 3 4 2 5\n'] Demo Output: ['3', '4'] Note: In the first sample test sequence of removing made by Nastya looks like this: "ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba" Nastya can not continue, because it is impossible to get word "abb" from word "ababcba". So, Nastya will remove only three letters.

```python t = list(input()) p = input() a = input().split(" ") pi = 200001 def StringCrap(t, p, a): for i in a: index = 0 t[int(i) - 1] = " " for o in range(pi if pi <= 200000 else 0, len(t)): if index == len(p): break if t[o] == p[index]: index += 1 if index != len(p): return a.index(i) print(StringCrap(t, p, a)) ```

0

984

A

Game

PROGRAMMING

800

[ "sortings" ]

null

Two players play a game. Initially there are $n$ integers $a_1, a_2, \ldots, a_n$ written on the board. Each turn a player selects one number and erases it from the board. This continues until there is only one number left on the board, i. e. $n - 1$ turns are made. The first player makes the first move, then players alternate turns. The first player wants to minimize the last number that would be left on the board, while the second player wants to maximize it. You want to know what number will be left on the board after $n - 1$ turns if both players make optimal moves.

The first line contains one integer $n$ ($1 \le n \le 1000$) — the number of numbers on the board. The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \le a_i \le 10^6$).

Print one number that will be left on the board.

[ "3\n2 1 3\n", "3\n2 2 2\n" ]

[ "2", "2" ]

In the first sample, the first player erases $3$ and the second erases $1$. $2$ is left on the board. In the second sample, $2$ is left on the board regardless of the actions of the players.

500

[ { "input": "3\n2 1 3", "output": "2" }, { "input": "3\n2 2 2", "output": "2" }, { "input": "9\n44 53 51 80 5 27 74 79 94", "output": "53" }, { "input": "10\n38 82 23 37 96 4 81 60 67 86", "output": "60" }, { "input": "10\n58 26 77 15 53 81 68 48 22 65", "output": "53" }, { "input": "1\n124", "output": "124" }, { "input": "2\n2 1", "output": "1" }, { "input": "3\n1 1 1000", "output": "1" }, { "input": "2\n322 322", "output": "322" }, { "input": "3\n9 92 12", "output": "12" }, { "input": "3\n1 2 2", "output": "2" } ]

1,694,012,694

2,147,483,647

Python 3

COMPILATION_ERROR

TESTS

0

n=input() n=int(n) arr=list(map(int,input().strip().split())) arr2 = sorted(arr) if (n%2==0): print(arr2[n//2]) else : print(arr2{n//2])

Title: Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Two players play a game. Initially there are $n$ integers $a_1, a_2, \ldots, a_n$ written on the board. Each turn a player selects one number and erases it from the board. This continues until there is only one number left on the board, i. e. $n - 1$ turns are made. The first player makes the first move, then players alternate turns. The first player wants to minimize the last number that would be left on the board, while the second player wants to maximize it. You want to know what number will be left on the board after $n - 1$ turns if both players make optimal moves. Input Specification: The first line contains one integer $n$ ($1 \le n \le 1000$) — the number of numbers on the board. The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \le a_i \le 10^6$). Output Specification: Print one number that will be left on the board. Demo Input: ['3\n2 1 3\n', '3\n2 2 2\n'] Demo Output: ['2', '2'] Note: In the first sample, the first player erases $3$ and the second erases $1$. $2$ is left on the board. In the second sample, $2$ is left on the board regardless of the actions of the players.

```python n=input() n=int(n) arr=list(map(int,input().strip().split())) arr2 = sorted(arr) if (n%2==0): print(arr2[n//2]) else : print(arr2{n//2]) ```

-1

41

A

Translation

PROGRAMMING

800

[ "implementation", "strings" ]

A. Translation

2

256

The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.

The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.

If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.

[ "code\nedoc\n", "abb\naba\n", "code\ncode\n" ]

[ "YES\n", "NO\n", "NO\n" ]

none

500

[ { "input": "code\nedoc", "output": "YES" }, { "input": "abb\naba", "output": "NO" }, { "input": "code\ncode", "output": "NO" }, { "input": "abacaba\nabacaba", "output": "YES" }, { "input": "q\nq", "output": "YES" }, { "input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk", "output": "NO" }, { "input": "z\na", "output": "NO" }, { "input": "asd\ndsa", "output": "YES" }, { "input": "abcdef\nfecdba", "output": "NO" }, { "input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu", "output": "NO" }, { "input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf", "output": "NO" }, { "input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp", "output": "NO" }, { "input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb", "output": "NO" }, { "input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom", "output": "NO" }, { "input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh", "output": "NO" }, { "input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy", "output": "NO" }, { "input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko", "output": "NO" }, { "input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv", "output": "NO" }, { "input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd", "output": "NO" }, { "input": "w\nw", "output": "YES" }, { "input": "vz\nzv", "output": "YES" }, { "input": "ry\nyr", "output": "YES" }, { "input": "xou\nuox", "output": "YES" }, { "input": "axg\ngax", "output": "NO" }, { "input": "zdsl\nlsdz", "output": "YES" }, { "input": "kudl\nldku", "output": "NO" }, { "input": "zzlzwnqlcl\nlclqnwzlzz", "output": "YES" }, { "input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv", "output": "YES" }, { "input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar", "output": "NO" }, { "input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn", "output": "YES" }, { "input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum", "output": "YES" }, { "input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv", "output": "YES" }, { "input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm", "output": "NO" }, { "input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd", "output": "NO" }, { "input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg", "output": "YES" }, { "input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis", "output": "YES" }, { "input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy", "output": "NO" }, { "input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw", "output": "YES" }, { "input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi", "output": "YES" }, { "input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib", "output": "YES" } ]

1,693,655,311

2,147,483,647

Python 3

WRONG_ANSWER

TESTS

2

92

0

x = str(input()) z = str(input()) v=0 c=0 for i in range(len(x)): c += ord(x[i]) v += ord(z[-i]) if c==v: print('YES') else: print('NO')

Title: Translation Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. Input Specification: The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. Output Specification: If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. Demo Input: ['code\nedoc\n', 'abb\naba\n', 'code\ncode\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none

```python x = str(input()) z = str(input()) v=0 c=0 for i in range(len(x)): c += ord(x[i]) v += ord(z[-i]) if c==v: print('YES') else: print('NO') ```

0

285

A

Slightly Decreasing Permutations

PROGRAMMING

1,100

[ "greedy", "implementation" ]

null

Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*. The decreasing coefficient of permutation *p*1,<=*p*2,<=...,<=*p**n* is the number of such *i* (1<=≤<=*i*<=<<=*n*), that *p**i*<=><=*p**i*<=+<=1. You have numbers *n* and *k*. Your task is to print the permutation of length *n* with decreasing coefficient *k*.

The single line contains two space-separated integers: *n*,<=*k* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*k*<=<<=*n*) — the permutation length and the decreasing coefficient.

In a single line print *n* space-separated integers: *p*1,<=*p*2,<=...,<=*p**n* — the permutation of length *n* with decreasing coefficient *k*. If there are several permutations that meet this condition, print any of them. It is guaranteed that the permutation with the sought parameters exists.

[ "5 2\n", "3 0\n", "3 2\n" ]

[ "1 5 2 4 3\n", "1 2 3\n", "3 2 1\n" ]

none

500

[ { "input": "5 2", "output": "1 5 2 4 3" }, { "input": "3 0", "output": "1 2 3" }, { "input": "3 2", "output": "3 2 1" }, { "input": "1 0", "output": "1" }, { "input": "2 0", "output": "1 2" }, { "input": "2 1", "output": "2 1" }, { "input": "10 4", "output": "10 9 8 7 1 2 3 4 5 6" }, { "input": "56893 5084", "output": "56893 56892 56891 56890 56889 56888 56887 56886 56885 56884 56883 56882 56881 56880 56879 56878 56877 56876 56875 56874 56873 56872 56871 56870 56869 56868 56867 56866 56865 56864 56863 56862 56861 56860 56859 56858 56857 56856 56855 56854 56853 56852 56851 56850 56849 56848 56847 56846 56845 56844 56843 56842 56841 56840 56839 56838 56837 56836 56835 56834 56833 56832 56831 56830 56829 56828 56827 56826 56825 56824 56823 56822 56821 56820 56819 56818 56817 56816 56815 56814 56813 56812 56811 56810 56809 5..." }, { "input": "6 3", "output": "6 5 4 1 2 3" }, { "input": "1 0", "output": "1" }, { "input": "310 186", "output": "310 309 308 307 306 305 304 303 302 301 300 299 298 297 296 295 294 293 292 291 290 289 288 287 286 285 284 283 282 281 280 279 278 277 276 275 274 273 272 271 270 269 268 267 266 265 264 263 262 261 260 259 258 257 256 255 254 253 252 251 250 249 248 247 246 245 244 243 242 241 240 239 238 237 236 235 234 233 232 231 230 229 228 227 226 225 224 223 222 221 220 219 218 217 216 215 214 213 212 211 210 209 208 207 206 205 204 203 202 201 200 199 198 197 196 195 194 193 192 191 190 189 188 187 186 185 184 183..." }, { "input": "726 450", "output": "726 725 724 723 722 721 720 719 718 717 716 715 714 713 712 711 710 709 708 707 706 705 704 703 702 701 700 699 698 697 696 695 694 693 692 691 690 689 688 687 686 685 684 683 682 681 680 679 678 677 676 675 674 673 672 671 670 669 668 667 666 665 664 663 662 661 660 659 658 657 656 655 654 653 652 651 650 649 648 647 646 645 644 643 642 641 640 639 638 637 636 635 634 633 632 631 630 629 628 627 626 625 624 623 622 621 620 619 618 617 616 615 614 613 612 611 610 609 608 607 606 605 604 603 602 601 600 599..." }, { "input": "438 418", "output": "438 437 436 435 434 433 432 431 430 429 428 427 426 425 424 423 422 421 420 419 418 417 416 415 414 413 412 411 410 409 408 407 406 405 404 403 402 401 400 399 398 397 396 395 394 393 392 391 390 389 388 387 386 385 384 383 382 381 380 379 378 377 376 375 374 373 372 371 370 369 368 367 366 365 364 363 362 361 360 359 358 357 356 355 354 353 352 351 350 349 348 347 346 345 344 343 342 341 340 339 338 337 336 335 334 333 332 331 330 329 328 327 326 325 324 323 322 321 320 319 318 317 316 315 314 313 312 311..." }, { "input": "854 829", "output": "854 853 852 851 850 849 848 847 846 845 844 843 842 841 840 839 838 837 836 835 834 833 832 831 830 829 828 827 826 825 824 823 822 821 820 819 818 817 816 815 814 813 812 811 810 809 808 807 806 805 804 803 802 801 800 799 798 797 796 795 794 793 792 791 790 789 788 787 786 785 784 783 782 781 780 779 778 777 776 775 774 773 772 771 770 769 768 767 766 765 764 763 762 761 760 759 758 757 756 755 754 753 752 751 750 749 748 747 746 745 744 743 742 741 740 739 738 737 736 735 734 733 732 731 730 729 728 727..." }, { "input": "214 167", "output": "214 213 212 211 210 209 208 207 206 205 204 203 202 201 200 199 198 197 196 195 194 193 192 191 190 189 188 187 186 185 184 183 182 181 180 179 178 177 176 175 174 173 172 171 170 169 168 167 166 165 164 163 162 161 160 159 158 157 156 155 154 153 152 151 150 149 148 147 146 145 144 143 142 141 140 139 138 137 136 135 134 133 132 131 130 129 128 127 126 125 124 123 122 121 120 119 118 117 116 115 114 113 112 111 110 109 108 107 106 105 104 103 102 101 100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 ..." }, { "input": "85705 56268", "output": "85705 85704 85703 85702 85701 85700 85699 85698 85697 85696 85695 85694 85693 85692 85691 85690 85689 85688 85687 85686 85685 85684 85683 85682 85681 85680 85679 85678 85677 85676 85675 85674 85673 85672 85671 85670 85669 85668 85667 85666 85665 85664 85663 85662 85661 85660 85659 85658 85657 85656 85655 85654 85653 85652 85651 85650 85649 85648 85647 85646 85645 85644 85643 85642 85641 85640 85639 85638 85637 85636 85635 85634 85633 85632 85631 85630 85629 85628 85627 85626 85625 85624 85623 85622 85621 8..." }, { "input": "11417 4583", "output": "11417 11416 11415 11414 11413 11412 11411 11410 11409 11408 11407 11406 11405 11404 11403 11402 11401 11400 11399 11398 11397 11396 11395 11394 11393 11392 11391 11390 11389 11388 11387 11386 11385 11384 11383 11382 11381 11380 11379 11378 11377 11376 11375 11374 11373 11372 11371 11370 11369 11368 11367 11366 11365 11364 11363 11362 11361 11360 11359 11358 11357 11356 11355 11354 11353 11352 11351 11350 11349 11348 11347 11346 11345 11344 11343 11342 11341 11340 11339 11338 11337 11336 11335 11334 11333 1..." }, { "input": "53481 20593", "output": "53481 53480 53479 53478 53477 53476 53475 53474 53473 53472 53471 53470 53469 53468 53467 53466 53465 53464 53463 53462 53461 53460 53459 53458 53457 53456 53455 53454 53453 53452 53451 53450 53449 53448 53447 53446 53445 53444 53443 53442 53441 53440 53439 53438 53437 53436 53435 53434 53433 53432 53431 53430 53429 53428 53427 53426 53425 53424 53423 53422 53421 53420 53419 53418 53417 53416 53415 53414 53413 53412 53411 53410 53409 53408 53407 53406 53405 53404 53403 53402 53401 53400 53399 53398 53397 5..." }, { "input": "79193 77281", "output": "79193 79192 79191 79190 79189 79188 79187 79186 79185 79184 79183 79182 79181 79180 79179 79178 79177 79176 79175 79174 79173 79172 79171 79170 79169 79168 79167 79166 79165 79164 79163 79162 79161 79160 79159 79158 79157 79156 79155 79154 79153 79152 79151 79150 79149 79148 79147 79146 79145 79144 79143 79142 79141 79140 79139 79138 79137 79136 79135 79134 79133 79132 79131 79130 79129 79128 79127 79126 79125 79124 79123 79122 79121 79120 79119 79118 79117 79116 79115 79114 79113 79112 79111 79110 79109 7..." }, { "input": "42607 42144", "output": "42607 42606 42605 42604 42603 42602 42601 42600 42599 42598 42597 42596 42595 42594 42593 42592 42591 42590 42589 42588 42587 42586 42585 42584 42583 42582 42581 42580 42579 42578 42577 42576 42575 42574 42573 42572 42571 42570 42569 42568 42567 42566 42565 42564 42563 42562 42561 42560 42559 42558 42557 42556 42555 42554 42553 42552 42551 42550 42549 42548 42547 42546 42545 42544 42543 42542 42541 42540 42539 42538 42537 42536 42535 42534 42533 42532 42531 42530 42529 42528 42527 42526 42525 42524 42523 4..." }, { "input": "100000 0", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "100000 99999", "output": "100000 99999 99998 99997 99996 99995 99994 99993 99992 99991 99990 99989 99988 99987 99986 99985 99984 99983 99982 99981 99980 99979 99978 99977 99976 99975 99974 99973 99972 99971 99970 99969 99968 99967 99966 99965 99964 99963 99962 99961 99960 99959 99958 99957 99956 99955 99954 99953 99952 99951 99950 99949 99948 99947 99946 99945 99944 99943 99942 99941 99940 99939 99938 99937 99936 99935 99934 99933 99932 99931 99930 99929 99928 99927 99926 99925 99924 99923 99922 99921 99920 99919 99918 99917 99916 ..." }, { "input": "100000 53860", "output": "100000 99999 99998 99997 99996 99995 99994 99993 99992 99991 99990 99989 99988 99987 99986 99985 99984 99983 99982 99981 99980 99979 99978 99977 99976 99975 99974 99973 99972 99971 99970 99969 99968 99967 99966 99965 99964 99963 99962 99961 99960 99959 99958 99957 99956 99955 99954 99953 99952 99951 99950 99949 99948 99947 99946 99945 99944 99943 99942 99941 99940 99939 99938 99937 99936 99935 99934 99933 99932 99931 99930 99929 99928 99927 99926 99925 99924 99923 99922 99921 99920 99919 99918 99917 99916 ..." }, { "input": "4 0", "output": "1 2 3 4" }, { "input": "4 1", "output": "4 1 2 3" }, { "input": "4 2", "output": "4 3 1 2" }, { "input": "4 3", "output": "4 3 2 1" }, { "input": "3 1", "output": "3 1 2" } ]

1,565,184,200

2,147,483,647

PyPy 3

OK

TESTS

28

342

8,396,800

class CodeforcesTask285ASolution: def __init__(self): self.result = '' self.n_k = [] def read_input(self): self.n_k = [int(x) for x in input().split(" ")] def process_task(self): inc = [x for x in range(1, self.n_k[0] - self.n_k[1])] dc = [x for x in range(self.n_k[0] - self.n_k[1], self.n_k[0] + 1)][::-1] self.result = " ".join([str(x) for x in inc + dc]) def get_result(self): return self.result if __name__ == "__main__": Solution = CodeforcesTask285ASolution() Solution.read_input() Solution.process_task() print(Solution.get_result())

Title: Slightly Decreasing Permutations Time Limit: None seconds Memory Limit: None megabytes Problem Description: Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*. The decreasing coefficient of permutation *p*1,<=*p*2,<=...,<=*p**n* is the number of such *i* (1<=≤<=*i*<=<<=*n*), that *p**i*<=><=*p**i*<=+<=1. You have numbers *n* and *k*. Your task is to print the permutation of length *n* with decreasing coefficient *k*. Input Specification: The single line contains two space-separated integers: *n*,<=*k* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*k*<=<<=*n*) — the permutation length and the decreasing coefficient. Output Specification: In a single line print *n* space-separated integers: *p*1,<=*p*2,<=...,<=*p**n* — the permutation of length *n* with decreasing coefficient *k*. If there are several permutations that meet this condition, print any of them. It is guaranteed that the permutation with the sought parameters exists. Demo Input: ['5 2\n', '3 0\n', '3 2\n'] Demo Output: ['1 5 2 4 3\n', '1 2 3\n', '3 2 1\n'] Note: none

```python class CodeforcesTask285ASolution: def __init__(self): self.result = '' self.n_k = [] def read_input(self): self.n_k = [int(x) for x in input().split(" ")] def process_task(self): inc = [x for x in range(1, self.n_k[0] - self.n_k[1])] dc = [x for x in range(self.n_k[0] - self.n_k[1], self.n_k[0] + 1)][::-1] self.result = " ".join([str(x) for x in inc + dc]) def get_result(self): return self.result if __name__ == "__main__": Solution = CodeforcesTask285ASolution() Solution.read_input() Solution.process_task() print(Solution.get_result()) ```

3

559

B

Equivalent Strings

PROGRAMMING

1,700

[ "divide and conquer", "hashing", "sortings", "strings" ]

null

Today on a lecture about strings Gerald learned a new definition of string equivalency. Two strings *a* and *b* of equal length are called equivalent in one of the two cases: 1. They are equal. 1. If we split string *a* into two halves of the same size *a*1 and *a*2, and string *b* into two halves of the same size *b*1 and *b*2, then one of the following is correct: *a*1 is equivalent to *b*1, and *a*2 is equivalent to *b*2 1. *a*1 is equivalent to *b*2, and *a*2 is equivalent to *b*1 As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent. Gerald has already completed this home task. Now it's your turn!

The first two lines of the input contain two strings given by the teacher. Each of them has the length from 1 to 200<=000 and consists of lowercase English letters. The strings have the same length.

Print "YES" (without the quotes), if these two strings are equivalent, and "NO" (without the quotes) otherwise.

[ "aaba\nabaa\n", "aabb\nabab\n" ]

[ "YES\n", "NO\n" ]

In the first sample you should split the first string into strings "aa" and "ba", the second one — into strings "ab" and "aa". "aa" is equivalent to "aa"; "ab" is equivalent to "ba" as "ab" = "a" + "b", "ba" = "b" + "a". In the second sample the first string can be splitted into strings "aa" and "bb", that are equivalent only to themselves. That's why string "aabb" is equivalent only to itself and to string "bbaa".

1,000

[ { "input": "aaba\nabaa", "output": "YES" }, { "input": "aabb\nabab", "output": "NO" }, { "input": "a\na", "output": "YES" }, { "input": "a\nb", "output": "NO" }, { "input": "ab\nab", "output": "YES" }, { "input": "ab\nba", "output": "YES" }, { "input": "ab\nbb", "output": "NO" }, { "input": "zzaa\naazz", "output": "YES" }, { "input": "azza\nzaaz", "output": "YES" }, { "input": "abc\nabc", "output": "YES" }, { "input": "abc\nacb", "output": "NO" }, { "input": "azzz\nzzaz", "output": "YES" }, { "input": "abcd\ndcab", "output": "YES" }, { "input": "abcd\ncdab", "output": "YES" }, { "input": "abcd\ndcba", "output": "YES" }, { "input": "abcd\nacbd", "output": "NO" }, { "input": "oloaxgddgujq\noloaxgujqddg", "output": "YES" }, { "input": "uwzwdxfmosmqatyv\ndxfmzwwusomqvyta", "output": "YES" }, { "input": "hagnzomowtledfdotnll\nledfdotnllomowthagnz", "output": "YES" }, { "input": "snyaydaeobufdg\nsnyaydaeobufdg", "output": "YES" }, { "input": "baaaaa\nabaaaa", "output": "NO" }, { "input": "hhiisug\nmzdjwju", "output": "NO" }, { "input": "bbbabbabaaab\naaaabbabbbbb", "output": "NO" }, { "input": "bbaaab\naababb", "output": "NO" }, { "input": "aabbaaaa\naaaaabab", "output": "NO" }, { "input": "aab\naba", "output": "NO" }, { "input": "abcddd\nbacddd", "output": "NO" }, { "input": "qgiufelsfhanx\naaaaaaaaaaaaa", "output": "NO" }, { "input": "aabaababaaba\naababaaababa", "output": "NO" }, { "input": "nocdqzdriyyil\naaaaaaaaaaaaa", "output": "NO" }, { "input": "zdmctxl\nkojqhgw", "output": "NO" }, { "input": "yhwepqwyhwepqwyhwepqweahnqtueahnqtueahnqtuyhwepqwyhwepqwyhwepqwyhwepqweahnqtueahnqtuyhwepqweahnqtueahnqtueahnqtueahnqtueahnqtueahnqtu\neahnqtueahnqtueahnqtuyhwepqweahnqtuyhwepqwyhwepqweahnqtuyhwepqweahnqtuyhwepqweahnqtueahnqtuyhwepqweahnqtueahnqtuyhwepqwyhwepqwyhwepqw", "output": "NO" }, { "input": "abc\nbac", "output": "NO" }, { "input": "ottceez\npcstdvz", "output": "NO" } ]

1,602,150,430

2,147,483,647

Python 3

TIME_LIMIT_EXCEEDED

TESTS

88

2,000

1,331,200

def checkEqual(stringA, stringB): if stringA == stringB: return True if len(stringA) != len(stringB): return False if len(stringA) % 2 == 1: return False length = int(len(stringA)) return (checkEqual(stringA[:int(length/2)], stringB[:int(length/2)]) and checkEqual(stringA[int(length/2):], stringB[int(length/2):])) \ or (checkEqual(stringA[:int(length/2)], stringB[int(length/2):]) and checkEqual(stringA[int(length/2):], stringB[:int(length/2)])) stringA = input() stringB = input() if checkEqual(stringA, stringB): print("YES") else: print("NO")

Title: Equivalent Strings Time Limit: None seconds Memory Limit: None megabytes Problem Description: Today on a lecture about strings Gerald learned a new definition of string equivalency. Two strings *a* and *b* of equal length are called equivalent in one of the two cases: 1. They are equal. 1. If we split string *a* into two halves of the same size *a*1 and *a*2, and string *b* into two halves of the same size *b*1 and *b*2, then one of the following is correct: *a*1 is equivalent to *b*1, and *a*2 is equivalent to *b*2 1. *a*1 is equivalent to *b*2, and *a*2 is equivalent to *b*1 As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent. Gerald has already completed this home task. Now it's your turn! Input Specification: The first two lines of the input contain two strings given by the teacher. Each of them has the length from 1 to 200<=000 and consists of lowercase English letters. The strings have the same length. Output Specification: Print "YES" (without the quotes), if these two strings are equivalent, and "NO" (without the quotes) otherwise. Demo Input: ['aaba\nabaa\n', 'aabb\nabab\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample you should split the first string into strings "aa" and "ba", the second one — into strings "ab" and "aa". "aa" is equivalent to "aa"; "ab" is equivalent to "ba" as "ab" = "a" + "b", "ba" = "b" + "a". In the second sample the first string can be splitted into strings "aa" and "bb", that are equivalent only to themselves. That's why string "aabb" is equivalent only to itself and to string "bbaa".

```python def checkEqual(stringA, stringB): if stringA == stringB: return True if len(stringA) != len(stringB): return False if len(stringA) % 2 == 1: return False length = int(len(stringA)) return (checkEqual(stringA[:int(length/2)], stringB[:int(length/2)]) and checkEqual(stringA[int(length/2):], stringB[int(length/2):])) \ or (checkEqual(stringA[:int(length/2)], stringB[int(length/2):]) and checkEqual(stringA[int(length/2):], stringB[:int(length/2)])) stringA = input() stringB = input() if checkEqual(stringA, stringB): print("YES") else: print("NO") ```

0

515

A

Drazil and Date

PROGRAMMING

1,000

[ "math" ]

null

Someday, Drazil wanted to go on date with Varda. Drazil and Varda live on Cartesian plane. Drazil's home is located in point (0,<=0) and Varda's home is located in point (*a*,<=*b*). In each step, he can move in a unit distance in horizontal or vertical direction. In other words, from position (*x*,<=*y*) he can go to positions (*x*<=+<=1,<=*y*), (*x*<=-<=1,<=*y*), (*x*,<=*y*<=+<=1) or (*x*,<=*y*<=-<=1). Unfortunately, Drazil doesn't have sense of direction. So he randomly chooses the direction he will go to in each step. He may accidentally return back to his house during his travel. Drazil may even not notice that he has arrived to (*a*,<=*b*) and continue travelling. Luckily, Drazil arrived to the position (*a*,<=*b*) successfully. Drazil said to Varda: "It took me exactly *s* steps to travel from my house to yours". But Varda is confused about his words, she is not sure that it is possible to get from (0,<=0) to (*a*,<=*b*) in exactly *s* steps. Can you find out if it is possible for Varda?

You are given three integers *a*, *b*, and *s* (<=-<=109<=≤<=*a*,<=*b*<=≤<=109, 1<=≤<=*s*<=≤<=2·109) in a single line.

If you think Drazil made a mistake and it is impossible to take exactly *s* steps and get from his home to Varda's home, print "No" (without quotes). Otherwise, print "Yes".

[ "5 5 11\n", "10 15 25\n", "0 5 1\n", "0 0 2\n" ]

[ "No\n", "Yes\n", "No\n", "Yes\n" ]

In fourth sample case one possible route is: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/0d30660ddf6eb6c64ffd071055a4e8ddd016cde5.png" style="max-width: 100.0%;max-height: 100.0%;"/>.

500

[ { "input": "5 5 11", "output": "No" }, { "input": "10 15 25", "output": "Yes" }, { "input": "0 5 1", "output": "No" }, { "input": "0 0 2", "output": "Yes" }, { "input": "999999999 999999999 2000000000", "output": "Yes" }, { "input": "-606037695 998320124 820674098", "output": "No" }, { "input": "948253616 -83299062 1031552680", "output": "Yes" }, { "input": "711980199 216568284 928548487", "output": "Yes" }, { "input": "-453961301 271150176 725111473", "output": "No" }, { "input": "0 0 2000000000", "output": "Yes" }, { "input": "0 0 1999999999", "output": "No" }, { "input": "1000000000 1000000000 2000000000", "output": "Yes" }, { "input": "-1000000000 1000000000 2000000000", "output": "Yes" }, { "input": "-1000000000 -1000000000 2000000000", "output": "Yes" }, { "input": "-1000000000 -1000000000 1000000000", "output": "No" }, { "input": "-1 -1 3", "output": "No" }, { "input": "919785634 216774719 129321944", "output": "No" }, { "input": "-467780354 -721273539 1369030008", "output": "No" }, { "input": "-232833910 -880680184 1774549792", "output": "Yes" }, { "input": "45535578 402686155 1011249824", "output": "No" }, { "input": "-203250176 -30379840 233630015", "output": "No" }, { "input": "-814516648 -75830576 890347222", "output": "No" }, { "input": "869184175 -511854751 1381038923", "output": "No" }, { "input": "552884998 -262338193 815223187", "output": "No" }, { "input": "-133874494 857573117 991447611", "output": "Yes" }, { "input": "169406792 786701289 956108082", "output": "No" }, { "input": "30237137 -989203246 1019440385", "output": "Yes" }, { "input": "576608216 -617624133 1194232352", "output": "No" }, { "input": "-662360368 97618995 759979367", "output": "Yes" }, { "input": "-115989290 321714461 437703756", "output": "No" }, { "input": "-1 -3 2", "output": "No" }, { "input": "-2 -2 2", "output": "No" }, { "input": "0 0 1", "output": "No" }, { "input": "0 -1 7", "output": "Yes" }, { "input": "1 2 7", "output": "Yes" }, { "input": "0 5 6", "output": "No" }, { "input": "0 -4 2", "output": "No" }, { "input": "-5 5 2", "output": "No" }, { "input": "-5 -2 7", "output": "Yes" }, { "input": "5 -5 2", "output": "No" } ]

1,693,973,290

2,147,483,647

PyPy 3-64

WRONG_ANSWER

TESTS

8

46

0

x, y, s = map(int, input().split()) d = x + y if d == s: print("Yes") elif s > d and (s - d) % 2 == 0: print("Yes") else: print("No")

Title: Drazil and Date Time Limit: None seconds Memory Limit: None megabytes Problem Description: Someday, Drazil wanted to go on date with Varda. Drazil and Varda live on Cartesian plane. Drazil's home is located in point (0,<=0) and Varda's home is located in point (*a*,<=*b*). In each step, he can move in a unit distance in horizontal or vertical direction. In other words, from position (*x*,<=*y*) he can go to positions (*x*<=+<=1,<=*y*), (*x*<=-<=1,<=*y*), (*x*,<=*y*<=+<=1) or (*x*,<=*y*<=-<=1). Unfortunately, Drazil doesn't have sense of direction. So he randomly chooses the direction he will go to in each step. He may accidentally return back to his house during his travel. Drazil may even not notice that he has arrived to (*a*,<=*b*) and continue travelling. Luckily, Drazil arrived to the position (*a*,<=*b*) successfully. Drazil said to Varda: "It took me exactly *s* steps to travel from my house to yours". But Varda is confused about his words, she is not sure that it is possible to get from (0,<=0) to (*a*,<=*b*) in exactly *s* steps. Can you find out if it is possible for Varda? Input Specification: You are given three integers *a*, *b*, and *s* (<=-<=109<=≤<=*a*,<=*b*<=≤<=109, 1<=≤<=*s*<=≤<=2·109) in a single line. Output Specification: If you think Drazil made a mistake and it is impossible to take exactly *s* steps and get from his home to Varda's home, print "No" (without quotes). Otherwise, print "Yes". Demo Input: ['5 5 11\n', '10 15 25\n', '0 5 1\n', '0 0 2\n'] Demo Output: ['No\n', 'Yes\n', 'No\n', 'Yes\n'] Note: In fourth sample case one possible route is: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/0d30660ddf6eb6c64ffd071055a4e8ddd016cde5.png" style="max-width: 100.0%;max-height: 100.0%;"/>.

```python x, y, s = map(int, input().split()) d = x + y if d == s: print("Yes") elif s > d and (s - d) % 2 == 0: print("Yes") else: print("No") ```

0

622

B

The Time

PROGRAMMING

900

[ "implementation" ]

null

You are given the current time in 24-hour format hh:mm. Find and print the time after *a* minutes. Note that you should find only the time after *a* minutes, see the examples to clarify the problem statement. You can read more about 24-hour format here [https://en.wikipedia.org/wiki/24-hour_clock](https://en.wikipedia.org/wiki/24-hour_clock).

The first line contains the current time in the format hh:mm (0<=≤<=*hh*<=<<=24,<=0<=≤<=*mm*<=<<=60). The hours and the minutes are given with two digits (the hours or the minutes less than 10 are given with the leading zeroes). The second line contains integer *a* (0<=≤<=*a*<=≤<=104) — the number of the minutes passed.

The only line should contain the time after *a* minutes in the format described in the input. Note that you should print exactly two digits for the hours and the minutes (add leading zeroes to the numbers if needed). See the examples to check the input/output format.

[ "23:59\n10\n", "20:20\n121\n", "10:10\n0\n" ]

[ "00:09\n", "22:21\n", "10:10\n" ]

none

0

[ { "input": "23:59\n10", "output": "00:09" }, { "input": "20:20\n121", "output": "22:21" }, { "input": "10:10\n0", "output": "10:10" }, { "input": "12:34\n10000", "output": "11:14" }, { "input": "00:00\n10000", "output": "22:40" }, { "input": "00:00\n1440", "output": "00:00" }, { "input": "23:59\n8640", "output": "23:59" }, { "input": "10:01\n0", "output": "10:01" }, { "input": "04:05\n0", "output": "04:05" }, { "input": "02:59\n1", "output": "03:00" }, { "input": "05:15\n10", "output": "05:25" }, { "input": "03:10\n20", "output": "03:30" }, { "input": "09:11\n0", "output": "09:11" }, { "input": "19:00\n0", "output": "19:00" }, { "input": "23:59\n1", "output": "00:00" }, { "input": "11:59\n1", "output": "12:00" }, { "input": "19:34\n566", "output": "05:00" }, { "input": "00:01\n59", "output": "01:00" }, { "input": "03:30\n0", "output": "03:30" }, { "input": "22:30\n30", "output": "23:00" }, { "input": "22:50\n70", "output": "00:00" }, { "input": "05:12\n0", "output": "05:12" }, { "input": "09:20\n40", "output": "10:00" }, { "input": "15:04\n36", "output": "15:40" }, { "input": "05:37\n23", "output": "06:00" }, { "input": "23:59\n59", "output": "00:58" }, { "input": "21:09\n9997", "output": "19:46" }, { "input": "11:00\n1", "output": "11:01" }, { "input": "20:01\n2699", "output": "17:00" }, { "input": "01:00\n59", "output": "01:59" }, { "input": "07:09\n6538", "output": "20:07" }, { "input": "00:00\n10", "output": "00:10" }, { "input": "02:09\n2074", "output": "12:43" }, { "input": "01:10\n1", "output": "01:11" }, { "input": "23:01\n59", "output": "00:00" }, { "input": "08:50\n20", "output": "09:10" }, { "input": "13:18\n5121", "output": "02:39" }, { "input": "18:31\n2677", "output": "15:08" }, { "input": "14:17\n108", "output": "16:05" }, { "input": "02:45\n5617", "output": "00:22" }, { "input": "00:00\n3600", "output": "12:00" }, { "input": "19:01\n59", "output": "20:00" }, { "input": "19:02\n59", "output": "20:01" }, { "input": "14:00\n2880", "output": "14:00" }, { "input": "01:10\n44", "output": "01:54" }, { "input": "02:01\n59", "output": "03:00" }, { "input": "07:02\n121", "output": "09:03" }, { "input": "10:00\n61", "output": "11:01" }, { "input": "23:59\n61", "output": "01:00" }, { "input": "00:00\n0", "output": "00:00" }, { "input": "23:59\n121", "output": "02:00" }, { "input": "00:00\n60", "output": "01:00" }, { "input": "15:52\n60", "output": "16:52" }, { "input": "00:39\n6525", "output": "13:24" }, { "input": "00:30\n30", "output": "01:00" }, { "input": "00:59\n1", "output": "01:00" }, { "input": "00:55\n4321", "output": "00:56" }, { "input": "10:05\n1", "output": "10:06" }, { "input": "23:00\n60", "output": "00:00" } ]

1,650,867,686

2,147,483,647

Python 3

WRONG_ANSWER

TESTS

3

31

0

import sys input = sys.stdin.readline s = input()[:-1] n = int(input()) h = int(s[:2])*60 + int(s[3:]) t = h + n if t >= 1440: t -= 1440 print('%02d:%02d' %(t/60,t%60))

Title: The Time Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given the current time in 24-hour format hh:mm. Find and print the time after *a* minutes. Note that you should find only the time after *a* minutes, see the examples to clarify the problem statement. You can read more about 24-hour format here [https://en.wikipedia.org/wiki/24-hour_clock](https://en.wikipedia.org/wiki/24-hour_clock). Input Specification: The first line contains the current time in the format hh:mm (0<=≤<=*hh*<=<<=24,<=0<=≤<=*mm*<=<<=60). The hours and the minutes are given with two digits (the hours or the minutes less than 10 are given with the leading zeroes). The second line contains integer *a* (0<=≤<=*a*<=≤<=104) — the number of the minutes passed. Output Specification: The only line should contain the time after *a* minutes in the format described in the input. Note that you should print exactly two digits for the hours and the minutes (add leading zeroes to the numbers if needed). See the examples to check the input/output format. Demo Input: ['23:59\n10\n', '20:20\n121\n', '10:10\n0\n'] Demo Output: ['00:09\n', '22:21\n', '10:10\n'] Note: none

```python import sys input = sys.stdin.readline s = input()[:-1] n = int(input()) h = int(s[:2])*60 + int(s[3:]) t = h + n if t >= 1440: t -= 1440 print('%02d:%02d' %(t/60,t%60)) ```

0

624

A

Save Luke

PROGRAMMING

800

[ "math" ]

null

Luke Skywalker got locked up in a rubbish shredder between two presses. R2D2 is already working on his rescue, but Luke needs to stay alive as long as possible. For simplicity we will assume that everything happens on a straight line, the presses are initially at coordinates 0 and *L*, and they move towards each other with speed *v*1 and *v*2, respectively. Luke has width *d* and is able to choose any position between the presses. Luke dies as soon as the distance between the presses is less than his width. Your task is to determine for how long Luke can stay alive.

The first line of the input contains four integers *d*, *L*, *v*1, *v*2 (1<=≤<=*d*,<=*L*,<=*v*1,<=*v*2<=≤<=10<=000,<=*d*<=<<=*L*) — Luke's width, the initial position of the second press and the speed of the first and second presses, respectively.

Print a single real value — the maximum period of time Luke can stay alive for. Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6. Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if .

[ "2 6 2 2\n", "1 9 1 2\n" ]

[ "1.00000000000000000000\n", "2.66666666666666650000\n" ]

In the first sample Luke should stay exactly in the middle of the segment, that is at coordinates [2;4], as the presses move with the same speed. In the second sample he needs to occupy the position <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/71395c777960eaded59a9fdc428a9625f152605b.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In this case both presses move to his edges at the same time.

500

[ { "input": "2 6 2 2", "output": "1.00000000000000000000" }, { "input": "1 9 1 2", "output": "2.66666666666666650000" }, { "input": "1 10000 1 1", "output": "4999.50000000000000000000" }, { "input": "9999 10000 10000 10000", "output": "0.00005000000000000000" }, { "input": "1023 2340 1029 3021", "output": "0.32518518518518519000" }, { "input": "2173 2176 10000 9989", "output": "0.00015008254539996998" }, { "input": "1 2 123 1", "output": "0.00806451612903225780" }, { "input": "123 1242 12 312", "output": "3.45370370370370370000" }, { "input": "2 9997 3 12", "output": "666.33333333333337000000" }, { "input": "1 10000 10000 10000", "output": "0.49995000000000001000" }, { "input": "3274 4728 888 4578", "output": "0.26600804976216613000" }, { "input": "4600 9696 5634 8248", "output": "0.36709407866301685000" }, { "input": "2255 7902 8891 429", "output": "0.60590128755364803000" }, { "input": "6745 9881 2149 9907", "output": "0.26011944260119441000" }, { "input": "4400 8021 6895 2089", "output": "0.40304986642920748000" }, { "input": "5726 9082 7448 3054", "output": "0.31955817939440107000" }, { "input": "3381 9769 4898 2532", "output": "0.85975773889636609000" }, { "input": "1036 6259 5451 4713", "output": "0.51387249114521838000" }, { "input": "5526 6455 197 4191", "output": "0.21171376481312670000" }, { "input": "1196 4082 4071 9971", "output": "0.20552627830793335000" }, { "input": "8850 9921 8816 9449", "output": "0.05863673692855187600" }, { "input": "3341 7299 2074 8927", "output": "0.35978547404781386000" }, { "input": "7831 8609 6820 2596", "output": "0.08262531860662701600" }, { "input": "2322 7212 77 4778", "output": "1.00720906282183310000" }, { "input": "9976 9996 4823 4255", "output": "0.00220312844238819110" }, { "input": "7631 9769 5377 6437", "output": "0.18097172845776197000" }, { "input": "8957 9525 8634 107", "output": "0.06498112344125385500" }, { "input": "6612 9565 3380 2288", "output": "0.52099505998588569000" }, { "input": "1103 6256 3934 9062", "output": "0.39650661742074483000" }, { "input": "1854 3280 1481 2140", "output": "0.39381386357359843000" } ]

1,556,795,285

2,147,483,647

Python 3

OK

TESTS

30

109

0

a, b, c, d = map(int, input().split()) print((b - a)/(c + d)) # UBCF # CodeForcesian # ♥ # سلام من به تو یار قدیمییییی

Title: Save Luke Time Limit: None seconds Memory Limit: None megabytes Problem Description: Luke Skywalker got locked up in a rubbish shredder between two presses. R2D2 is already working on his rescue, but Luke needs to stay alive as long as possible. For simplicity we will assume that everything happens on a straight line, the presses are initially at coordinates 0 and *L*, and they move towards each other with speed *v*1 and *v*2, respectively. Luke has width *d* and is able to choose any position between the presses. Luke dies as soon as the distance between the presses is less than his width. Your task is to determine for how long Luke can stay alive. Input Specification: The first line of the input contains four integers *d*, *L*, *v*1, *v*2 (1<=≤<=*d*,<=*L*,<=*v*1,<=*v*2<=≤<=10<=000,<=*d*<=<<=*L*) — Luke's width, the initial position of the second press and the speed of the first and second presses, respectively. Output Specification: Print a single real value — the maximum period of time Luke can stay alive for. Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6. Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if . Demo Input: ['2 6 2 2\n', '1 9 1 2\n'] Demo Output: ['1.00000000000000000000\n', '2.66666666666666650000\n'] Note: In the first sample Luke should stay exactly in the middle of the segment, that is at coordinates [2;4], as the presses move with the same speed. In the second sample he needs to occupy the position <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/71395c777960eaded59a9fdc428a9625f152605b.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In this case both presses move to his edges at the same time.

```python a, b, c, d = map(int, input().split()) print((b - a)/(c + d)) # UBCF # CodeForcesian # ♥ # سلام من به تو یار قدیمییییی ```

3

664

A

Complicated GCD

PROGRAMMING

800

[ "math", "number theory" ]

null

Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm. Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type!

The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100).

Output one integer — greatest common divisor of all integers from *a* to *b* inclusive.

[ "1 2\n", "61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n" ]

[ "1\n", "61803398874989484820458683436563811772030917980576\n" ]

none

500

[ { "input": "1 2", "output": "1" }, { "input": "61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576", "output": "61803398874989484820458683436563811772030917980576" }, { "input": "1 100", "output": "1" }, { "input": "100 100000", "output": "1" }, { "input": "12345 67890123456789123457", "output": "1" }, { "input": "1 1", "output": "1" }, { "input": "2 2", "output": "2" }, { "input": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158 8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158", "output": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158" }, { "input": "1 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "1" }, { "input": "8328748239473982794239847237438782379810988324751 9328748239473982794239847237438782379810988324751", "output": "1" }, { "input": "1029398958432734901284327523909481928483573793 1029398958432734901284327523909481928483573794", "output": "1" }, { "input": "10000 1000000000", "output": "1" }, { "input": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000" }, { "input": "11210171722243 65715435710585778347", "output": "1" }, { "input": "2921881079263974825226940825843 767693191032295360887755303860323261471", "output": "1" }, { "input": "8025352957265704896940312528736939363590612908210603 96027920417708260814607687034511406492969694925539085", "output": "1" }, { "input": "23510978780782786207241069904470895053213996267165977112058175452757132930 210352653280909370107314249722987050753257161175393375412301228883856435481424", "output": "1" }, { "input": "8150070767079366215626260746398623663859344142817267779361251788637547414925170226504788118262 49924902262298336032630839998470954964895251605110946547855439236151401194070172107435992986913614", "output": "1" }, { "input": "15943150466658398903 15943150466658398903", "output": "15943150466658398903" }, { "input": "410470228200245407491525399055972 410470228200245407491525399055972", "output": "410470228200245407491525399055972" }, { "input": "51894705655711504622197349350106792045098781545973899451307 51894705655711504622197349350106792045098781545973899451307", "output": "51894705655711504622197349350106792045098781545973899451307" }, { "input": "60353594589897438036015726222485085035927634677598681595162804007836722215668410 60353594589897438036015726222485085035927634677598681595162804007836722215668410", "output": "60353594589897438036015726222485085035927634677598681595162804007836722215668410" }, { "input": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535 761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535", "output": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535" }, { "input": "1 2000000000", "output": "1" }, { "input": "13 1928834874", "output": "1" }, { "input": "87 2938984237482934238", "output": "1" }, { "input": "213 413", "output": "1" }, { "input": "3 4", "output": "1" } ]

1,600,624,385

2,147,483,647

Python 3

COMPILATION_ERROR

TESTS

0

x,y=input().split() x=int(x) y=int(y) for i in range reversed(1,max(x,y)/2): if i%x==0 and i%y==0: print(i)

Title: Complicated GCD Time Limit: None seconds Memory Limit: None megabytes Problem Description: Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm. Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type! Input Specification: The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100). Output Specification: Output one integer — greatest common divisor of all integers from *a* to *b* inclusive. Demo Input: ['1 2\n', '61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n'] Demo Output: ['1\n', '61803398874989484820458683436563811772030917980576\n'] Note: none

```python x,y=input().split() x=int(x) y=int(y) for i in range reversed(1,max(x,y)/2): if i%x==0 and i%y==0: print(i) ```

-1

854

A

Fraction

PROGRAMMING

800

[ "brute force", "constructive algorithms", "math" ]

null

Petya is a big fan of mathematics, especially its part related to fractions. Recently he learned that a fraction is called proper iff its numerator is smaller than its denominator (*a*<=<<=*b*) and that the fraction is called irreducible if its numerator and its denominator are coprime (they do not have positive common divisors except 1). During his free time, Petya thinks about proper irreducible fractions and converts them to decimals using the calculator. One day he mistakenly pressed addition button (<=+<=) instead of division button (÷) and got sum of numerator and denominator that was equal to *n* instead of the expected decimal notation. Petya wanted to restore the original fraction, but soon he realized that it might not be done uniquely. That's why he decided to determine maximum possible proper irreducible fraction such that sum of its numerator and denominator equals *n*. Help Petya deal with this problem.

In the only line of input there is an integer *n* (3<=≤<=*n*<=≤<=1000), the sum of numerator and denominator of the fraction.

Output two space-separated positive integers *a* and *b*, numerator and denominator of the maximum possible proper irreducible fraction satisfying the given sum.

[ "3\n", "4\n", "12\n" ]

[ "1 2\n", "1 3\n", "5 7\n" ]

none

500

[ { "input": "3", "output": "1 2" }, { "input": "4", "output": "1 3" }, { "input": "12", "output": "5 7" }, { "input": "34", "output": "15 19" }, { "input": "13", "output": "6 7" }, { "input": "11", "output": "5 6" }, { "input": "24", "output": "11 13" }, { "input": "17", "output": "8 9" }, { "input": "10", "output": "3 7" }, { "input": "69", "output": "34 35" }, { "input": "100", "output": "49 51" }, { "input": "57", "output": "28 29" }, { "input": "1000", "output": "499 501" }, { "input": "999", "output": "499 500" }, { "input": "998", "output": "497 501" }, { "input": "997", "output": "498 499" }, { "input": "996", "output": "497 499" }, { "input": "995", "output": "497 498" }, { "input": "994", "output": "495 499" }, { "input": "5", "output": "2 3" }, { "input": "6", "output": "1 5" }, { "input": "8", "output": "3 5" }, { "input": "9", "output": "4 5" }, { "input": "423", "output": "211 212" }, { "input": "876", "output": "437 439" }, { "input": "29", "output": "14 15" } ]

1,574,625,450

2,147,483,647

PyPy 3

WRONG_ANSWER

TESTS

0

109

0

n = int(input()) for i in range(1, n): if max(n - i, i) % min(n - i, i) != 0: print(min(i, n - i), max(i, n - i)) break

Title: Fraction Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petya is a big fan of mathematics, especially its part related to fractions. Recently he learned that a fraction is called proper iff its numerator is smaller than its denominator (*a*<=<<=*b*) and that the fraction is called irreducible if its numerator and its denominator are coprime (they do not have positive common divisors except 1). During his free time, Petya thinks about proper irreducible fractions and converts them to decimals using the calculator. One day he mistakenly pressed addition button (<=+<=) instead of division button (÷) and got sum of numerator and denominator that was equal to *n* instead of the expected decimal notation. Petya wanted to restore the original fraction, but soon he realized that it might not be done uniquely. That's why he decided to determine maximum possible proper irreducible fraction such that sum of its numerator and denominator equals *n*. Help Petya deal with this problem. Input Specification: In the only line of input there is an integer *n* (3<=≤<=*n*<=≤<=1000), the sum of numerator and denominator of the fraction. Output Specification: Output two space-separated positive integers *a* and *b*, numerator and denominator of the maximum possible proper irreducible fraction satisfying the given sum. Demo Input: ['3\n', '4\n', '12\n'] Demo Output: ['1 2\n', '1 3\n', '5 7\n'] Note: none

```python n = int(input()) for i in range(1, n): if max(n - i, i) % min(n - i, i) != 0: print(min(i, n - i), max(i, n - i)) break ```

0

568

A

Primes or Palindromes?

PROGRAMMING

1,600

[ "brute force", "implementation", "math", "number theory" ]

null

Rikhail Mubinchik believes that the current definition of prime numbers is obsolete as they are too complex and unpredictable. A palindromic number is another matter. It is aesthetically pleasing, and it has a number of remarkable properties. Help Rikhail to convince the scientific community in this! Let us remind you that a number is called prime if it is integer larger than one, and is not divisible by any positive integer other than itself and one. Rikhail calls a number a palindromic if it is integer, positive, and its decimal representation without leading zeros is a palindrome, i.e. reads the same from left to right and right to left. One problem with prime numbers is that there are too many of them. Let's introduce the following notation: π(*n*) — the number of primes no larger than *n*, *rub*(*n*) — the number of palindromic numbers no larger than *n*. Rikhail wants to prove that there are a lot more primes than palindromic ones. He asked you to solve the following problem: for a given value of the coefficient *A* find the maximum *n*, such that π(*n*)<=≤<=*A*·*rub*(*n*).

The input consists of two positive integers *p*, *q*, the numerator and denominator of the fraction that is the value of *A* (, ).

If such maximum number exists, then print it. Otherwise, print "Palindromic tree is better than splay tree" (without the quotes).

[ "1 1\n", "1 42\n", "6 4\n" ]

[ "40\n", "1\n", "172\n" ]

none

500

[ { "input": "1 1", "output": "40" }, { "input": "1 42", "output": "1" }, { "input": "6 4", "output": "172" }, { "input": "3 1", "output": "2530" }, { "input": "42 1", "output": "1179858" }, { "input": "10000 239", "output": "1168638" }, { "input": "5 8", "output": "16" }, { "input": "7 11", "output": "16" }, { "input": "16 60", "output": "1" }, { "input": "214 210", "output": "40" }, { "input": "620 35", "output": "251262" }, { "input": "940 480", "output": "1372" }, { "input": "1307 3420", "output": "1" }, { "input": "6811 5416", "output": "66" }, { "input": "7 267", "output": "1" }, { "input": "106 6", "output": "250300" }, { "input": "10000 10000", "output": "40" }, { "input": "10000 9999", "output": "40" }, { "input": "9999 9998", "output": "40" }, { "input": "9999 9999", "output": "40" }, { "input": "4 9", "output": "10" }, { "input": "1000 10000", "output": "1" }, { "input": "238 9996", "output": "1" }, { "input": "999 10000", "output": "1" }, { "input": "241 10000", "output": "1" }, { "input": "239 10000", "output": "1" }, { "input": "5858 674", "output": "71118" } ]

1,682,596,731

2,147,483,647

PyPy 3-64

OK

TESTS

27

576

19,763,200

n = 2 * 10 ** 6 + 10 ** 5 p, q = map(int, input().split(' ')) pi = 0 si = 0 pr = [0] * n pr[1] = 1 for i in range(2, n): if pr[i] == 0: for j in range(i*i, n, i): pr[j] = 1 res = 'Palindromic tree is better than splay tree' for i in range(1, n): if pr[i] == 0: pi += 1 j = str(i) if j == j[::-1]: si += 1 if q*pi <= si*p: res = i print(res)

Title: Primes or Palindromes? Time Limit: None seconds Memory Limit: None megabytes Problem Description: Rikhail Mubinchik believes that the current definition of prime numbers is obsolete as they are too complex and unpredictable. A palindromic number is another matter. It is aesthetically pleasing, and it has a number of remarkable properties. Help Rikhail to convince the scientific community in this! Let us remind you that a number is called prime if it is integer larger than one, and is not divisible by any positive integer other than itself and one. Rikhail calls a number a palindromic if it is integer, positive, and its decimal representation without leading zeros is a palindrome, i.e. reads the same from left to right and right to left. One problem with prime numbers is that there are too many of them. Let's introduce the following notation: π(*n*) — the number of primes no larger than *n*, *rub*(*n*) — the number of palindromic numbers no larger than *n*. Rikhail wants to prove that there are a lot more primes than palindromic ones. He asked you to solve the following problem: for a given value of the coefficient *A* find the maximum *n*, such that π(*n*)<=≤<=*A*·*rub*(*n*). Input Specification: The input consists of two positive integers *p*, *q*, the numerator and denominator of the fraction that is the value of *A* (, ). Output Specification: If such maximum number exists, then print it. Otherwise, print "Palindromic tree is better than splay tree" (without the quotes). Demo Input: ['1 1\n', '1 42\n', '6 4\n'] Demo Output: ['40\n', '1\n', '172\n'] Note: none

```python n = 2 * 10 ** 6 + 10 ** 5 p, q = map(int, input().split(' ')) pi = 0 si = 0 pr = [0] * n pr[1] = 1 for i in range(2, n): if pr[i] == 0: for j in range(i*i, n, i): pr[j] = 1 res = 'Palindromic tree is better than splay tree' for i in range(1, n): if pr[i] == 0: pi += 1 j = str(i) if j == j[::-1]: si += 1 if q*pi <= si*p: res = i print(res) ```

3

435

A

Queue on Bus Stop

PROGRAMMING

1,000

[ "implementation" ]

null

It's that time of the year when the Russians flood their countryside summer cottages (dachas) and the bus stop has a lot of people. People rarely go to the dacha on their own, it's usually a group, so the people stand in queue by groups. The bus stop queue has *n* groups of people. The *i*-th group from the beginning has *a**i* people. Every 30 minutes an empty bus arrives at the bus stop, it can carry at most *m* people. Naturally, the people from the first group enter the bus first. Then go the people from the second group and so on. Note that the order of groups in the queue never changes. Moreover, if some group cannot fit all of its members into the current bus, it waits for the next bus together with other groups standing after it in the queue. Your task is to determine how many buses is needed to transport all *n* groups to the dacha countryside.

The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100). The next line contains *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*m*).

Print a single integer — the number of buses that is needed to transport all *n* groups to the dacha countryside.

[ "4 3\n2 3 2 1\n", "3 4\n1 2 1\n" ]

[ "3\n", "1\n" ]

none

500

[ { "input": "4 3\n2 3 2 1", "output": "3" }, { "input": "3 4\n1 2 1", "output": "1" }, { "input": "1 5\n4", "output": "1" }, { "input": "5 1\n1 1 1 1 1", "output": "5" }, { "input": "6 4\n1 3 2 3 4 1", "output": "5" }, { "input": "6 8\n6 1 1 1 4 5", "output": "3" }, { "input": "10 10\n1 10 1 10 1 1 7 8 6 7", "output": "8" }, { "input": "100 100\n85 50 17 89 65 89 5 20 86 26 16 21 85 14 44 31 87 31 6 2 48 67 8 80 79 1 48 36 97 1 5 30 79 50 78 12 2 55 76 100 54 40 26 81 97 96 68 56 87 14 51 17 54 37 52 33 69 62 38 63 74 15 62 78 9 19 67 2 60 58 93 60 18 96 55 48 34 7 79 82 32 58 90 67 20 50 27 15 7 89 98 10 11 15 99 49 4 51 77 52", "output": "63" }, { "input": "10 1\n1 1 1 1 1 1 1 1 1 1", "output": "10" }, { "input": "10 2\n2 2 1 1 1 1 1 2 1 2", "output": "8" }, { "input": "10 3\n1 3 1 1 3 2 2 2 3 3", "output": "9" }, { "input": "10 4\n2 1 1 1 3 4 4 4 1 2", "output": "6" }, { "input": "10 5\n2 2 3 4 4 1 5 3 1 2", "output": "7" }, { "input": "100 3\n1 2 3 2 1 2 2 3 1 3 3 2 2 1 1 2 2 1 1 1 1 2 3 3 2 1 1 2 2 2 3 3 3 2 1 3 1 3 3 2 3 1 2 2 2 3 2 1 1 3 3 3 3 2 1 1 2 3 2 2 3 2 3 2 2 3 2 2 2 2 3 3 3 1 3 3 1 1 2 3 2 2 2 2 3 3 3 2 1 2 3 1 1 2 3 3 1 3 3 2", "output": "83" }, { "input": "100 7\n4 7 4 7 7 4 7 3 5 6 3 5 4 3 7 2 7 2 4 1 6 3 3 7 4 4 5 4 3 6 4 3 2 2 1 4 4 1 7 3 7 7 1 3 1 5 4 1 5 3 5 2 2 1 5 5 1 5 2 7 5 5 1 5 5 4 6 5 1 3 5 6 7 4 1 3 3 4 3 2 7 6 5 7 2 7 1 1 2 2 3 1 3 7 1 3 2 1 1 7", "output": "71" }, { "input": "100 10\n3 4 8 10 8 6 4 3 7 7 6 2 3 1 3 10 1 7 9 3 5 5 2 6 2 9 1 7 4 2 4 1 6 1 7 10 2 5 3 7 6 4 6 2 8 8 8 6 6 10 3 7 4 3 4 1 7 9 3 6 3 6 1 4 9 3 8 1 10 1 4 10 7 7 9 5 3 8 10 2 1 10 8 7 10 8 5 3 1 2 1 10 6 1 5 3 3 5 7 2", "output": "64" }, { "input": "100 15\n3 12 8 3 11 14 12 14 1 11 13 3 5 13 4 14 2 11 7 8 12 9 15 7 15 1 4 11 6 12 1 3 8 13 1 8 14 4 3 14 1 3 1 6 10 15 13 11 12 1 14 13 11 14 11 3 12 7 3 15 14 4 5 6 5 14 7 14 6 2 6 12 6 13 13 1 9 13 15 11 6 3 15 11 9 4 15 8 15 12 1 15 10 10 4 1 15 1 4 1", "output": "71" }, { "input": "100 30\n7 14 22 16 11 13 7 29 20 19 22 6 12 16 1 8 27 21 22 3 15 27 20 12 4 19 1 26 26 22 25 17 29 25 16 29 29 28 16 26 25 14 16 20 5 21 5 15 19 13 17 21 17 19 23 13 1 25 6 30 16 19 12 10 28 8 15 13 14 24 19 30 12 19 22 1 3 14 16 3 20 26 15 19 9 10 19 27 2 16 10 22 15 13 19 3 24 9 8 13", "output": "71" }, { "input": "100 40\n39 19 13 36 11 21 32 12 1 2 39 26 32 39 24 1 4 19 10 4 16 39 32 34 13 24 30 35 3 10 8 18 13 12 39 27 31 40 37 20 17 17 37 5 10 12 22 17 7 1 31 13 11 10 2 6 22 16 2 4 9 27 6 35 22 16 22 30 33 2 26 20 35 19 40 37 19 17 21 28 37 28 40 4 5 4 35 19 26 36 19 12 21 20 21 30 9 16 9 32", "output": "65" }, { "input": "100 50\n2 46 4 6 38 19 15 34 10 35 37 30 3 25 5 45 40 45 33 31 6 20 10 44 11 9 2 14 35 5 9 23 20 2 48 22 25 35 38 31 24 33 35 16 4 30 27 10 12 22 6 24 12 30 23 21 14 12 32 21 7 12 25 43 18 34 34 28 47 13 28 43 18 39 44 42 35 26 35 14 8 29 32 20 29 3 20 6 20 9 9 27 8 42 10 37 42 27 8 1", "output": "60" }, { "input": "100 60\n34 21 39 17 48 46 23 56 46 52 50 39 55 48 54 38 32 38 24 26 44 12 28 9 25 26 10 52 42 60 41 3 16 60 44 29 27 55 19 19 19 57 45 59 29 35 5 14 50 47 57 48 16 7 12 36 58 31 37 58 30 50 19 11 10 41 59 57 49 41 33 9 12 11 53 50 60 51 21 9 44 23 1 16 4 15 17 57 15 17 46 50 18 52 43 24 47 50 19 18", "output": "74" }, { "input": "100 90\n74 65 49 41 3 79 61 83 50 40 13 57 90 14 62 77 36 10 3 5 5 40 50 75 32 26 3 71 79 54 88 50 46 20 42 59 30 36 83 86 60 62 82 68 62 80 18 65 28 28 81 74 62 33 61 35 33 83 90 72 6 6 51 4 22 20 29 10 8 3 84 69 12 17 24 16 12 64 80 74 68 59 1 59 15 59 37 58 79 83 51 56 81 14 37 45 19 31 61 90", "output": "67" }, { "input": "100 99\n69 46 76 47 71 9 66 46 78 17 96 83 56 96 29 3 43 48 79 23 93 61 19 9 29 72 15 84 93 46 71 87 11 43 96 44 54 75 3 66 2 95 46 32 69 52 79 38 57 53 37 60 71 82 28 31 84 58 89 40 62 74 22 50 45 38 99 67 24 28 28 12 69 88 33 10 31 71 46 7 42 81 54 81 96 44 8 1 20 24 28 19 54 35 69 32 71 13 66 15", "output": "68" }, { "input": "90 100\n25 52 88 89 36 17 57 64 66 11 89 61 54 92 48 51 18 42 44 92 6 14 67 100 16 21 17 88 85 73 33 11 94 84 56 72 4 80 90 78 96 5 62 70 54 70 94 80 10 91 100 89 98 87 69 74 88 63 53 79 38 94 89 52 21 82 67 79 100 81 2 40 30 69 34 15 12 33 87 52 95 18 51 30 15 39 30 99 46 84", "output": "67" }, { "input": "5 100\n14 67 15 28 21", "output": "2" }, { "input": "10 100\n2 17 53 94 95 57 36 47 68 48", "output": "7" }, { "input": "1 100\n18", "output": "1" }, { "input": "100 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "100" }, { "input": "30 100\n56 7 99 83 2 65 35 53 99 36 42 57 13 37 68 52 87 11 50 23 86 24 32 39 97 6 64 1 18 86", "output": "18" }, { "input": "60 100\n18 75 43 88 45 43 20 59 59 79 62 39 53 21 28 46 54 53 97 81 18 15 2 95 84 9 36 70 30 76 17 19 83 40 45 32 31 70 23 14 44 35 79 84 97 96 99 60 3 73 64 83 6 12 67 86 70 89 18 61", "output": "40" }, { "input": "1 73\n24", "output": "1" }, { "input": "4 4\n1 4 4 4", "output": "4" }, { "input": "2 6\n1 4", "output": "1" }, { "input": "2 5\n5 5", "output": "2" } ]

1,401,941,981

2,147,483,647

Python 3

WRONG_ANSWER

TESTS

4

186

0

n, m = tuple(map(int,input().split())) a = list(map(int,input().split())) s = sum(a) k = s // m if s % m == 0 else s // m + 1 print(k)

Title: Queue on Bus Stop Time Limit: None seconds Memory Limit: None megabytes Problem Description: It's that time of the year when the Russians flood their countryside summer cottages (dachas) and the bus stop has a lot of people. People rarely go to the dacha on their own, it's usually a group, so the people stand in queue by groups. The bus stop queue has *n* groups of people. The *i*-th group from the beginning has *a**i* people. Every 30 minutes an empty bus arrives at the bus stop, it can carry at most *m* people. Naturally, the people from the first group enter the bus first. Then go the people from the second group and so on. Note that the order of groups in the queue never changes. Moreover, if some group cannot fit all of its members into the current bus, it waits for the next bus together with other groups standing after it in the queue. Your task is to determine how many buses is needed to transport all *n* groups to the dacha countryside. Input Specification: The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100). The next line contains *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*m*). Output Specification: Print a single integer — the number of buses that is needed to transport all *n* groups to the dacha countryside. Demo Input: ['4 3\n2 3 2 1\n', '3 4\n1 2 1\n'] Demo Output: ['3\n', '1\n'] Note: none

```python n, m = tuple(map(int,input().split())) a = list(map(int,input().split())) s = sum(a) k = s // m if s % m == 0 else s // m + 1 print(k) ```

0

381

A

Sereja and Dima

PROGRAMMING

800

[ "greedy", "implementation", "two pointers" ]

null

Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins. Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move. Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.

The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.

On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.

[ "4\n4 1 2 10\n", "7\n1 2 3 4 5 6 7\n" ]

[ "12 5\n", "16 12\n" ]

In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.

500

[ { "input": "4\n4 1 2 10", "output": "12 5" }, { "input": "7\n1 2 3 4 5 6 7", "output": "16 12" }, { "input": "42\n15 29 37 22 16 5 26 31 6 32 19 3 45 36 33 14 25 20 48 7 42 11 24 28 9 18 8 21 47 17 38 40 44 4 35 1 43 39 41 27 12 13", "output": "613 418" }, { "input": "43\n32 1 15 48 38 26 25 14 20 44 11 30 3 42 49 19 18 46 5 45 10 23 34 9 29 41 2 52 6 17 35 4 50 22 33 51 7 28 47 13 39 37 24", "output": "644 500" }, { "input": "1\n3", "output": "3 0" }, { "input": "45\n553 40 94 225 415 471 126 190 647 394 515 303 189 159 308 6 139 132 326 78 455 75 85 295 135 613 360 614 351 228 578 259 258 591 444 29 33 463 561 174 368 183 140 168 646", "output": "6848 6568" }, { "input": "44\n849 373 112 307 479 608 856 769 526 82 168 143 573 762 115 501 688 36 214 450 396 496 236 309 287 786 397 43 811 141 745 846 350 270 276 677 420 459 403 722 267 54 394 727", "output": "9562 9561" }, { "input": "35\n10 15 18 1 28 16 2 33 6 22 23 4 9 25 35 8 7 26 3 20 30 14 31 19 27 32 11 5 29 24 21 34 13 17 12", "output": "315 315" }, { "input": "17\n580 376 191 496 73 44 520 357 483 149 81 178 514 300 216 598 304", "output": "3238 2222" }, { "input": "30\n334 443 223 424 168 549 189 303 429 559 516 220 459 134 344 346 316 446 209 148 487 526 69 286 102 366 518 280 392 325", "output": "5246 4864" }, { "input": "95\n122 29 188 265 292 287 183 225 222 187 155 256 64 148 173 278 218 136 290 17 31 130 2 87 57 283 255 280 68 166 174 142 102 39 116 206 288 154 26 78 296 172 184 232 77 91 277 8 249 186 94 93 207 251 257 195 101 299 193 124 293 65 58 35 24 302 220 189 252 125 27 284 247 182 141 103 198 97 234 83 281 216 85 180 267 236 109 143 149 239 79 300 191 244 71", "output": "8147 7807" }, { "input": "1\n1", "output": "1 0" } ]

1,669,949,113

2,147,483,647

Python 3

OK

TESTS

34

46

0

# Ahmed Yasser El-kotb Gamea # 120210114 # Section 6 n = int(input()) a = input().split() a = list(map(int, a)) ser = 0 dima = 0 for i in range(n): if a[0] > a[-1]: if i % 2 == 0: ser += a[0] else: dima += a[0] a.pop(0) else: if i % 2 == 0: ser += a[-1] else: dima += a[-1] a.pop(-1) print(ser, dima)

Title: Sereja and Dima Time Limit: None seconds Memory Limit: None megabytes Problem Description: Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins. Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move. Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000. Output Specification: On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game. Demo Input: ['4\n4 1 2 10\n', '7\n1 2 3 4 5 6 7\n'] Demo Output: ['12 5\n', '16 12\n'] Note: In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.

```python # Ahmed Yasser El-kotb Gamea # 120210114 # Section 6 n = int(input()) a = input().split() a = list(map(int, a)) ser = 0 dima = 0 for i in range(n): if a[0] > a[-1]: if i % 2 == 0: ser += a[0] else: dima += a[0] a.pop(0) else: if i % 2 == 0: ser += a[-1] else: dima += a[-1] a.pop(-1) print(ser, dima) ```

3

149

A

Business trip

PROGRAMMING

900

[ "greedy", "implementation", "sortings" ]

null

What joy! Petya's parents went on a business trip for the whole year and the playful kid is left all by himself. Petya got absolutely happy. He jumped on the bed and threw pillows all day long, until... Today Petya opened the cupboard and found a scary note there. His parents had left him with duties: he should water their favourite flower all year, each day, in the morning, in the afternoon and in the evening. "Wait a second!" — thought Petya. He know for a fact that if he fulfills the parents' task in the *i*-th (1<=≤<=*i*<=≤<=12) month of the year, then the flower will grow by *a**i* centimeters, and if he doesn't water the flower in the *i*-th month, then the flower won't grow this month. Petya also knows that try as he might, his parents won't believe that he has been watering the flower if it grows strictly less than by *k* centimeters. Help Petya choose the minimum number of months when he will water the flower, given that the flower should grow no less than by *k* centimeters.

The first line contains exactly one integer *k* (0<=≤<=*k*<=≤<=100). The next line contains twelve space-separated integers: the *i*-th (1<=≤<=*i*<=≤<=12) number in the line represents *a**i* (0<=≤<=*a**i*<=≤<=100).

Print the only integer — the minimum number of months when Petya has to water the flower so that the flower grows no less than by *k* centimeters. If the flower can't grow by *k* centimeters in a year, print -1.

[ "5\n1 1 1 1 2 2 3 2 2 1 1 1\n", "0\n0 0 0 0 0 0 0 1 1 2 3 0\n", "11\n1 1 4 1 1 5 1 1 4 1 1 1\n" ]

[ "2\n", "0\n", "3\n" ]

Let's consider the first sample test. There it is enough to water the flower during the seventh and the ninth month. Then the flower grows by exactly five centimeters. In the second sample Petya's parents will believe him even if the flower doesn't grow at all (*k* = 0). So, it is possible for Petya not to water the flower at all.

500

[ { "input": "5\n1 1 1 1 2 2 3 2 2 1 1 1", "output": "2" }, { "input": "0\n0 0 0 0 0 0 0 1 1 2 3 0", "output": "0" }, { "input": "11\n1 1 4 1 1 5 1 1 4 1 1 1", "output": "3" }, { "input": "15\n20 1 1 1 1 2 2 1 2 2 1 1", "output": "1" }, { "input": "7\n8 9 100 12 14 17 21 10 11 100 23 10", "output": "1" }, { "input": "52\n1 12 3 11 4 5 10 6 9 7 8 2", "output": "6" }, { "input": "50\n2 2 3 4 5 4 4 5 7 3 2 7", "output": "-1" }, { "input": "0\n55 81 28 48 99 20 67 95 6 19 10 93", "output": "0" }, { "input": "93\n85 40 93 66 92 43 61 3 64 51 90 21", "output": "1" }, { "input": "99\n36 34 22 0 0 0 52 12 0 0 33 47", "output": "2" }, { "input": "99\n28 32 31 0 10 35 11 18 0 0 32 28", "output": "3" }, { "input": "99\n19 17 0 1 18 11 29 9 29 22 0 8", "output": "4" }, { "input": "76\n2 16 11 10 12 0 20 4 4 14 11 14", "output": "5" }, { "input": "41\n2 1 7 7 4 2 4 4 9 3 10 0", "output": "6" }, { "input": "47\n8 2 2 4 3 1 9 4 2 7 7 8", "output": "7" }, { "input": "58\n6 11 7 0 5 6 3 9 4 9 5 1", "output": "8" }, { "input": "32\n5 2 4 1 5 0 5 1 4 3 0 3", "output": "9" }, { "input": "31\n6 1 0 4 4 5 1 0 5 3 2 0", "output": "9" }, { "input": "35\n2 3 0 0 6 3 3 4 3 5 0 6", "output": "9" }, { "input": "41\n3 1 3 4 3 6 6 1 4 4 0 6", "output": "11" }, { "input": "97\n0 5 3 12 10 16 22 8 21 17 21 10", "output": "5" }, { "input": "100\n21 21 0 0 4 13 0 26 0 0 0 15", "output": "6" }, { "input": "100\n0 0 16 5 22 0 5 0 25 0 14 13", "output": "7" }, { "input": "97\n17 0 10 0 0 0 18 0 14 23 15 0", "output": "6" }, { "input": "100\n0 9 0 18 7 0 0 14 33 3 0 16", "output": "7" }, { "input": "95\n5 2 13 0 15 18 17 0 6 11 0 8", "output": "9" }, { "input": "94\n11 13 0 9 15 8 8 16 3 7 1 3", "output": "11" }, { "input": "96\n8 4 12 15 8 0 4 10 6 6 12 11", "output": "11" }, { "input": "100\n5 5 3 8 6 5 0 3 3 8 1 3", "output": "-1" }, { "input": "100\n1 0 0 1 1 0 1 1 1 1 2 1", "output": "-1" }, { "input": "100\n6 3 2 0 4 1 2 2 2 2 1 1", "output": "-1" }, { "input": "0\n0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0", "output": "-1" }, { "input": "0\n100 100 100 100 100 100 100 100 100 100 100 100", "output": "0" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100", "output": "1" }, { "input": "12\n1 1 1 1 1 1 1 1 1 1 1 1", "output": "12" }, { "input": "13\n1 1 1 1 1 1 1 1 1 1 1 2", "output": "12" }, { "input": "15\n10 1 1 1 1 1 1 1 1 1 1 1", "output": "6" }, { "input": "1\n0 0 0 0 0 0 0 0 0 0 0 0", "output": "-1" } ]

1,675,520,607

2,147,483,647

Python 3

OK

TESTS

39

92

4,300,800

# LUOGU_RID: 101469757 n, *a = map(int, open(0).read().split()) a.sort(reverse=True) for i in range(13): if sum(a[:i]) >= n: exit(print(i)) print(-1)

Title: Business trip Time Limit: None seconds Memory Limit: None megabytes Problem Description: What joy! Petya's parents went on a business trip for the whole year and the playful kid is left all by himself. Petya got absolutely happy. He jumped on the bed and threw pillows all day long, until... Today Petya opened the cupboard and found a scary note there. His parents had left him with duties: he should water their favourite flower all year, each day, in the morning, in the afternoon and in the evening. "Wait a second!" — thought Petya. He know for a fact that if he fulfills the parents' task in the *i*-th (1<=≤<=*i*<=≤<=12) month of the year, then the flower will grow by *a**i* centimeters, and if he doesn't water the flower in the *i*-th month, then the flower won't grow this month. Petya also knows that try as he might, his parents won't believe that he has been watering the flower if it grows strictly less than by *k* centimeters. Help Petya choose the minimum number of months when he will water the flower, given that the flower should grow no less than by *k* centimeters. Input Specification: The first line contains exactly one integer *k* (0<=≤<=*k*<=≤<=100). The next line contains twelve space-separated integers: the *i*-th (1<=≤<=*i*<=≤<=12) number in the line represents *a**i* (0<=≤<=*a**i*<=≤<=100). Output Specification: Print the only integer — the minimum number of months when Petya has to water the flower so that the flower grows no less than by *k* centimeters. If the flower can't grow by *k* centimeters in a year, print -1. Demo Input: ['5\n1 1 1 1 2 2 3 2 2 1 1 1\n', '0\n0 0 0 0 0 0 0 1 1 2 3 0\n', '11\n1 1 4 1 1 5 1 1 4 1 1 1\n'] Demo Output: ['2\n', '0\n', '3\n'] Note: Let's consider the first sample test. There it is enough to water the flower during the seventh and the ninth month. Then the flower grows by exactly five centimeters. In the second sample Petya's parents will believe him even if the flower doesn't grow at all (*k* = 0). So, it is possible for Petya not to water the flower at all.

```python # LUOGU_RID: 101469757 n, *a = map(int, open(0).read().split()) a.sort(reverse=True) for i in range(13): if sum(a[:i]) >= n: exit(print(i)) print(-1) ```

3

344

A

Magnets

PROGRAMMING

800

[ "implementation" ]

null

Mad scientist Mike entertains himself by arranging rows of dominoes. He doesn't need dominoes, though: he uses rectangular magnets instead. Each magnet has two poles, positive (a "plus") and negative (a "minus"). If two magnets are put together at a close distance, then the like poles will repel each other and the opposite poles will attract each other. Mike starts by laying one magnet horizontally on the table. During each following step Mike adds one more magnet horizontally to the right end of the row. Depending on how Mike puts the magnet on the table, it is either attracted to the previous one (forming a group of multiple magnets linked together) or repelled by it (then Mike lays this magnet at some distance to the right from the previous one). We assume that a sole magnet not linked to others forms a group of its own. Mike arranged multiple magnets in a row. Determine the number of groups that the magnets formed.

The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100000) — the number of magnets. Then *n* lines follow. The *i*-th line (1<=≤<=*i*<=≤<=*n*) contains either characters "01", if Mike put the *i*-th magnet in the "plus-minus" position, or characters "10", if Mike put the magnet in the "minus-plus" position.

On the single line of the output print the number of groups of magnets.

[ "6\n10\n10\n10\n01\n10\n10\n", "4\n01\n01\n10\n10\n" ]

[ "3\n", "2\n" ]

The first testcase corresponds to the figure. The testcase has three groups consisting of three, one and two magnets. The second testcase has two groups, each consisting of two magnets.

500

[ { "input": "6\n10\n10\n10\n01\n10\n10", "output": "3" }, { "input": "4\n01\n01\n10\n10", "output": "2" }, { "input": "1\n10", "output": "1" }, { "input": "2\n01\n10", "output": "2" }, { "input": "2\n10\n10", "output": "1" }, { "input": "3\n10\n01\n10", "output": "3" }, { "input": "1\n01", "output": "1" }, { "input": "2\n01\n01", "output": "1" }, { "input": "2\n10\n01", "output": "2" }, { "input": "3\n01\n01\n01", "output": "1" }, { "input": "3\n10\n10\n01", "output": "2" }, { "input": "3\n01\n10\n10", "output": "2" }, { "input": "115\n10\n10\n10\n10\n01\n01\n10\n10\n10\n01\n01\n10\n01\n01\n10\n10\n10\n01\n10\n01\n10\n10\n01\n01\n10\n10\n10\n10\n01\n10\n01\n01\n10\n10\n10\n10\n01\n10\n10\n10\n01\n10\n01\n10\n10\n10\n10\n01\n01\n01\n10\n10\n01\n01\n01\n10\n10\n01\n10\n01\n01\n01\n01\n10\n10\n01\n10\n01\n01\n01\n01\n01\n10\n01\n10\n10\n01\n01\n01\n10\n01\n01\n10\n10\n01\n01\n01\n01\n01\n10\n01\n10\n01\n10\n01\n01\n01\n10\n01\n10\n10\n01\n10\n10\n01\n01\n01\n10\n10\n10\n10\n10\n10\n10\n10", "output": "55" } ]

1,695,467,281

2,147,483,647

Python 3

OK

TESTS

31

310

7,884,800

n=int(input()) magnets=[] for i in range(n): magnet=input() magnets.append(magnet) x=1 for i in range(n-1): if magnets[i]==magnets[i+1]: x=x else: x+=1 print(x)

Title: Magnets Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mad scientist Mike entertains himself by arranging rows of dominoes. He doesn't need dominoes, though: he uses rectangular magnets instead. Each magnet has two poles, positive (a "plus") and negative (a "minus"). If two magnets are put together at a close distance, then the like poles will repel each other and the opposite poles will attract each other. Mike starts by laying one magnet horizontally on the table. During each following step Mike adds one more magnet horizontally to the right end of the row. Depending on how Mike puts the magnet on the table, it is either attracted to the previous one (forming a group of multiple magnets linked together) or repelled by it (then Mike lays this magnet at some distance to the right from the previous one). We assume that a sole magnet not linked to others forms a group of its own. Mike arranged multiple magnets in a row. Determine the number of groups that the magnets formed. Input Specification: The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100000) — the number of magnets. Then *n* lines follow. The *i*-th line (1<=≤<=*i*<=≤<=*n*) contains either characters "01", if Mike put the *i*-th magnet in the "plus-minus" position, or characters "10", if Mike put the magnet in the "minus-plus" position. Output Specification: On the single line of the output print the number of groups of magnets. Demo Input: ['6\n10\n10\n10\n01\n10\n10\n', '4\n01\n01\n10\n10\n'] Demo Output: ['3\n', '2\n'] Note: The first testcase corresponds to the figure. The testcase has three groups consisting of three, one and two magnets. The second testcase has two groups, each consisting of two magnets.

```python n=int(input()) magnets=[] for i in range(n): magnet=input() magnets.append(magnet) x=1 for i in range(n-1): if magnets[i]==magnets[i+1]: x=x else: x+=1 print(x) ```

3

158

B

Taxi

PROGRAMMING

1,100

[ "*special", "greedy", "implementation" ]

null

After the lessons *n* groups of schoolchildren went outside and decided to visit Polycarpus to celebrate his birthday. We know that the *i*-th group consists of *s**i* friends (1<=≤<=*s**i*<=≤<=4), and they want to go to Polycarpus together. They decided to get there by taxi. Each car can carry at most four passengers. What minimum number of cars will the children need if all members of each group should ride in the same taxi (but one taxi can take more than one group)?

The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of groups of schoolchildren. The second line contains a sequence of integers *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*s**i*<=≤<=4). The integers are separated by a space, *s**i* is the number of children in the *i*-th group.

Print the single number — the minimum number of taxis necessary to drive all children to Polycarpus.

[ "5\n1 2 4 3 3\n", "8\n2 3 4 4 2 1 3 1\n" ]

[ "4\n", "5\n" ]

In the first test we can sort the children into four cars like this: - the third group (consisting of four children), - the fourth group (consisting of three children), - the fifth group (consisting of three children), - the first and the second group (consisting of one and two children, correspondingly). There are other ways to sort the groups into four cars.

1,000

[ { "input": "5\n1 2 4 3 3", "output": "4" }, { "input": "8\n2 3 4 4 2 1 3 1", "output": "5" }, { "input": "5\n4 4 4 4 4", "output": "5" }, { "input": "12\n1 1 1 1 1 1 1 1 1 1 1 1", "output": "3" }, { "input": "2\n2 1", "output": "1" }, { "input": "4\n3 2 1 3", "output": "3" }, { "input": "4\n2 4 1 3", "output": "3" }, { "input": "1\n1", "output": "1" }, { "input": "1\n2", "output": "1" }, { "input": "1\n3", "output": "1" }, { "input": "1\n4", "output": "1" }, { "input": "2\n1 1", "output": "1" }, { "input": "2\n2 2", "output": "1" }, { "input": "2\n3 3", "output": "2" }, { "input": "2\n4 4", "output": "2" }, { "input": "2\n2 1", "output": "1" }, { "input": "2\n3 1", "output": "1" }, { "input": "2\n4 1", "output": "2" }, { "input": "2\n2 3", "output": "2" }, { "input": "2\n4 2", "output": "2" }, { "input": "2\n4 3", "output": "2" }, { "input": "4\n2 2 1 1", "output": "2" }, { "input": "4\n3 1 3 1", "output": "2" }, { "input": "4\n1 4 1 4", "output": "3" }, { "input": "4\n2 2 3 3", "output": "3" }, { "input": "4\n2 4 4 2", "output": "3" }, { "input": "4\n3 3 4 4", "output": "4" }, { "input": "3\n1 1 2", "output": "1" }, { "input": "3\n1 3 1", "output": "2" }, { "input": "3\n4 1 1", "output": "2" }, { "input": "3\n3 2 2", "output": "2" }, { "input": "3\n2 4 2", "output": "2" }, { "input": "3\n3 4 3", "output": "3" }, { "input": "3\n2 2 1", "output": "2" }, { "input": "3\n1 3 3", "output": "2" }, { "input": "3\n4 4 1", "output": "3" }, { "input": "3\n3 3 2", "output": "3" }, { "input": "3\n4 2 4", "output": "3" }, { "input": "3\n4 3 4", "output": "3" }, { "input": "3\n4 3 2", "output": "3" }, { "input": "3\n3 1 4", "output": "2" }, { "input": "3\n2 1 4", "output": "2" }, { "input": "3\n3 1 2", "output": "2" }, { "input": "4\n4 4 3 2", "output": "4" }, { "input": "4\n1 4 3 1", "output": "3" }, { "input": "4\n2 2 4 1", "output": "3" }, { "input": "4\n3 2 1 2", "output": "2" }, { "input": "5\n2 4 2 3 4", "output": "4" }, { "input": "5\n1 3 4 1 3", "output": "3" }, { "input": "5\n1 1 2 4 2", "output": "3" }, { "input": "5\n1 3 2 3 2", "output": "3" }, { "input": "8\n1 1 2 1 1 1 3 2", "output": "3" }, { "input": "78\n2 2 2 2 3 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 3 2 2 2 2 2 2 2 1 1 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2", "output": "39" }, { "input": "7\n2 2 2 1 2 1 2", "output": "3" }, { "input": "9\n3 1 2 1 1 1 1 1 1", "output": "3" }, { "input": "10\n3 1 2 2 2 2 2 2 1 2", "output": "5" }, { "input": "18\n1 3 3 3 1 1 3 1 1 1 3 3 3 3 1 3 1 1", "output": "9" }, { "input": "26\n3 1 3 3 1 3 2 3 1 3 3 2 1 2 3 2 2 1 2 1 2 1 1 3 2 1", "output": "13" } ]

1,696,916,292

2,147,483,647

PyPy 3-64

WRONG_ANSWER

TESTS

0

92

0

groupnum = int(input()) fgroups = input().split() groups = [] agroups = [] for g in fgroups: groups.append(int(g)) groups.sort() counter = 0 taxis = [] for grp in groups: if len(taxis) == 0: taxis.append(grp) if grp == 4: taxis.append(4) elif 4-grp in taxis: index = taxis.index(4-grp) taxis[index] = 4 elif 3-grp in taxis and grp < 3: index = taxis.index(3-grp) taxis[index] = 3 elif 2-grp in taxis and grp < 2: index = taxis.index(2-grp) taxis[index] = 2 else: taxis.append(grp) print(str(len(taxis))) print(str(counter))

Title: Taxi Time Limit: None seconds Memory Limit: None megabytes Problem Description: After the lessons *n* groups of schoolchildren went outside and decided to visit Polycarpus to celebrate his birthday. We know that the *i*-th group consists of *s**i* friends (1<=≤<=*s**i*<=≤<=4), and they want to go to Polycarpus together. They decided to get there by taxi. Each car can carry at most four passengers. What minimum number of cars will the children need if all members of each group should ride in the same taxi (but one taxi can take more than one group)? Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of groups of schoolchildren. The second line contains a sequence of integers *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*s**i*<=≤<=4). The integers are separated by a space, *s**i* is the number of children in the *i*-th group. Output Specification: Print the single number — the minimum number of taxis necessary to drive all children to Polycarpus. Demo Input: ['5\n1 2 4 3 3\n', '8\n2 3 4 4 2 1 3 1\n'] Demo Output: ['4\n', '5\n'] Note: In the first test we can sort the children into four cars like this: - the third group (consisting of four children), - the fourth group (consisting of three children), - the fifth group (consisting of three children), - the first and the second group (consisting of one and two children, correspondingly). There are other ways to sort the groups into four cars.

```python groupnum = int(input()) fgroups = input().split() groups = [] agroups = [] for g in fgroups: groups.append(int(g)) groups.sort() counter = 0 taxis = [] for grp in groups: if len(taxis) == 0: taxis.append(grp) if grp == 4: taxis.append(4) elif 4-grp in taxis: index = taxis.index(4-grp) taxis[index] = 4 elif 3-grp in taxis and grp < 3: index = taxis.index(3-grp) taxis[index] = 3 elif 2-grp in taxis and grp < 2: index = taxis.index(2-grp) taxis[index] = 2 else: taxis.append(grp) print(str(len(taxis))) print(str(counter)) ```

0

483

A

Counterexample

PROGRAMMING

1,100

[ "brute force", "implementation", "math", "number theory" ]

null

Your friend has recently learned about coprime numbers. A pair of numbers {*a*,<=*b*} is called coprime if the maximum number that divides both *a* and *b* is equal to one. Your friend often comes up with different statements. He has recently supposed that if the pair (*a*,<=*b*) is coprime and the pair (*b*,<=*c*) is coprime, then the pair (*a*,<=*c*) is coprime. You want to find a counterexample for your friend's statement. Therefore, your task is to find three distinct numbers (*a*,<=*b*,<=*c*), for which the statement is false, and the numbers meet the condition *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*. More specifically, you need to find three numbers (*a*,<=*b*,<=*c*), such that *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*, pairs (*a*,<=*b*) and (*b*,<=*c*) are coprime, and pair (*a*,<=*c*) is not coprime.

The single line contains two positive space-separated integers *l*, *r* (1<=≤<=*l*<=≤<=*r*<=≤<=1018; *r*<=-<=*l*<=≤<=50).

Print three positive space-separated integers *a*, *b*, *c* — three distinct numbers (*a*,<=*b*,<=*c*) that form the counterexample. If there are several solutions, you are allowed to print any of them. The numbers must be printed in ascending order. If the counterexample does not exist, print the single number -1.

[ "2 4\n", "10 11\n", "900000000000000009 900000000000000029\n" ]

[ "2 3 4\n", "-1\n", "900000000000000009 900000000000000010 900000000000000021\n" ]

In the first sample pair (2, 4) is not coprime and pairs (2, 3) and (3, 4) are. In the second sample you cannot form a group of three distinct integers, so the answer is -1. In the third sample it is easy to see that numbers 900000000000000009 and 900000000000000021 are divisible by three.

500

[ { "input": "2 4", "output": "2 3 4" }, { "input": "10 11", "output": "-1" }, { "input": "900000000000000009 900000000000000029", "output": "900000000000000009 900000000000000010 900000000000000021" }, { "input": "640097987171091791 640097987171091835", "output": "640097987171091792 640097987171091793 640097987171091794" }, { "input": "19534350415104721 19534350415104725", "output": "19534350415104722 19534350415104723 19534350415104724" }, { "input": "933700505788726243 933700505788726280", "output": "933700505788726244 933700505788726245 933700505788726246" }, { "input": "1 3", "output": "-1" }, { "input": "1 4", "output": "2 3 4" }, { "input": "1 1", "output": "-1" }, { "input": "266540997167959130 266540997167959164", "output": "266540997167959130 266540997167959131 266540997167959132" }, { "input": "267367244641009850 267367244641009899", "output": "267367244641009850 267367244641009851 267367244641009852" }, { "input": "268193483524125978 268193483524125993", "output": "268193483524125978 268193483524125979 268193483524125980" }, { "input": "269019726702209402 269019726702209432", "output": "269019726702209402 269019726702209403 269019726702209404" }, { "input": "269845965585325530 269845965585325576", "output": "269845965585325530 269845965585325531 269845965585325532" }, { "input": "270672213058376250 270672213058376260", "output": "270672213058376250 270672213058376251 270672213058376252" }, { "input": "271498451941492378 271498451941492378", "output": "-1" }, { "input": "272324690824608506 272324690824608523", "output": "272324690824608506 272324690824608507 272324690824608508" }, { "input": "273150934002691930 273150934002691962", "output": "273150934002691930 273150934002691931 273150934002691932" }, { "input": "996517375802030516 996517375802030524", "output": "996517375802030516 996517375802030517 996517375802030518" }, { "input": "997343614685146644 997343614685146694", "output": "997343614685146644 997343614685146645 997343614685146646" }, { "input": "998169857863230068 998169857863230083", "output": "998169857863230068 998169857863230069 998169857863230070" }, { "input": "998996101041313492 998996101041313522", "output": "998996101041313492 998996101041313493 998996101041313494" }, { "input": "999822344219396916 999822344219396961", "output": "999822344219396916 999822344219396917 999822344219396918" }, { "input": "648583102513043 648583102513053", "output": "648583102513044 648583102513045 648583102513046" }, { "input": "266540997167959130 266540997167959131", "output": "-1" }, { "input": "267367244641009850 267367244641009850", "output": "-1" }, { "input": "268193483524125978 268193483524125979", "output": "-1" }, { "input": "269019726702209402 269019726702209402", "output": "-1" }, { "input": "269845965585325530 269845965585325530", "output": "-1" }, { "input": "270672213058376250 270672213058376254", "output": "270672213058376250 270672213058376251 270672213058376252" }, { "input": "271498451941492378 271498451941492379", "output": "-1" }, { "input": "272324690824608506 272324690824608508", "output": "272324690824608506 272324690824608507 272324690824608508" }, { "input": "273150934002691930 273150934002691931", "output": "-1" }, { "input": "996517375802030516 996517375802030518", "output": "996517375802030516 996517375802030517 996517375802030518" }, { "input": "997343614685146644 997343614685146644", "output": "-1" }, { "input": "2147483647 2147483649", "output": "-1" }, { "input": "3 5", "output": "-1" }, { "input": "1 7", "output": "2 3 4" }, { "input": "9 12", "output": "9 11 12" }, { "input": "4 4", "output": "-1" }, { "input": "11 13", "output": "-1" }, { "input": "2 2", "output": "-1" } ]

1,641,595,494

2,147,483,647

PyPy 3

OK

TESTS

42

77

1,331,200

import math l, r = map(int, input().split()) def is_coprime(a, b): return math.gcd(a,b) == 1 for i in range(l, r - 1): for j in range(i + 1, r): for k in range(j + 1, r + 1): if is_coprime(i, j) and is_coprime(j, k) and not is_coprime(i, k): print(i, j, k) exit() print(-1)

Title: Counterexample Time Limit: None seconds Memory Limit: None megabytes Problem Description: Your friend has recently learned about coprime numbers. A pair of numbers {*a*,<=*b*} is called coprime if the maximum number that divides both *a* and *b* is equal to one. Your friend often comes up with different statements. He has recently supposed that if the pair (*a*,<=*b*) is coprime and the pair (*b*,<=*c*) is coprime, then the pair (*a*,<=*c*) is coprime. You want to find a counterexample for your friend's statement. Therefore, your task is to find three distinct numbers (*a*,<=*b*,<=*c*), for which the statement is false, and the numbers meet the condition *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*. More specifically, you need to find three numbers (*a*,<=*b*,<=*c*), such that *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*, pairs (*a*,<=*b*) and (*b*,<=*c*) are coprime, and pair (*a*,<=*c*) is not coprime. Input Specification: The single line contains two positive space-separated integers *l*, *r* (1<=≤<=*l*<=≤<=*r*<=≤<=1018; *r*<=-<=*l*<=≤<=50). Output Specification: Print three positive space-separated integers *a*, *b*, *c* — three distinct numbers (*a*,<=*b*,<=*c*) that form the counterexample. If there are several solutions, you are allowed to print any of them. The numbers must be printed in ascending order. If the counterexample does not exist, print the single number -1. Demo Input: ['2 4\n', '10 11\n', '900000000000000009 900000000000000029\n'] Demo Output: ['2 3 4\n', '-1\n', '900000000000000009 900000000000000010 900000000000000021\n'] Note: In the first sample pair (2, 4) is not coprime and pairs (2, 3) and (3, 4) are. In the second sample you cannot form a group of three distinct integers, so the answer is -1. In the third sample it is easy to see that numbers 900000000000000009 and 900000000000000021 are divisible by three.

```python import math l, r = map(int, input().split()) def is_coprime(a, b): return math.gcd(a,b) == 1 for i in range(l, r - 1): for j in range(i + 1, r): for k in range(j + 1, r + 1): if is_coprime(i, j) and is_coprime(j, k) and not is_coprime(i, k): print(i, j, k) exit() print(-1) ```

3

284

A

Cows and Primitive Roots

PROGRAMMING

1,400

[ "implementation", "math", "number theory" ]

null

The cows have just learned what a primitive root is! Given a prime *p*, a primitive root is an integer *x* (1<=≤<=*x*<=<<=*p*) such that none of integers *x*<=-<=1,<=*x*2<=-<=1,<=...,<=*x**p*<=-<=2<=-<=1 are divisible by *p*, but *x**p*<=-<=1<=-<=1 is. Unfortunately, computing primitive roots can be time consuming, so the cows need your help. Given a prime *p*, help the cows find the number of primitive roots .

The input contains a single line containing an integer *p* (2<=≤<=*p*<=<<=2000). It is guaranteed that *p* is a prime.

Output on a single line the number of primitive roots .

[ "3\n", "5\n" ]

[ "1\n", "2\n" ]

The only primitive root <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/3722298ba062e95b18705d1253eb4e5d31e3b2d1.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 2. The primitive roots <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1d85c6a17ef1c42b53cf94d00bc49a7ac458fd58.png" style="max-width: 100.0%;max-height: 100.0%;"/> are 2 and 3.

500

[ { "input": "3", "output": "1" }, { "input": "5", "output": "2" }, { "input": "7", "output": "2" }, { "input": "11", "output": "4" }, { "input": "17", "output": "8" }, { "input": "19", "output": "6" }, { "input": "1583", "output": "672" }, { "input": "997", "output": "328" }, { "input": "2", "output": "1" }, { "input": "1987", "output": "660" }, { "input": "1993", "output": "656" }, { "input": "1997", "output": "996" }, { "input": "1999", "output": "648" }, { "input": "1297", "output": "432" }, { "input": "163", "output": "54" }, { "input": "1259", "output": "576" }, { "input": "821", "output": "320" }, { "input": "29", "output": "12" }, { "input": "43", "output": "12" }, { "input": "1949", "output": "972" }, { "input": "1879", "output": "624" }, { "input": "1759", "output": "584" }, { "input": "1597", "output": "432" }, { "input": "1619", "output": "808" }, { "input": "1277", "output": "560" }, { "input": "1097", "output": "544" }, { "input": "953", "output": "384" }, { "input": "751", "output": "200" }, { "input": "607", "output": "200" }, { "input": "509", "output": "252" }, { "input": "431", "output": "168" }, { "input": "317", "output": "156" }, { "input": "211", "output": "48" }, { "input": "127", "output": "36" }, { "input": "101", "output": "40" }, { "input": "31", "output": "8" } ]

1,687,541,484

2,147,483,647

PyPy 3-64

TIME_LIMIT_EXCEEDED

TESTS

6

2,000

4,608,000

p=int(input()) c=0 for i in range(1,p): if (i**(p-1)-1)%p==0: for j in range(1,p-1): if ((i**j)-1)%p!=0: continue else: break else: c+=1 print(c)

Title: Cows and Primitive Roots Time Limit: None seconds Memory Limit: None megabytes Problem Description: The cows have just learned what a primitive root is! Given a prime *p*, a primitive root is an integer *x* (1<=≤<=*x*<=<<=*p*) such that none of integers *x*<=-<=1,<=*x*2<=-<=1,<=...,<=*x**p*<=-<=2<=-<=1 are divisible by *p*, but *x**p*<=-<=1<=-<=1 is. Unfortunately, computing primitive roots can be time consuming, so the cows need your help. Given a prime *p*, help the cows find the number of primitive roots . Input Specification: The input contains a single line containing an integer *p* (2<=≤<=*p*<=<<=2000). It is guaranteed that *p* is a prime. Output Specification: Output on a single line the number of primitive roots . Demo Input: ['3\n', '5\n'] Demo Output: ['1\n', '2\n'] Note: The only primitive root <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/3722298ba062e95b18705d1253eb4e5d31e3b2d1.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 2. The primitive roots <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1d85c6a17ef1c42b53cf94d00bc49a7ac458fd58.png" style="max-width: 100.0%;max-height: 100.0%;"/> are 2 and 3.

```python p=int(input()) c=0 for i in range(1,p): if (i**(p-1)-1)%p==0: for j in range(1,p-1): if ((i**j)-1)%p!=0: continue else: break else: c+=1 print(c) ```

0

686

A

Free Ice Cream

PROGRAMMING

800

[ "constructive algorithms", "implementation" ]

null

After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer. At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue). If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress. Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.

The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109). Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.

Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.

[ "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n", "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n" ]

[ "22 1\n", "3 2\n" ]

Consider the first sample. 1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.

500

[ { "input": "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20", "output": "22 1" }, { "input": "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98", "output": "3 2" }, { "input": "6 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000", "output": "7000000000 0" }, { "input": "5 12\n- 12\n+ 7\n- 6\n- 1\n+ 46", "output": "46 0" }, { "input": "11 1000\n- 100\n+ 100\n+ 100\n+ 100\n+ 100\n- 100\n- 100\n- 100\n- 100\n- 100\n- 100", "output": "700 0" }, { "input": "1 0\n- 526403222", "output": "0 1" }, { "input": "1 897986543\n- 371188251", "output": "526798292 0" }, { "input": "1 0\n+ 1", "output": "1 0" }, { "input": "1 0\n- 1", "output": "0 1" }, { "input": "1 10\n+ 10", "output": "20 0" }, { "input": "1 3\n- 5", "output": "3 1" }, { "input": "1 0\n- 5", "output": "0 1" }, { "input": "1 0\n+ 5", "output": "5 0" } ]

1,694,250,552

2,147,483,647

Python 3

WRONG_ANSWER

TESTS

7

46

0

n, x = map(int, input().split()) s = 0 for i in range(n): a = [str(x) for x in input().split()] if a[0] == "+": x += int(a[1]) elif a[0] == "-" and x > int(a[1]): x -= int(a[1]) else: s += 1 print(x, s, end=" ")

Title: Free Ice Cream Time Limit: None seconds Memory Limit: None megabytes Problem Description: After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer. At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue). If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress. Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids. Input Specification: The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109). Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place. Output Specification: Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress. Demo Input: ['5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n', '5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n'] Demo Output: ['22 1\n', '3 2\n'] Note: Consider the first sample. 1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.

```python n, x = map(int, input().split()) s = 0 for i in range(n): a = [str(x) for x in input().split()] if a[0] == "+": x += int(a[1]) elif a[0] == "-" and x > int(a[1]): x -= int(a[1]) else: s += 1 print(x, s, end=" ") ```

0

722

B

Verse Pattern

PROGRAMMING

1,200

[ "implementation", "strings" ]

null

You are given a text consisting of *n* lines. Each line contains some space-separated words, consisting of lowercase English letters. We define a syllable as a string that contains exactly one vowel and any arbitrary number (possibly none) of consonants. In English alphabet following letters are considered to be vowels: 'a', 'e', 'i', 'o', 'u' and 'y'. Each word of the text that contains at least one vowel can be divided into syllables. Each character should be a part of exactly one syllable. For example, the word "mamma" can be divided into syllables as "ma" and "mma", "mam" and "ma", and "mamm" and "a". Words that consist of only consonants should be ignored. The verse patterns for the given text is a sequence of *n* integers *p*1,<=*p*2,<=...,<=*p**n*. Text matches the given verse pattern if for each *i* from 1 to *n* one can divide words of the *i*-th line in syllables in such a way that the total number of syllables is equal to *p**i*. You are given the text and the verse pattern. Check, if the given text matches the given verse pattern.

The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the text. The second line contains integers *p*1,<=...,<=*p**n* (0<=≤<=*p**i*<=≤<=100) — the verse pattern. Next *n* lines contain the text itself. Text consists of lowercase English letters and spaces. It's guaranteed that all lines are non-empty, each line starts and ends with a letter and words are separated by exactly one space. The length of each line doesn't exceed 100 characters.

If the given text matches the given verse pattern, then print "YES" (without quotes) in the only line of the output. Otherwise, print "NO" (without quotes).

[ "3\n2 2 3\nintel\ncode\nch allenge\n", "4\n1 2 3 1\na\nbcdefghi\njklmnopqrstu\nvwxyz\n", "4\n13 11 15 15\nto be or not to be that is the question\nwhether tis nobler in the mind to suffer\nthe slings and arrows of outrageous fortune\nor to take arms against a sea of troubles\n" ]

[ "YES\n", "NO\n", "YES\n" ]

In the first sample, one can split words into syllables in the following way: Since the word "ch" in the third line doesn't contain vowels, we can ignore it. As the result we get 2 syllabels in first two lines and 3 syllables in the third one.

500

[ { "input": "3\n2 2 3\nintel\ncode\nch allenge", "output": "YES" }, { "input": "4\n1 2 3 1\na\nbcdefghi\njklmnopqrstu\nvwxyz", "output": "NO" }, { "input": "4\n13 11 15 15\nto be or not to be that is the question\nwhether tis nobler in the mind to suffer\nthe slings and arrows of outrageous fortune\nor to take arms against a sea of troubles", "output": "YES" }, { "input": "5\n2 2 1 1 1\nfdbie\naaj\ni\ni n\nshi", "output": "YES" }, { "input": "5\n2 11 10 7 9\nhy of\nyur pjyacbatdoylojayu\nemd ibweioiimyxya\nyocpyivudobua\nuiraueect impxqhzpty e", "output": "NO" }, { "input": "5\n6 9 7 3 10\nabtbdaa\nom auhz ub iaravozegs\ncieulibsdhj ufki\nadu pnpurt\nh naony i jaysjsjxpwuuc", "output": "NO" }, { "input": "2\n26 35\ngouojxaoobw iu bkaadyo degnjkubeabt kbap thwki dyebailrhnoh ooa\npiaeaebaocptyswuc wezesazipu osebhaonouygasjrciyiqaejtqsioubiuakg umynbsvw xpfqdwxo", "output": "NO" }, { "input": "5\n1 0 0 1 1\ngqex\nw\nh\nzsvu\nqcqd", "output": "NO" }, { "input": "5\n0 0 0 0 0\njtv\nl\nqg\ntp\nfgd", "output": "YES" }, { "input": "10\n0 0 0 0 0 0 0 0 0 0\nj t fr\nn\nnhcgx\np\nmb hmhtz\ndbjc\ncwdxj\nn j whkbt\nzk m cwh\nqr n", "output": "YES" }, { "input": "5\n4 5 1 0 0\noa\nqfohq\ni l\naik\nx", "output": "NO" }, { "input": "10\n2 9 0 3 2 4 1 2 4 2\nxtwl oy\nafgeju fi\nr hy\nddsowagw\nxoredo f\nwufnxy k uh\nod\nlejrinw\nsueecohfjl\nedufg", "output": "NO" }, { "input": "10\n1 1 0 0 0 4 0 4 0 0\na bn\nhnwss f\nd s bn\nbdzxzgsxq\nghh v\neimblv i er\nca kn k\nzm ffc zcb\nn\nz hkhvfkwhg", "output": "NO" }, { "input": "5\n0 10 6 6 0\nfgthrxst\nsohnweymewnnmbobj\nj\nfwwt acdtfvkpv khbxokn\nhndovkkgfhnhqod", "output": "NO" }, { "input": "5\n3 2 2 4 2\ni yu\niu\noa\naiio\nuo", "output": "YES" }, { "input": "5\n11 12 11 4 6\nuuuayoiaoiy\nuaiee iai eieu\nooayaayeuee\noii o\noea uuo", "output": "YES" }, { "input": "3\n2 3 2\nintel\ncode\nch allenge", "output": "NO" }, { "input": "2\n1 2\ncode\na", "output": "NO" }, { "input": "2\n1 1\nbababa\nbababa", "output": "NO" }, { "input": "1\n1\naa", "output": "NO" }, { "input": "1\n1\naaa", "output": "NO" }, { "input": "2\n2 3\naee\nae", "output": "NO" } ]

1,680,902,526

2,147,483,647

PyPy 3-64

OK

TESTS

54

62

1,638,400

n = int(input()) p = [int(x) for x in input().split()] lines = [] for i in range(n): lines.append(input()) for i in range(n): total = 0 for letter in lines[i]: if letter in 'aeiouy': total += 1 if total != p[i]: print('NO') break else: print('YES')

Title: Verse Pattern Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a text consisting of *n* lines. Each line contains some space-separated words, consisting of lowercase English letters. We define a syllable as a string that contains exactly one vowel and any arbitrary number (possibly none) of consonants. In English alphabet following letters are considered to be vowels: 'a', 'e', 'i', 'o', 'u' and 'y'. Each word of the text that contains at least one vowel can be divided into syllables. Each character should be a part of exactly one syllable. For example, the word "mamma" can be divided into syllables as "ma" and "mma", "mam" and "ma", and "mamm" and "a". Words that consist of only consonants should be ignored. The verse patterns for the given text is a sequence of *n* integers *p*1,<=*p*2,<=...,<=*p**n*. Text matches the given verse pattern if for each *i* from 1 to *n* one can divide words of the *i*-th line in syllables in such a way that the total number of syllables is equal to *p**i*. You are given the text and the verse pattern. Check, if the given text matches the given verse pattern. Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the text. The second line contains integers *p*1,<=...,<=*p**n* (0<=≤<=*p**i*<=≤<=100) — the verse pattern. Next *n* lines contain the text itself. Text consists of lowercase English letters and spaces. It's guaranteed that all lines are non-empty, each line starts and ends with a letter and words are separated by exactly one space. The length of each line doesn't exceed 100 characters. Output Specification: If the given text matches the given verse pattern, then print "YES" (without quotes) in the only line of the output. Otherwise, print "NO" (without quotes). Demo Input: ['3\n2 2 3\nintel\ncode\nch allenge\n', '4\n1 2 3 1\na\nbcdefghi\njklmnopqrstu\nvwxyz\n', '4\n13 11 15 15\nto be or not to be that is the question\nwhether tis nobler in the mind to suffer\nthe slings and arrows of outrageous fortune\nor to take arms against a sea of troubles\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n'] Note: In the first sample, one can split words into syllables in the following way: Since the word "ch" in the third line doesn't contain vowels, we can ignore it. As the result we get 2 syllabels in first two lines and 3 syllables in the third one.

```python n = int(input()) p = [int(x) for x in input().split()] lines = [] for i in range(n): lines.append(input()) for i in range(n): total = 0 for letter in lines[i]: if letter in 'aeiouy': total += 1 if total != p[i]: print('NO') break else: print('YES') ```

3

380

C

Sereja and Brackets

PROGRAMMING

2,000

[ "data structures", "schedules" ]

null

Sereja has a bracket sequence *s*1,<=*s*2,<=...,<=*s**n*, or, in other words, a string *s* of length *n*, consisting of characters "(" and ")". Sereja needs to answer *m* queries, each of them is described by two integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). The answer to the *i*-th query is the length of the maximum correct bracket subsequence of sequence *s**l**i*,<=*s**l**i*<=+<=1,<=...,<=*s**r**i*. Help Sereja answer all queries. You can find the definitions for a subsequence and a correct bracket sequence in the notes.

The first line contains a sequence of characters *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*n*<=≤<=106) without any spaces. Each character is either a "(" or a ")". The second line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains a pair of integers. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*) — the description of the *i*-th query.

Print the answer to each question on a single line. Print the answers in the order they go in the input.

[ "())(())(())(\n7\n1 1\n2 3\n1 2\n1 12\n8 12\n5 11\n2 10\n" ]

[ "0\n0\n2\n10\n4\n6\n6\n" ]

A subsequence of length |*x*| of string *s* = *s*1*s*2... *s*|*s*| (where |*s*| is the length of string *s*) is string *x* = *s**k*1*s**k*2... *s**k*|*x*| (1 ≤ *k*1 < *k*2 < ... < *k*|*x*| ≤ |*s*|). A correct bracket sequence is a bracket sequence that can be transformed into a correct aryphmetic expression by inserting characters "1" and "+" between the characters of the string. For example, bracket sequences "()()", "(())" are correct (the resulting expressions "(1)+(1)", "((1+1)+1)"), and ")(" and "(" are not. For the third query required sequence will be «()». For the fourth query required sequence will be «()(())(())».

1,500

[ { "input": "())(())(())(\n7\n1 1\n2 3\n1 2\n1 12\n8 12\n5 11\n2 10", "output": "0\n0\n2\n10\n4\n6\n6" }, { "input": "(((((()((((((((((()((()(((((\n1\n8 15", "output": "0" }, { "input": "((()((())(((((((((()(()(()(((((((((((((((()(()((((((((((((((()(((((((((((((((((((()(((\n39\n28 56\n39 46\n57 63\n29 48\n51 75\n14 72\n5 70\n51 73\n10 64\n31 56\n50 54\n15 78\n78 82\n1 11\n1 70\n1 19\n10 22\n13 36\n3 10\n34 40\n51 76\n64 71\n36 75\n24 71\n1 63\n5 14\n46 67\n32 56\n39 43\n43 56\n61 82\n2 78\n1 21\n10 72\n49 79\n12 14\n53 79\n15 31\n7 47", "output": "4\n4\n2\n4\n2\n12\n16\n2\n12\n4\n0\n12\n0\n6\n18\n6\n2\n6\n6\n0\n2\n0\n6\n8\n18\n4\n2\n4\n2\n2\n2\n18\n8\n12\n2\n0\n2\n6\n12" }, { "input": "))(()))))())())))))())((()()))))()))))))))))))\n9\n26 42\n21 22\n6 22\n7 26\n43 46\n25 27\n32 39\n22 40\n2 45", "output": "4\n0\n6\n8\n0\n2\n2\n10\n20" }, { "input": "(()((((()(())((((((((()((((((()((((\n71\n15 29\n17 18\n5 26\n7 10\n16 31\n26 35\n2 30\n16 24\n2 24\n7 12\n15 18\n12 13\n25 30\n1 30\n12 13\n16 20\n6 35\n20 28\n18 23\n9 31\n12 35\n14 17\n8 16\n3 10\n12 33\n7 19\n2 33\n7 17\n21 27\n10 30\n29 32\n9 28\n18 32\n28 31\n31 33\n4 26\n15 27\n10 17\n8 14\n11 28\n8 23\n17 33\n4 14\n3 6\n6 34\n19 23\n4 21\n16 27\n14 27\n6 19\n31 32\n29 32\n9 17\n1 21\n2 31\n18 29\n16 26\n15 18\n4 5\n13 20\n9 28\n18 30\n1 32\n2 9\n16 24\n1 20\n4 15\n16 23\n19 34\n5 22\n5 23", "output": "2\n0\n8\n2\n4\n2\n10\n2\n10\n4\n0\n0\n0\n10\n0\n0\n10\n2\n2\n8\n4\n0\n6\n2\n4\n6\n12\n6\n2\n6\n2\n6\n4\n2\n0\n8\n2\n4\n6\n4\n8\n4\n6\n0\n10\n2\n6\n2\n2\n6\n0\n2\n4\n8\n12\n2\n2\n0\n0\n0\n6\n2\n12\n4\n2\n8\n6\n2\n4\n6\n8" }, { "input": "(((())((((()()((((((()((()(((((((((((()((\n6\n20 37\n28 32\n12 18\n7 25\n21 33\n4 5", "output": "4\n0\n2\n6\n4\n2" }, { "input": "(((()((((()()()(()))((((()(((()))()((((()))()((())\n24\n37 41\n13 38\n31 34\n14 16\n29 29\n12 46\n1 26\n15 34\n8 47\n11 23\n6 32\n2 22\n9 27\n17 40\n6 15\n4 49\n12 33\n3 48\n22 47\n19 48\n10 27\n23 25\n4 44\n27 48", "output": "2\n16\n0\n2\n0\n26\n16\n12\n30\n8\n18\n14\n14\n12\n6\n34\n16\n32\n18\n18\n12\n0\n30\n16" }, { "input": ")()((((((((((((((((()(((()()(()((((((()(((((((()()))((((())(((((((((()(((((((((\n51\n29 53\n31 69\n54 59\n3 52\n26 46\n14 62\n6 54\n39 56\n17 27\n46 74\n60 72\n18 26\n38 46\n4 27\n22 52\n44 49\n42 77\n2 20\n39 57\n61 70\n33 54\n10 30\n67 70\n46 66\n17 77\n5 52\n33 77\n26 32\n1 72\n40 78\n38 68\n19 47\n30 53\n19 29\n52 71\n1 11\n22 53\n17 42\n2 51\n4 12\n24 76\n22 34\n21 69\n11 69\n36 52\n17 31\n57 58\n54 62\n23 71\n5 46\n51 53", "output": "12\n14\n4\n18\n6\n22\n18\n8\n4\n12\n2\n4\n2\n4\n16\n2\n14\n2\n8\n2\n10\n6\n2\n10\n24\n18\n16\n4\n26\n14\n14\n10\n12\n6\n6\n2\n16\n10\n18\n0\n22\n6\n20\n22\n10\n8\n2\n4\n22\n10\n0" }, { "input": "(\n1\n1 1", "output": "0" }, { "input": ")\n1\n1 1", "output": "0" }, { "input": "()\n1\n1 2", "output": "2" }, { "input": ")(\n1\n1 2", "output": "0" } ]

1,688,373,182

2,147,483,647

PyPy 3-64

TIME_LIMIT_EXCEEDED

TESTS

12

1,000

148,684,800

import sys import os from io import BytesIO, IOBase MOD = 10**9+7 BUFSIZE = 8192 class FastIO(IOBase): newlines = 0 def __init__(self, file): self._fd = file.fileno() self.buffer = BytesIO() self.writable = "x" in file.mode or "r" not in file.mode self.write = self.buffer.write if self.writable else None def read(self): while True: b = os.read(self._fd, max(os.fstat(self._fd).st_size, BUFSIZE)) if not b: break ptr = self.buffer.tell() self.buffer.seek(0, 2), self.buffer.write(b), self.buffer.seek(ptr) self.newlines = 0 return self.buffer.read() def readline(self): while self.newlines == 0: b = os.read(self._fd, max(os.fstat(self._fd).st_size, BUFSIZE)) self.newlines = b.count(b"\n") + (not b) ptr = self.buffer.tell() self.buffer.seek(0, 2), self.buffer.write(b), self.buffer.seek(ptr) self.newlines -= 1 return self.buffer.readline() def flush(self): if self.writable: os.write(self._fd, self.buffer.getvalue()) self.buffer.truncate(0), self.buffer.seek(0) class IOWrapper(IOBase): def __init__(self, file): self.buffer = FastIO(file) self.flush = self.buffer.flush self.writable = self.buffer.writable self.write = lambda s: self.buffer.write(s.encode("ascii")) self.read = lambda: self.buffer.read().decode("ascii") self.readline = lambda: self.buffer.readline().decode("ascii") input = sys.stdin.readline class Node: def __init__(self, ans, lp, rp): self.ans = ans self.lp = lp self.rp = rp def merge(a, b): match = min(a.lp, b.rp) ans = a.ans + b.ans + match lp = a.lp + b.lp - match rp = a.rp + b.rp - match return Node(ans, lp, rp) def build(l, r, i): if l == r: tree[i] = Node(0, 1 if str[l] == '(' else 0, 1 if str[l] == ')' else 0) return mid = (l + r) // 2 lc = 2 * i + 1 rc = 2 * i + 2 build(l, mid, lc) build(mid + 1, r, rc) tree[i] = merge(tree[lc], tree[rc]) def query(l, r, s, e, i): if s <= l and r <= e: return tree[i] if s > r or e < l: return Node(0, 0, 0) mid = (l + r) // 2 lc = 2 * i + 1 rc = 2 * i + 2 ln = query(l, mid, s, e, lc) rn = query(mid + 1, r, s, e, rc) return merge(ln, rn) str = input() n = len(str) tree = [None] * (4 * n) build(0, n - 1, 0) m = int(input()) for _ in range(m): s, e = map(int, input().split()) s -= 1 e -= 1 ansNode = query(0, n - 1, s, e, 0) print(2 * ansNode.ans)

Title: Sereja and Brackets Time Limit: None seconds Memory Limit: None megabytes Problem Description: Sereja has a bracket sequence *s*1,<=*s*2,<=...,<=*s**n*, or, in other words, a string *s* of length *n*, consisting of characters "(" and ")". Sereja needs to answer *m* queries, each of them is described by two integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). The answer to the *i*-th query is the length of the maximum correct bracket subsequence of sequence *s**l**i*,<=*s**l**i*<=+<=1,<=...,<=*s**r**i*. Help Sereja answer all queries. You can find the definitions for a subsequence and a correct bracket sequence in the notes. Input Specification: The first line contains a sequence of characters *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*n*<=≤<=106) without any spaces. Each character is either a "(" or a ")". The second line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains a pair of integers. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*) — the description of the *i*-th query. Output Specification: Print the answer to each question on a single line. Print the answers in the order they go in the input. Demo Input: ['())(())(())(\n7\n1 1\n2 3\n1 2\n1 12\n8 12\n5 11\n2 10\n'] Demo Output: ['0\n0\n2\n10\n4\n6\n6\n'] Note: A subsequence of length |*x*| of string *s* = *s*1*s*2... *s*|*s*| (where |*s*| is the length of string *s*) is string *x* = *s**k*1*s**k*2... *s**k*|*x*| (1 ≤ *k*1 < *k*2 < ... < *k*|*x*| ≤ |*s*|). A correct bracket sequence is a bracket sequence that can be transformed into a correct aryphmetic expression by inserting characters "1" and "+" between the characters of the string. For example, bracket sequences "()()", "(())" are correct (the resulting expressions "(1)+(1)", "((1+1)+1)"), and ")(" and "(" are not. For the third query required sequence will be «()». For the fourth query required sequence will be «()(())(())».

```python import sys import os from io import BytesIO, IOBase MOD = 10**9+7 BUFSIZE = 8192 class FastIO(IOBase): newlines = 0 def __init__(self, file): self._fd = file.fileno() self.buffer = BytesIO() self.writable = "x" in file.mode or "r" not in file.mode self.write = self.buffer.write if self.writable else None def read(self): while True: b = os.read(self._fd, max(os.fstat(self._fd).st_size, BUFSIZE)) if not b: break ptr = self.buffer.tell() self.buffer.seek(0, 2), self.buffer.write(b), self.buffer.seek(ptr) self.newlines = 0 return self.buffer.read() def readline(self): while self.newlines == 0: b = os.read(self._fd, max(os.fstat(self._fd).st_size, BUFSIZE)) self.newlines = b.count(b"\n") + (not b) ptr = self.buffer.tell() self.buffer.seek(0, 2), self.buffer.write(b), self.buffer.seek(ptr) self.newlines -= 1 return self.buffer.readline() def flush(self): if self.writable: os.write(self._fd, self.buffer.getvalue()) self.buffer.truncate(0), self.buffer.seek(0) class IOWrapper(IOBase): def __init__(self, file): self.buffer = FastIO(file) self.flush = self.buffer.flush self.writable = self.buffer.writable self.write = lambda s: self.buffer.write(s.encode("ascii")) self.read = lambda: self.buffer.read().decode("ascii") self.readline = lambda: self.buffer.readline().decode("ascii") input = sys.stdin.readline class Node: def __init__(self, ans, lp, rp): self.ans = ans self.lp = lp self.rp = rp def merge(a, b): match = min(a.lp, b.rp) ans = a.ans + b.ans + match lp = a.lp + b.lp - match rp = a.rp + b.rp - match return Node(ans, lp, rp) def build(l, r, i): if l == r: tree[i] = Node(0, 1 if str[l] == '(' else 0, 1 if str[l] == ')' else 0) return mid = (l + r) // 2 lc = 2 * i + 1 rc = 2 * i + 2 build(l, mid, lc) build(mid + 1, r, rc) tree[i] = merge(tree[lc], tree[rc]) def query(l, r, s, e, i): if s <= l and r <= e: return tree[i] if s > r or e < l: return Node(0, 0, 0) mid = (l + r) // 2 lc = 2 * i + 1 rc = 2 * i + 2 ln = query(l, mid, s, e, lc) rn = query(mid + 1, r, s, e, rc) return merge(ln, rn) str = input() n = len(str) tree = [None] * (4 * n) build(0, n - 1, 0) m = int(input()) for _ in range(m): s, e = map(int, input().split()) s -= 1 e -= 1 ansNode = query(0, n - 1, s, e, 0) print(2 * ansNode.ans) ```

0

933

A

A Twisty Movement

PROGRAMMING

1,800

[ "dp" ]

null

A dragon symbolizes wisdom, power and wealth. On Lunar New Year's Day, people model a dragon with bamboo strips and clothes, raise them with rods, and hold the rods high and low to resemble a flying dragon. A performer holding the rod low is represented by a 1, while one holding it high is represented by a 2. Thus, the line of performers can be represented by a sequence *a*1,<=*a*2,<=...,<=*a**n*. Little Tommy is among them. He would like to choose an interval [*l*,<=*r*] (1<=≤<=*l*<=≤<=*r*<=≤<=*n*), then reverse *a**l*,<=*a**l*<=+<=1,<=...,<=*a**r* so that the length of the longest non-decreasing subsequence of the new sequence is maximum. A non-decreasing subsequence is a sequence of indices *p*1,<=*p*2,<=...,<=*p**k*, such that *p*1<=<<=*p*2<=<<=...<=<<=*p**k* and *a**p*1<=≤<=*a**p*2<=≤<=...<=≤<=*a**p**k*. The length of the subsequence is *k*.

The first line contains an integer *n* (1<=≤<=*n*<=≤<=2000), denoting the length of the original sequence. The second line contains *n* space-separated integers, describing the original sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2,<=*i*<==<=1,<=2,<=...,<=*n*).

Print a single integer, which means the maximum possible length of the longest non-decreasing subsequence of the new sequence.

[ "4\n1 2 1 2\n", "10\n1 1 2 2 2 1 1 2 2 1\n" ]

[ "4\n", "9\n" ]

In the first example, after reversing [2, 3], the array will become [1, 1, 2, 2], where the length of the longest non-decreasing subsequence is 4. In the second example, after reversing [3, 7], the array will become [1, 1, 1, 1, 2, 2, 2, 2, 2, 1], where the length of the longest non-decreasing subsequence is 9.

500

[ { "input": "4\n1 2 1 2", "output": "4" }, { "input": "10\n1 1 2 2 2 1 1 2 2 1", "output": "9" }, { "input": "200\n2 1 1 2 1 2 2 2 2 2 1 2 2 1 1 2 2 1 1 1 2 1 1 2 2 2 2 2 1 1 2 1 2 1 1 2 1 1 1 1 2 1 2 2 1 2 1 1 1 2 1 1 1 2 2 2 1 1 1 1 2 2 2 1 2 2 2 1 2 2 2 1 2 1 2 1 2 1 1 1 1 2 2 2 1 1 2 1 2 1 2 1 2 2 1 1 1 2 2 2 2 1 2 2 2 1 1 1 1 2 1 1 1 2 2 1 2 1 2 2 2 1 2 1 2 1 2 1 2 2 2 1 2 2 2 1 1 1 1 2 1 2 1 1 1 2 1 2 2 2 1 2 1 1 1 1 1 1 2 1 1 2 2 2 1 2 1 1 1 1 2 2 1 2 1 2 1 2 1 2 1 2 2 1 1 1 1 2 2 1 1 2 2 1 2 2 1 2 2 2", "output": "116" }, { "input": "200\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "200" }, { "input": "1\n2", "output": "1" }, { "input": "2\n1 2", "output": "2" }, { "input": "2\n2 1", "output": "2" }, { "input": "3\n2 1 2", "output": "3" }, { "input": "3\n1 2 1", "output": "3" }, { "input": "100\n1 1 2 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 2 1 2 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 2 1 1 1 1 1 1 2 1 1 1 1 1 1 2 1 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 2 1 2 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2", "output": "89" }, { "input": "100\n1 2 1 2 2 2 1 1 2 2 2 1 2 2 2 1 1 1 1 2 2 2 1 1 1 1 1 2 1 1 2 2 2 2 1 1 2 2 2 1 2 1 2 1 2 1 2 2 1 2 2 1 2 1 2 2 1 2 1 1 2 2 1 2 2 1 1 1 1 2 2 1 2 2 1 1 1 1 1 1 1 2 2 2 1 1 2 2 1 2 2 1 1 1 2 2 1 1 1 1", "output": "60" }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 2 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 2 1 1 1 1 1 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 2 2 1 1 1 1 1 1 2 2", "output": "91" }, { "input": "100\n2 2 2 2 1 2 1 1 1 1 2 1 1 1 2 1 1 1 1 2 2 1 1 1 1 2 1 1 1 2 1 2 1 2 2 2 2 2 1 1 1 1 2 1 1 2 1 1 2 2 1 1 1 1 2 1 1 2 2 2 2 1 1 1 2 1 1 1 2 2 1 1 2 1 2 2 2 1 1 2 2 1 1 2 2 1 1 1 2 2 1 1 2 2 2 1 1 1 2 2", "output": "63" }, { "input": "200\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 1 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 2 1 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2", "output": "187" }, { "input": "200\n1 2 1 1 1 1 1 1 2 1 1 1 2 1 1 1 1 1 1 2 2 1 1 1 1 1 2 1 1 1 1 2 1 2 1 1 1 2 1 2 1 1 2 2 2 2 2 1 2 1 1 2 2 2 2 1 2 2 1 1 2 2 1 2 1 1 1 2 2 1 2 2 1 2 2 2 2 2 1 1 1 2 2 2 1 1 2 2 1 2 1 2 2 1 2 2 1 2 1 2 2 1 1 1 1 1 2 1 1 1 1 2 1 1 2 1 1 1 2 2 2 1 1 2 1 1 2 1 2 1 1 1 2 1 2 1 2 2 1 1 1 1 2 1 1 2 1 2 1 1 2 2 1 1 1 2 1 1 1 2 1 2 1 2 1 1 1 1 2 2 2 1 2 1 2 2 1 2 1 1 2 1 1 2 1 2 1 2 1 1 2 1 1 2 2 1 2 1 1 2", "output": "131" }, { "input": "200\n1 2 2 1 2 1 1 1 1 1 2 1 2 2 2 2 2 1 2 1 1 2 2 2 1 2 1 1 2 2 1 1 1 2 2 1 2 1 2 2 1 1 1 2 1 1 1 1 1 1 2 2 2 1 2 1 1 2 2 1 2 1 1 1 2 2 1 2 2 2 2 1 1 2 2 2 2 2 1 2 1 2 2 1 2 2 2 2 2 1 2 1 1 1 2 1 1 2 2 2 1 2 1 1 1 1 1 1 2 2 2 1 2 2 1 1 1 2 2 2 1 1 2 2 2 1 2 1 1 2 1 2 2 1 1 1 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 1 2 2 1 1 1 2 2 2 1 2 2 1 2 2 2 2 1 2 1 1 1 2 1 1 2 1 1 1 1 2 1 2 1 1 1 2 2 2 2 1 1 2 2 2 2", "output": "118" }, { "input": "20\n1 2 2 2 2 2 2 2 1 1 1 2 2 2 1 2 1 1 2 1", "output": "16" }, { "input": "200\n2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "191" }, { "input": "10\n2 2 2 2 2 2 2 2 2 1", "output": "10" }, { "input": "6\n2 2 2 1 1 1", "output": "6" } ]

1,662,000,877

2,147,483,647

PyPy 3

COMPILATION_ERROR

TESTS

0

package main import ( "bufio" . "fmt" "os" // "strings" // "container/heap" // "bytes" // "math" // "strconv" ) var r = bufio.NewReader(os.Stdin) var w = bufio.NewWriter(os.Stdout) var n,m int var k int var turn int const MOD int64 = 1e9 + 7 var s,t string type pair struct{node,weight int} func solve(){ nums:=make([]int,n+1) for i:=1;i<=n;i++{ Fscan(r,&nums[i]) } dp:=make([]int,5) for i:=1;i<=n;i++{ dp[1]+=int(nums[i]==1) dp[2]=max(dp[1],dp[2]+int(nums[i]==2)) dp[3]=max(dp[2],dp[3]+int(nums[i]==1)) dp[4]=max(dp[3],dp[4]+int(nums[i]==2)) } Fprint(w,dp[4]) return } func main(){ defer w.Flush() // Fscan(r,&n,&m) Fscan(r,&n) // Fscan(r,&turn) // Fscan(r,&s) // Fscan(r,&k) // for i:=0;i<turn;i++{ // solve() // } solve() } /* ===========================PART 1: Math Func ============================ */ func max(x, y int) int {if x > y {return x};return y} func abs(x int64) int64 {if x > 0 {return x};return -x} func min(x, y int) int {if x < y {return x};return y} func memset(a []int, v int) { if len(a) == 0 {return} a[0] = v for bp := 1; bp < len(a); bp *= 2 { copy(a[bp:], a[:bp]) } }

Title: A Twisty Movement Time Limit: None seconds Memory Limit: None megabytes Problem Description: A dragon symbolizes wisdom, power and wealth. On Lunar New Year's Day, people model a dragon with bamboo strips and clothes, raise them with rods, and hold the rods high and low to resemble a flying dragon. A performer holding the rod low is represented by a 1, while one holding it high is represented by a 2. Thus, the line of performers can be represented by a sequence *a*1,<=*a*2,<=...,<=*a**n*. Little Tommy is among them. He would like to choose an interval [*l*,<=*r*] (1<=≤<=*l*<=≤<=*r*<=≤<=*n*), then reverse *a**l*,<=*a**l*<=+<=1,<=...,<=*a**r* so that the length of the longest non-decreasing subsequence of the new sequence is maximum. A non-decreasing subsequence is a sequence of indices *p*1,<=*p*2,<=...,<=*p**k*, such that *p*1<=<<=*p*2<=<<=...<=<<=*p**k* and *a**p*1<=≤<=*a**p*2<=≤<=...<=≤<=*a**p**k*. The length of the subsequence is *k*. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=2000), denoting the length of the original sequence. The second line contains *n* space-separated integers, describing the original sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2,<=*i*<==<=1,<=2,<=...,<=*n*). Output Specification: Print a single integer, which means the maximum possible length of the longest non-decreasing subsequence of the new sequence. Demo Input: ['4\n1 2 1 2\n', '10\n1 1 2 2 2 1 1 2 2 1\n'] Demo Output: ['4\n', '9\n'] Note: In the first example, after reversing [2, 3], the array will become [1, 1, 2, 2], where the length of the longest non-decreasing subsequence is 4. In the second example, after reversing [3, 7], the array will become [1, 1, 1, 1, 2, 2, 2, 2, 2, 1], where the length of the longest non-decreasing subsequence is 9.

```python package main import ( "bufio" . "fmt" "os" // "strings" // "container/heap" // "bytes" // "math" // "strconv" ) var r = bufio.NewReader(os.Stdin) var w = bufio.NewWriter(os.Stdout) var n,m int var k int var turn int const MOD int64 = 1e9 + 7 var s,t string type pair struct{node,weight int} func solve(){ nums:=make([]int,n+1) for i:=1;i<=n;i++{ Fscan(r,&nums[i]) } dp:=make([]int,5) for i:=1;i<=n;i++{ dp[1]+=int(nums[i]==1) dp[2]=max(dp[1],dp[2]+int(nums[i]==2)) dp[3]=max(dp[2],dp[3]+int(nums[i]==1)) dp[4]=max(dp[3],dp[4]+int(nums[i]==2)) } Fprint(w,dp[4]) return } func main(){ defer w.Flush() // Fscan(r,&n,&m) Fscan(r,&n) // Fscan(r,&turn) // Fscan(r,&s) // Fscan(r,&k) // for i:=0;i<turn;i++{ // solve() // } solve() } /* ===========================PART 1: Math Func ============================ */ func max(x, y int) int {if x > y {return x};return y} func abs(x int64) int64 {if x > 0 {return x};return -x} func min(x, y int) int {if x < y {return x};return y} func memset(a []int, v int) { if len(a) == 0 {return} a[0] = v for bp := 1; bp < len(a); bp *= 2 { copy(a[bp:], a[:bp]) } } ```

-1

742

A

Arpa’s hard exam and Mehrdad’s naive cheat

PROGRAMMING

1,000

[ "implementation", "math", "number theory" ]

null

There exists an island called Arpa’s land, some beautiful girls live there, as ugly ones do. Mehrdad wants to become minister of Arpa’s land. Arpa has prepared an exam. Exam has only one question, given *n*, print the last digit of 1378*n*. Mehrdad has become quite confused and wants you to help him. Please help, although it's a naive cheat.

The single line of input contains one integer *n* (0<=<=≤<=<=*n*<=<=≤<=<=109).

Print single integer — the last digit of 1378*n*.

[ "1\n", "2\n" ]

[ "8", "4" ]

In the first example, last digit of 13781 = 1378 is 8. In the second example, last digit of 13782 = 1378·1378 = 1898884 is 4.

500

[ { "input": "1", "output": "8" }, { "input": "2", "output": "4" }, { "input": "1000", "output": "6" }, { "input": "3", "output": "2" }, { "input": "4", "output": "6" }, { "input": "1000000000", "output": "6" }, { "input": "5", "output": "8" }, { "input": "6", "output": "4" }, { "input": "999999999", "output": "2" }, { "input": "1378", "output": "4" }, { "input": "13781378", "output": "4" }, { "input": "51202278", "output": "4" }, { "input": "999999998", "output": "4" }, { "input": "999999997", "output": "8" }, { "input": "12193721", "output": "8" }, { "input": "0", "output": "1" }, { "input": "989898989", "output": "8" }, { "input": "7", "output": "2" }, { "input": "8", "output": "6" }, { "input": "9", "output": "8" }, { "input": "10", "output": "4" }, { "input": "11", "output": "2" }, { "input": "12", "output": "6" }, { "input": "13", "output": "8" }, { "input": "14", "output": "4" }, { "input": "15", "output": "2" }, { "input": "16", "output": "6" }, { "input": "999999996", "output": "6" }, { "input": "999999995", "output": "2" }, { "input": "999999994", "output": "4" } ]

1,660,281,086

2,147,483,647

Python 3

OK

TESTS

30

46

0

x = int(input()) if not x: print(1) exit() print('8426'[(x-1) % 4])

Title: Arpa’s hard exam and Mehrdad’s naive cheat Time Limit: None seconds Memory Limit: None megabytes Problem Description: There exists an island called Arpa’s land, some beautiful girls live there, as ugly ones do. Mehrdad wants to become minister of Arpa’s land. Arpa has prepared an exam. Exam has only one question, given *n*, print the last digit of 1378*n*. Mehrdad has become quite confused and wants you to help him. Please help, although it's a naive cheat. Input Specification: The single line of input contains one integer *n* (0<=<=≤<=<=*n*<=<=≤<=<=109). Output Specification: Print single integer — the last digit of 1378*n*. Demo Input: ['1\n', '2\n'] Demo Output: ['8', '4'] Note: In the first example, last digit of 13781 = 1378 is 8. In the second example, last digit of 13782 = 1378·1378 = 1898884 is 4.

```python x = int(input()) if not x: print(1) exit() print('8426'[(x-1) % 4]) ```

3

37

A

Towers

PROGRAMMING

1,000

[ "sortings" ]

A. Towers

2

256

Little Vasya has received a young builder’s kit. The kit consists of several wooden bars, the lengths of all of them are known. The bars can be put one on the top of the other if their lengths are the same. Vasya wants to construct the minimal number of towers from the bars. Help Vasya to use the bars in the best way possible.

The first line contains an integer *N* (1<=≤<=*N*<=≤<=1000) — the number of bars at Vasya’s disposal. The second line contains *N* space-separated integers *l**i* — the lengths of the bars. All the lengths are natural numbers not exceeding 1000.

In one line output two numbers — the height of the largest tower and their total number. Remember that Vasya should use all the bars.

[ "3\n1 2 3\n", "4\n6 5 6 7\n" ]

[ "1 3\n", "2 3\n" ]

none

500

[ { "input": "3\n1 2 3", "output": "1 3" }, { "input": "4\n6 5 6 7", "output": "2 3" }, { "input": "4\n3 2 1 1", "output": "2 3" }, { "input": "4\n1 2 3 3", "output": "2 3" }, { "input": "3\n20 22 36", "output": "1 3" }, { "input": "25\n47 30 94 41 45 20 96 51 110 129 24 116 9 47 32 82 105 114 116 75 154 151 70 42 162", "output": "2 23" }, { "input": "45\n802 664 442 318 318 827 417 878 711 291 231 414 807 553 657 392 279 202 386 606 465 655 658 112 887 15 25 502 95 44 679 775 942 609 209 871 31 234 4 231 150 110 22 823 193", "output": "2 43" }, { "input": "63\n93 180 116 7 8 179 268 279 136 94 221 153 264 190 278 19 19 63 153 26 158 225 25 49 89 218 111 149 255 225 197 122 243 80 3 224 107 178 202 17 53 92 69 42 228 24 81 205 95 8 265 82 228 156 127 241 172 159 106 60 67 155 111", "output": "2 57" }, { "input": "83\n246 535 994 33 390 927 321 97 223 922 812 705 79 80 977 457 476 636 511 137 6 360 815 319 717 674 368 551 714 628 278 713 761 553 184 414 623 753 428 214 581 115 439 61 677 216 772 592 187 603 658 310 439 559 870 376 109 321 189 337 277 26 70 734 796 907 979 693 570 227 345 650 737 633 701 914 134 403 972 940 371 6 642", "output": "2 80" }, { "input": "105\n246 57 12 204 165 123 246 68 191 310 3 152 386 333 374 257 158 104 333 50 80 290 8 340 101 76 221 316 388 289 138 359 316 26 93 290 105 178 81 195 41 196 218 180 244 292 187 97 315 323 174 119 248 239 92 312 31 2 101 180 307 170 338 314 163 281 217 31 142 238 280 190 190 156 70 74 329 113 151 8 141 313 366 40 253 116 168 124 135 230 294 266 353 389 371 359 195 200 183 237 93 102 315 118 188", "output": "2 92" }, { "input": "123\n112 277 170 247 252 115 157 293 256 143 196 90 12 164 164 42 8 223 167 109 175 232 239 111 148 51 9 254 93 32 268 162 231 91 47 162 161 191 195 145 247 292 129 199 230 94 144 217 18 205 176 20 143 198 121 243 211 262 230 277 195 255 108 290 220 275 158 2 286 200 60 267 278 207 123 150 123 116 131 13 12 226 33 244 30 275 263 45 158 192 254 149 242 176 62 224 221 288 250 160 155 225 132 143 276 293 218 145 197 175 33 129 79 206 210 192 222 262 190 52 274 243 233", "output": "3 101" }, { "input": "5\n5 5 5 5 5", "output": "5 1" }, { "input": "3\n1000 1000 1000", "output": "3 1" }, { "input": "1\n1000", "output": "1 1" }, { "input": "1\n1", "output": "1 1" }, { "input": "5\n1 1000 1000 1000 1000", "output": "4 2" }, { "input": "5\n1000 1000 1000 8 7", "output": "3 3" } ]

1,613,837,720

2,147,483,647

Python 3

OK

TESTS

61

154

0

n = int(input()) barras = input().split() total_torres = 0 torre_maxima = 0 torres = dict() for i in range(n): num = barras[i] torres[num] = torres.get(num,0) + 1 if torres[num] == 1: total_torres = total_torres + 1 if torres[num] > torre_maxima: torre_maxima = torres[num] rpta = str(torre_maxima) + ' ' + str(total_torres) print(rpta)

Title: Towers Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Little Vasya has received a young builder’s kit. The kit consists of several wooden bars, the lengths of all of them are known. The bars can be put one on the top of the other if their lengths are the same. Vasya wants to construct the minimal number of towers from the bars. Help Vasya to use the bars in the best way possible. Input Specification: The first line contains an integer *N* (1<=≤<=*N*<=≤<=1000) — the number of bars at Vasya’s disposal. The second line contains *N* space-separated integers *l**i* — the lengths of the bars. All the lengths are natural numbers not exceeding 1000. Output Specification: In one line output two numbers — the height of the largest tower and their total number. Remember that Vasya should use all the bars. Demo Input: ['3\n1 2 3\n', '4\n6 5 6 7\n'] Demo Output: ['1 3\n', '2 3\n'] Note: none

```python n = int(input()) barras = input().split() total_torres = 0 torre_maxima = 0 torres = dict() for i in range(n): num = barras[i] torres[num] = torres.get(num,0) + 1 if torres[num] == 1: total_torres = total_torres + 1 if torres[num] > torre_maxima: torre_maxima = torres[num] rpta = str(torre_maxima) + ' ' + str(total_torres) print(rpta) ```

3.9615

625

B

War of the Corporations

PROGRAMMING

1,200

[ "constructive algorithms", "greedy", "strings" ]

null

A long time ago, in a galaxy far far away two giant IT-corporations Pineapple and Gogol continue their fierce competition. Crucial moment is just around the corner: Gogol is ready to release it's new tablet Lastus 3000. This new device is equipped with specially designed artificial intelligence (AI). Employees of Pineapple did their best to postpone the release of Lastus 3000 as long as possible. Finally, they found out, that the name of the new artificial intelligence is similar to the name of the phone, that Pineapple released 200 years ago. As all rights on its name belong to Pineapple, they stand on changing the name of Gogol's artificial intelligence. Pineapple insists, that the name of their phone occurs in the name of AI as a substring. Because the name of technology was already printed on all devices, the Gogol's director decided to replace some characters in AI name with "#". As this operation is pretty expensive, you should find the minimum number of characters to replace with "#", such that the name of AI doesn't contain the name of the phone as a substring. Substring is a continuous subsequence of a string.

The first line of the input contains the name of AI designed by Gogol, its length doesn't exceed 100<=000 characters. Second line contains the name of the phone released by Pineapple 200 years ago, its length doesn't exceed 30. Both string are non-empty and consist of only small English letters.

Print the minimum number of characters that must be replaced with "#" in order to obtain that the name of the phone doesn't occur in the name of AI as a substring.

[ "intellect\ntell\n", "google\napple\n", "sirisiri\nsir\n" ]

[ "1", "0", "2" ]

In the first sample AI's name may be replaced with "int#llect". In the second sample Gogol can just keep things as they are. In the third sample one of the new possible names of AI may be "s#ris#ri".

750

[ { "input": "intellect\ntell", "output": "1" }, { "input": "google\napple", "output": "0" }, { "input": "sirisiri\nsir", "output": "2" }, { "input": "sirisiri\nsiri", "output": "2" }, { "input": "aaaaaaa\naaaa", "output": "1" }, { "input": "bbbbbb\nbb", "output": "3" }, { "input": "abc\nabcabc", "output": "0" }, { "input": "kek\nkekekek", "output": "0" }, { "input": "aaaaa\naaa", "output": "1" }, { "input": "abcdabcv\nabcd", "output": "1" }, { "input": "abcabcabczabcabcabcz\ncab", "output": "4" }, { "input": "aatopotopotopotaa\ntopot", "output": "2" }, { "input": "abcabcabcabcabcabcabcabcabcabc\nabcabcabcabcabcabcabcabcabcabc", "output": "1" }, { "input": "sosossosos\nsos", "output": "2" }, { "input": "sosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosos\nsos", "output": "20" }, { "input": "tatatx\ntatx", "output": "1" }, { "input": "sxxsxxsxxd\nsxxsxxd", "output": "1" } ]

1,455,278,569

2,147,483,647

PyPy 3

WRONG_ANSWER

TESTS

4

109

0

gogol = input() pineapple = input() count = 0 fl = True while (fl): i = gogol.find(pineapple) if i == -1: fl = False else: count += 1 gogol = gogol[:i] + "#" + gogol[i+1:] print(count)

Title: War of the Corporations Time Limit: None seconds Memory Limit: None megabytes Problem Description: A long time ago, in a galaxy far far away two giant IT-corporations Pineapple and Gogol continue their fierce competition. Crucial moment is just around the corner: Gogol is ready to release it's new tablet Lastus 3000. This new device is equipped with specially designed artificial intelligence (AI). Employees of Pineapple did their best to postpone the release of Lastus 3000 as long as possible. Finally, they found out, that the name of the new artificial intelligence is similar to the name of the phone, that Pineapple released 200 years ago. As all rights on its name belong to Pineapple, they stand on changing the name of Gogol's artificial intelligence. Pineapple insists, that the name of their phone occurs in the name of AI as a substring. Because the name of technology was already printed on all devices, the Gogol's director decided to replace some characters in AI name with "#". As this operation is pretty expensive, you should find the minimum number of characters to replace with "#", such that the name of AI doesn't contain the name of the phone as a substring. Substring is a continuous subsequence of a string. Input Specification: The first line of the input contains the name of AI designed by Gogol, its length doesn't exceed 100<=000 characters. Second line contains the name of the phone released by Pineapple 200 years ago, its length doesn't exceed 30. Both string are non-empty and consist of only small English letters. Output Specification: Print the minimum number of characters that must be replaced with "#" in order to obtain that the name of the phone doesn't occur in the name of AI as a substring. Demo Input: ['intellect\ntell\n', 'google\napple\n', 'sirisiri\nsir\n'] Demo Output: ['1', '0', '2'] Note: In the first sample AI's name may be replaced with "int#llect". In the second sample Gogol can just keep things as they are. In the third sample one of the new possible names of AI may be "s#ris#ri".

```python gogol = input() pineapple = input() count = 0 fl = True while (fl): i = gogol.find(pineapple) if i == -1: fl = False else: count += 1 gogol = gogol[:i] + "#" + gogol[i+1:] print(count) ```

0

682

B

Alyona and Mex

PROGRAMMING

1,200

[ "sortings" ]

null

Someone gave Alyona an array containing *n* positive integers *a*1,<=*a*2,<=...,<=*a**n*. In one operation, Alyona can choose any element of the array and decrease it, i.e. replace with any positive integer that is smaller than the current one. Alyona can repeat this operation as many times as she wants. In particular, she may not apply any operation to the array at all. Formally, after applying some operations Alyona will get an array of *n* positive integers *b*1,<=*b*2,<=...,<=*b**n* such that 1<=≤<=*b**i*<=≤<=*a**i* for every 1<=≤<=*i*<=≤<=*n*. Your task is to determine the maximum possible value of mex of this array. Mex of an array in this problem is the minimum positive integer that doesn't appear in this array. For example, mex of the array containing 1, 3 and 4 is equal to 2, while mex of the array containing 2, 3 and 2 is equal to 1.

The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of elements in the Alyona's array. The second line of the input contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the array.

Print one positive integer — the maximum possible value of mex of the array after Alyona applies some (possibly none) operations.

[ "5\n1 3 3 3 6\n", "2\n2 1\n" ]

[ "5\n", "3\n" ]

In the first sample case if one will decrease the second element value to 2 and the fifth element value to 4 then the mex value of resulting array 1 2 3 3 4 will be equal to 5. To reach the answer to the second sample case one must not decrease any of the array elements.

1,000

[ { "input": "5\n1 3 3 3 6", "output": "5" }, { "input": "2\n2 1", "output": "3" }, { "input": "1\n1", "output": "2" }, { "input": "1\n1000000000", "output": "2" }, { "input": "1\n2", "output": "2" }, { "input": "2\n1 1", "output": "2" }, { "input": "2\n1 3", "output": "3" }, { "input": "2\n2 2", "output": "3" }, { "input": "2\n2 3", "output": "3" }, { "input": "2\n3 3", "output": "3" }, { "input": "3\n1 1 1", "output": "2" }, { "input": "3\n2 1 1", "output": "3" }, { "input": "3\n3 1 1", "output": "3" }, { "input": "3\n1 1 4", "output": "3" }, { "input": "3\n2 1 2", "output": "3" }, { "input": "3\n3 2 1", "output": "4" }, { "input": "3\n2 4 1", "output": "4" }, { "input": "3\n3 3 1", "output": "4" }, { "input": "3\n1 3 4", "output": "4" }, { "input": "3\n4 1 4", "output": "4" }, { "input": "3\n2 2 2", "output": "3" }, { "input": "3\n3 2 2", "output": "4" }, { "input": "3\n4 2 2", "output": "4" }, { "input": "3\n2 3 3", "output": "4" }, { "input": "3\n4 2 3", "output": "4" }, { "input": "3\n4 4 2", "output": "4" }, { "input": "3\n3 3 3", "output": "4" }, { "input": "3\n4 3 3", "output": "4" }, { "input": "3\n4 3 4", "output": "4" }, { "input": "3\n4 4 4", "output": "4" }, { "input": "4\n1 1 1 1", "output": "2" }, { "input": "4\n1 1 2 1", "output": "3" }, { "input": "4\n1 1 3 1", "output": "3" }, { "input": "4\n1 4 1 1", "output": "3" }, { "input": "4\n1 2 1 2", "output": "3" }, { "input": "4\n1 3 2 1", "output": "4" }, { "input": "4\n2 1 4 1", "output": "4" }, { "input": "4\n3 3 1 1", "output": "4" }, { "input": "4\n1 3 4 1", "output": "4" }, { "input": "4\n1 1 4 4", "output": "4" }, { "input": "4\n2 2 2 1", "output": "3" }, { "input": "4\n1 2 2 3", "output": "4" }, { "input": "4\n2 4 1 2", "output": "4" }, { "input": "4\n3 3 1 2", "output": "4" }, { "input": "4\n2 3 4 1", "output": "5" }, { "input": "4\n1 4 2 4", "output": "5" }, { "input": "4\n3 1 3 3", "output": "4" }, { "input": "4\n3 4 3 1", "output": "5" }, { "input": "4\n1 4 4 3", "output": "5" }, { "input": "4\n4 1 4 4", "output": "5" }, { "input": "4\n2 2 2 2", "output": "3" }, { "input": "4\n2 2 3 2", "output": "4" }, { "input": "4\n2 2 2 4", "output": "4" }, { "input": "4\n2 2 3 3", "output": "4" }, { "input": "4\n2 2 3 4", "output": "5" }, { "input": "4\n2 4 4 2", "output": "5" }, { "input": "4\n2 3 3 3", "output": "4" }, { "input": "4\n2 4 3 3", "output": "5" }, { "input": "4\n4 4 2 3", "output": "5" }, { "input": "4\n4 4 4 2", "output": "5" }, { "input": "4\n3 3 3 3", "output": "4" }, { "input": "4\n3 3 3 4", "output": "5" }, { "input": "4\n4 3 3 4", "output": "5" }, { "input": "4\n4 4 3 4", "output": "5" }, { "input": "4\n4 4 4 4", "output": "5" }, { "input": "11\n1 1 1 1 1 1 1 1 1 3 3", "output": "4" }, { "input": "20\n1 1 1 1 1 1 1 1 1 1 8 8 8 8 8 8 8 8 8 8", "output": "9" }, { "input": "4\n2 2 2 3", "output": "4" }, { "input": "3\n1 1 2", "output": "3" }, { "input": "15\n1 2 2 20 23 25 28 60 66 71 76 77 79 99 100", "output": "15" }, { "input": "7\n1 2 2 2 5 5 1", "output": "5" }, { "input": "4\n1 1 1 2", "output": "3" }, { "input": "5\n1 1 1 1 10000", "output": "3" }, { "input": "5\n1 1 1 1 2", "output": "3" }, { "input": "7\n1 3 3 3 3 3 6", "output": "5" }, { "input": "4\n1 1 1 3", "output": "3" }, { "input": "10\n1 1 1 1 1 1 1 1 1 100", "output": "3" }, { "input": "4\n1 1 2 2", "output": "3" }, { "input": "5\n1 1 1 3 4", "output": "4" }, { "input": "8\n1 1 1 1 2 2 3 40", "output": "5" }, { "input": "5\n1 1 1 1 1", "output": "2" }, { "input": "7\n1 2 2 2 2 2 4", "output": "4" }, { "input": "10\n1 1 1 10000000 10000000 10000000 10000000 10000000 10000000 10000000", "output": "9" }, { "input": "10\n1 1 1 1 1 1 1 1 2 3", "output": "4" }, { "input": "4\n8 8 8 8", "output": "5" }, { "input": "5\n5 6 6 6 7", "output": "6" } ]

1,601,302,232

2,147,483,647

Python 3

OK

TESTS

127

171

9,523,200

n,a,w=int(input()),sorted(map(int,input().split())),1 for i in a: if i>=w:w+=1 print(w)

Title: Alyona and Mex Time Limit: None seconds Memory Limit: None megabytes Problem Description: Someone gave Alyona an array containing *n* positive integers *a*1,<=*a*2,<=...,<=*a**n*. In one operation, Alyona can choose any element of the array and decrease it, i.e. replace with any positive integer that is smaller than the current one. Alyona can repeat this operation as many times as she wants. In particular, she may not apply any operation to the array at all. Formally, after applying some operations Alyona will get an array of *n* positive integers *b*1,<=*b*2,<=...,<=*b**n* such that 1<=≤<=*b**i*<=≤<=*a**i* for every 1<=≤<=*i*<=≤<=*n*. Your task is to determine the maximum possible value of mex of this array. Mex of an array in this problem is the minimum positive integer that doesn't appear in this array. For example, mex of the array containing 1, 3 and 4 is equal to 2, while mex of the array containing 2, 3 and 2 is equal to 1. Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of elements in the Alyona's array. The second line of the input contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the array. Output Specification: Print one positive integer — the maximum possible value of mex of the array after Alyona applies some (possibly none) operations. Demo Input: ['5\n1 3 3 3 6\n', '2\n2 1\n'] Demo Output: ['5\n', '3\n'] Note: In the first sample case if one will decrease the second element value to 2 and the fifth element value to 4 then the mex value of resulting array 1 2 3 3 4 will be equal to 5. To reach the answer to the second sample case one must not decrease any of the array elements.

```python n,a,w=int(input()),sorted(map(int,input().split())),1 for i in a: if i>=w:w+=1 print(w) ```

3

1,000

B

Light It Up

PROGRAMMING

1,500

[ "greedy" ]

null

Recently, you bought a brand new smart lamp with programming features. At first, you set up a schedule to the lamp. Every day it will turn power on at moment $0$ and turn power off at moment $M$. Moreover, the lamp allows you to set a program of switching its state (states are "lights on" and "lights off"). Unfortunately, some program is already installed into the lamp. The lamp allows only good programs. Good program can be represented as a non-empty array $a$, where $0 < a_1 < a_2 < \dots < a_{|a|} < M$. All $a_i$ must be integers. Of course, preinstalled program is a good program. The lamp follows program $a$ in next manner: at moment $0$ turns power and light on. Then at moment $a_i$ the lamp flips its state to opposite (if it was lit, it turns off, and vice versa). The state of the lamp flips instantly: for example, if you turn the light off at moment $1$ and then do nothing, the total time when the lamp is lit will be $1$. Finally, at moment $M$ the lamp is turning its power off regardless of its state. Since you are not among those people who read instructions, and you don't understand the language it's written in, you realize (after some testing) the only possible way to alter the preinstalled program. You can insert at most one element into the program $a$, so it still should be a good program after alteration. Insertion can be done between any pair of consecutive elements of $a$, or even at the begining or at the end of $a$. Find such a way to alter the program that the total time when the lamp is lit is maximum possible. Maybe you should leave program untouched. If the lamp is lit from $x$ till moment $y$, then its lit for $y - x$ units of time. Segments of time when the lamp is lit are summed up.

First line contains two space separated integers $n$ and $M$ ($1 \le n \le 10^5$, $2 \le M \le 10^9$) — the length of program $a$ and the moment when power turns off. Second line contains $n$ space separated integers $a_1, a_2, \dots, a_n$ ($0 < a_1 < a_2 < \dots < a_n < M$) — initially installed program $a$.

Print the only integer — maximum possible total time when the lamp is lit.

[ "3 10\n4 6 7\n", "2 12\n1 10\n", "2 7\n3 4\n" ]

[ "8\n", "9\n", "6\n" ]

In the first example, one of possible optimal solutions is to insert value $x = 3$ before $a_1$, so program will be $[3, 4, 6, 7]$ and time of lamp being lit equals $(3 - 0) + (6 - 4) + (10 - 7) = 8$. Other possible solution is to insert $x = 5$ in appropriate place. In the second example, there is only one optimal solution: to insert $x = 2$ between $a_1$ and $a_2$. Program will become $[1, 2, 10]$, and answer will be $(1 - 0) + (10 - 2) = 9$. In the third example, optimal answer is to leave program untouched, so answer will be $(3 - 0) + (7 - 4) = 6$.

0

[ { "input": "3 10\n4 6 7", "output": "8" }, { "input": "2 12\n1 10", "output": "9" }, { "input": "2 7\n3 4", "output": "6" }, { "input": "1 2\n1", "output": "1" }, { "input": "5 10\n1 3 5 6 8", "output": "6" }, { "input": "7 1000000000\n1 10001 10011 20011 20021 40021 40031", "output": "999999969" }, { "input": "7 1000000000\n3 10001 10011 20011 20021 40021 40031", "output": "999999969" }, { "input": "1 10\n1", "output": "9" }, { "input": "1 10000000\n1", "output": "9999999" }, { "input": "1 8\n1", "output": "7" }, { "input": "7 17\n1 5 9 10 11 14 16", "output": "9" }, { "input": "4 17\n1 5 9 10", "output": "12" }, { "input": "5 12\n1 2 3 4 5", "output": "9" }, { "input": "2 1000000000\n100 111", "output": "999999989" }, { "input": "3 90591\n90579 90580 90581", "output": "90589" }, { "input": "5 16\n1 2 3 4 5", "output": "13" }, { "input": "6 981231233\n1 6 15 30 130 1875", "output": "981229468" }, { "input": "1 3\n1", "output": "2" }, { "input": "3 12\n4 7 11", "output": "8" }, { "input": "1 100000\n1", "output": "99999" }, { "input": "2 5\n1 3", "output": "3" }, { "input": "1 1000000000\n1", "output": "999999999" }, { "input": "1 1000000000\n999999999", "output": "999999999" }, { "input": "3 4\n1 2 3", "output": "2" }, { "input": "3 5\n1 2 3", "output": "3" }, { "input": "1 4\n2", "output": "3" }, { "input": "3 5\n1 3 4", "output": "3" }, { "input": "9 20\n5 9 11 12 14 15 16 17 19", "output": "12" }, { "input": "2 4\n1 2", "output": "3" }, { "input": "1 10\n2", "output": "9" }, { "input": "2 6\n2 4", "output": "4" }, { "input": "2 4\n1 3", "output": "2" }, { "input": "3 6\n1 2 4", "output": "4" }, { "input": "7 9863\n65 96 97 98 101 112 1115", "output": "9819" } ]

1,663,219,817

2,147,483,647

PyPy 3-64

WRONG_ANSWER

TESTS

13

171

21,811,200

n, length = map(int, input().split()) origin = list(map(int, input().split())) if length % 2 == 0: origin.append(int(length)) ans = 0 checklist = list(((set(map(lambda x:x+1, origin))|set(map(lambda x:x-1, origin)))-set(origin)-set([0, -1, length+1]))|set([length])) for j in list(checklist): sume = 0 tested = origin.copy() tested.append(j) tested.sort() for i, number in enumerate(tested): sume += (number*(1 - 2*(i % 2))) ans = max(sume, ans) ans = max(ans, sume) print(ans)

Title: Light It Up Time Limit: None seconds Memory Limit: None megabytes Problem Description: Recently, you bought a brand new smart lamp with programming features. At first, you set up a schedule to the lamp. Every day it will turn power on at moment $0$ and turn power off at moment $M$. Moreover, the lamp allows you to set a program of switching its state (states are "lights on" and "lights off"). Unfortunately, some program is already installed into the lamp. The lamp allows only good programs. Good program can be represented as a non-empty array $a$, where $0 < a_1 < a_2 < \dots < a_{|a|} < M$. All $a_i$ must be integers. Of course, preinstalled program is a good program. The lamp follows program $a$ in next manner: at moment $0$ turns power and light on. Then at moment $a_i$ the lamp flips its state to opposite (if it was lit, it turns off, and vice versa). The state of the lamp flips instantly: for example, if you turn the light off at moment $1$ and then do nothing, the total time when the lamp is lit will be $1$. Finally, at moment $M$ the lamp is turning its power off regardless of its state. Since you are not among those people who read instructions, and you don't understand the language it's written in, you realize (after some testing) the only possible way to alter the preinstalled program. You can insert at most one element into the program $a$, so it still should be a good program after alteration. Insertion can be done between any pair of consecutive elements of $a$, or even at the begining or at the end of $a$. Find such a way to alter the program that the total time when the lamp is lit is maximum possible. Maybe you should leave program untouched. If the lamp is lit from $x$ till moment $y$, then its lit for $y - x$ units of time. Segments of time when the lamp is lit are summed up. Input Specification: First line contains two space separated integers $n$ and $M$ ($1 \le n \le 10^5$, $2 \le M \le 10^9$) — the length of program $a$ and the moment when power turns off. Second line contains $n$ space separated integers $a_1, a_2, \dots, a_n$ ($0 < a_1 < a_2 < \dots < a_n < M$) — initially installed program $a$. Output Specification: Print the only integer — maximum possible total time when the lamp is lit. Demo Input: ['3 10\n4 6 7\n', '2 12\n1 10\n', '2 7\n3 4\n'] Demo Output: ['8\n', '9\n', '6\n'] Note: In the first example, one of possible optimal solutions is to insert value $x = 3$ before $a_1$, so program will be $[3, 4, 6, 7]$ and time of lamp being lit equals $(3 - 0) + (6 - 4) + (10 - 7) = 8$. Other possible solution is to insert $x = 5$ in appropriate place. In the second example, there is only one optimal solution: to insert $x = 2$ between $a_1$ and $a_2$. Program will become $[1, 2, 10]$, and answer will be $(1 - 0) + (10 - 2) = 9$. In the third example, optimal answer is to leave program untouched, so answer will be $(3 - 0) + (7 - 4) = 6$.

```python n, length = map(int, input().split()) origin = list(map(int, input().split())) if length % 2 == 0: origin.append(int(length)) ans = 0 checklist = list(((set(map(lambda x:x+1, origin))|set(map(lambda x:x-1, origin)))-set(origin)-set([0, -1, length+1]))|set([length])) for j in list(checklist): sume = 0 tested = origin.copy() tested.append(j) tested.sort() for i, number in enumerate(tested): sume += (number*(1 - 2*(i % 2))) ans = max(sume, ans) ans = max(ans, sume) print(ans) ```

0

20

C

Dijkstra?

PROGRAMMING

1,900

[ "graphs", "shortest paths" ]

C. Dijkstra?

1

64

You are given a weighted undirected graph. The vertices are enumerated from 1 to *n*. Your task is to find the shortest path between the vertex 1 and the vertex *n*.

The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105), where *n* is the number of vertices and *m* is the number of edges. Following *m* lines contain one edge each in form *a**i*, *b**i* and *w**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=1<=≤<=*w**i*<=≤<=106), where *a**i*,<=*b**i* are edge endpoints and *w**i* is the length of the edge. It is possible that the graph has loops and multiple edges between pair of vertices.

Write the only integer -1 in case of no path. Write the shortest path in opposite case. If there are many solutions, print any of them.

[ "5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n", "5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n" ]

[ "1 4 3 5 ", "1 4 3 5 " ]

none

1,500

[ { "input": "5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1", "output": "1 4 3 5 " }, { "input": "5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1", "output": "1 4 3 5 " }, { "input": "2 1\n1 2 1", "output": "1 2 " }, { "input": "3 1\n1 2 1", "output": "-1" }, { "input": "3 3\n1 2 1\n1 3 2\n2 3 1", "output": "1 3 " }, { "input": "10 10\n1 5 12\n2 4 140\n2 10 149\n3 6 154\n3 7 9\n3 8 226\n3 10 132\n4 10 55\n5 8 33\n7 8 173", "output": "1 5 8 7 3 10 " }, { "input": "10 10\n1 5 178\n1 8 221\n2 7 92\n2 8 159\n3 5 55\n3 6 179\n3 10 237\n4 8 205\n5 6 191\n8 10 157", "output": "1 8 10 " }, { "input": "10 10\n1 4 200\n1 9 197\n3 4 79\n3 5 213\n3 6 149\n5 8 3\n5 9 189\n6 7 130\n6 9 51\n8 10 135", "output": "1 9 5 8 10 " }, { "input": "10 10\n1 4 201\n2 3 238\n3 4 40\n3 6 231\n3 8 45\n4 5 227\n4 6 58\n4 9 55\n5 7 14\n6 10 242", "output": "1 4 6 10 " } ]

1,649,401,929

2,147,483,647

PyPy 3-64

OK

TESTS

33

405

34,508,800

import sys import math import heapq input = sys.stdin.readline VC, EC = map(int, input().split()) G = [[] for _ in range(VC+1)] for _ in range(EC) : VA, VB, VW = map(int, input().split()) G[VA].append((VB, VW)) G[VB].append((VA, VW)) v = [False]*(VC+1) d = [math.inf]*(VC+1) f = list(range(VC+1)) h = [] d[1] = 0 f[1] = 1 heapq.heappush(h, (0, 1)) while h : HEW, HVN = heapq.heappop(h) if v[HVN] : continue v[HVN] = True for nv, nw in G[HVN] : if d[nv] > d[HVN]+nw : d[nv] = d[HVN]+nw f[nv] = HVN heapq.heappush(h, (d[nv], nv)) rs = [] sg = VC while f[sg] != sg : rs.append(sg) sg = f[sg] rs.append(sg) rs = rs[::-1] if rs[0] == 1 : print(" ".join(map(str, rs))) else : print(-1)

Title: Dijkstra? Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: You are given a weighted undirected graph. The vertices are enumerated from 1 to *n*. Your task is to find the shortest path between the vertex 1 and the vertex *n*. Input Specification: The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105), where *n* is the number of vertices and *m* is the number of edges. Following *m* lines contain one edge each in form *a**i*, *b**i* and *w**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=1<=≤<=*w**i*<=≤<=106), where *a**i*,<=*b**i* are edge endpoints and *w**i* is the length of the edge. It is possible that the graph has loops and multiple edges between pair of vertices. Output Specification: Write the only integer -1 in case of no path. Write the shortest path in opposite case. If there are many solutions, print any of them. Demo Input: ['5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n', '5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n'] Demo Output: ['1 4 3 5 ', '1 4 3 5 '] Note: none

```python import sys import math import heapq input = sys.stdin.readline VC, EC = map(int, input().split()) G = [[] for _ in range(VC+1)] for _ in range(EC) : VA, VB, VW = map(int, input().split()) G[VA].append((VB, VW)) G[VB].append((VA, VW)) v = [False]*(VC+1) d = [math.inf]*(VC+1) f = list(range(VC+1)) h = [] d[1] = 0 f[1] = 1 heapq.heappush(h, (0, 1)) while h : HEW, HVN = heapq.heappop(h) if v[HVN] : continue v[HVN] = True for nv, nw in G[HVN] : if d[nv] > d[HVN]+nw : d[nv] = d[HVN]+nw f[nv] = HVN heapq.heappush(h, (d[nv], nv)) rs = [] sg = VC while f[sg] != sg : rs.append(sg) sg = f[sg] rs.append(sg) rs = rs[::-1] if rs[0] == 1 : print(" ".join(map(str, rs))) else : print(-1) ```

3.540389

769

A

Year of University Entrance

PROGRAMMING

800

[ "*special", "implementation", "sortings" ]

null

There is the faculty of Computer Science in Berland. In the social net "TheContact!" for each course of this faculty there is the special group whose name equals the year of university entrance of corresponding course of students at the university. Each of students joins the group of his course and joins all groups for which the year of student's university entrance differs by no more than *x* from the year of university entrance of this student, where *x* — some non-negative integer. A value *x* is not given, but it can be uniquely determined from the available data. Note that students don't join other groups. You are given the list of groups which the student Igor joined. According to this information you need to determine the year of Igor's university entrance.

The first line contains the positive odd integer *n* (1<=≤<=*n*<=≤<=5) — the number of groups which Igor joined. The next line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (2010<=≤<=*a**i*<=≤<=2100) — years of student's university entrance for each group in which Igor is the member. It is guaranteed that the input data is correct and the answer always exists. Groups are given randomly.

Print the year of Igor's university entrance.

[ "3\n2014 2016 2015\n", "1\n2050\n" ]

[ "2015\n", "2050\n" ]

In the first test the value *x* = 1. Igor entered the university in 2015. So he joined groups members of which are students who entered the university in 2014, 2015 and 2016. In the second test the value *x* = 0. Igor entered only the group which corresponds to the year of his university entrance.

500

[ { "input": "3\n2014 2016 2015", "output": "2015" }, { "input": "1\n2050", "output": "2050" }, { "input": "1\n2010", "output": "2010" }, { "input": "1\n2011", "output": "2011" }, { "input": "3\n2010 2011 2012", "output": "2011" }, { "input": "3\n2049 2047 2048", "output": "2048" }, { "input": "5\n2043 2042 2041 2044 2040", "output": "2042" }, { "input": "5\n2012 2013 2014 2015 2016", "output": "2014" }, { "input": "1\n2045", "output": "2045" }, { "input": "1\n2046", "output": "2046" }, { "input": "1\n2099", "output": "2099" }, { "input": "1\n2100", "output": "2100" }, { "input": "3\n2011 2010 2012", "output": "2011" }, { "input": "3\n2011 2012 2010", "output": "2011" }, { "input": "3\n2012 2011 2010", "output": "2011" }, { "input": "3\n2010 2012 2011", "output": "2011" }, { "input": "3\n2012 2010 2011", "output": "2011" }, { "input": "3\n2047 2048 2049", "output": "2048" }, { "input": "3\n2047 2049 2048", "output": "2048" }, { "input": "3\n2048 2047 2049", "output": "2048" }, { "input": "3\n2048 2049 2047", "output": "2048" }, { "input": "3\n2049 2048 2047", "output": "2048" }, { "input": "5\n2011 2014 2012 2013 2010", "output": "2012" }, { "input": "5\n2014 2013 2011 2012 2015", "output": "2013" }, { "input": "5\n2021 2023 2024 2020 2022", "output": "2022" }, { "input": "5\n2081 2079 2078 2080 2077", "output": "2079" }, { "input": "5\n2095 2099 2097 2096 2098", "output": "2097" }, { "input": "5\n2097 2099 2100 2098 2096", "output": "2098" }, { "input": "5\n2012 2010 2014 2011 2013", "output": "2012" }, { "input": "5\n2012 2011 2013 2015 2014", "output": "2013" }, { "input": "5\n2023 2024 2022 2021 2020", "output": "2022" }, { "input": "5\n2077 2078 2080 2079 2081", "output": "2079" }, { "input": "5\n2099 2096 2095 2097 2098", "output": "2097" }, { "input": "5\n2097 2100 2098 2096 2099", "output": "2098" }, { "input": "5\n2011 2014 2013 2010 2012", "output": "2012" }, { "input": "5\n2013 2011 2015 2012 2014", "output": "2013" }, { "input": "5\n2024 2020 2021 2023 2022", "output": "2022" }, { "input": "5\n2079 2080 2077 2081 2078", "output": "2079" }, { "input": "5\n2095 2097 2096 2098 2099", "output": "2097" }, { "input": "5\n2099 2096 2100 2097 2098", "output": "2098" }, { "input": "5\n2034 2033 2036 2032 2035", "output": "2034" }, { "input": "5\n2030 2031 2033 2032 2029", "output": "2031" }, { "input": "5\n2093 2092 2094 2096 2095", "output": "2094" }, { "input": "5\n2012 2015 2014 2013 2011", "output": "2013" }, { "input": "5\n2056 2057 2058 2059 2060", "output": "2058" } ]

1,666,964,910

2,147,483,647

Python 3

OK

TESTS

45

62

0

n = int(input()) ll=list(map(int,input().split())) ll.sort() print(ll[n//2])

Title: Year of University Entrance Time Limit: None seconds Memory Limit: None megabytes Problem Description: There is the faculty of Computer Science in Berland. In the social net "TheContact!" for each course of this faculty there is the special group whose name equals the year of university entrance of corresponding course of students at the university. Each of students joins the group of his course and joins all groups for which the year of student's university entrance differs by no more than *x* from the year of university entrance of this student, where *x* — some non-negative integer. A value *x* is not given, but it can be uniquely determined from the available data. Note that students don't join other groups. You are given the list of groups which the student Igor joined. According to this information you need to determine the year of Igor's university entrance. Input Specification: The first line contains the positive odd integer *n* (1<=≤<=*n*<=≤<=5) — the number of groups which Igor joined. The next line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (2010<=≤<=*a**i*<=≤<=2100) — years of student's university entrance for each group in which Igor is the member. It is guaranteed that the input data is correct and the answer always exists. Groups are given randomly. Output Specification: Print the year of Igor's university entrance. Demo Input: ['3\n2014 2016 2015\n', '1\n2050\n'] Demo Output: ['2015\n', '2050\n'] Note: In the first test the value *x* = 1. Igor entered the university in 2015. So he joined groups members of which are students who entered the university in 2014, 2015 and 2016. In the second test the value *x* = 0. Igor entered only the group which corresponds to the year of his university entrance.

```python n = int(input()) ll=list(map(int,input().split())) ll.sort() print(ll[n//2]) ```

3

0

none

0

[ "none" ]

null

Alice likes snow a lot! Unfortunately, this year's winter is already over, and she can't expect to have any more of it. Bob has thus bought her a gift — a large snow maker. He plans to make some amount of snow every day. On day *i* he will make a pile of snow of volume *V**i* and put it in her garden. Each day, every pile will shrink a little due to melting. More precisely, when the temperature on a given day is *T**i*, each pile will reduce its volume by *T**i*. If this would reduce the volume of a pile to or below zero, it disappears forever. All snow piles are independent of each other. Note that the pile made on day *i* already loses part of its volume on the same day. In an extreme case, this may mean that there are no piles left at the end of a particular day. You are given the initial pile sizes and the temperature on each day. Determine the total volume of snow melted on each day.

The first line contains a single integer *N* (1<=≤<=*N*<=≤<=105) — the number of days. The second line contains *N* integers *V*1,<=*V*2,<=...,<=*V**N* (0<=≤<=*V**i*<=≤<=109), where *V**i* is the initial size of a snow pile made on the day *i*. The third line contains *N* integers *T*1,<=*T*2,<=...,<=*T**N* (0<=≤<=*T**i*<=≤<=109), where *T**i* is the temperature on the day *i*.

Output a single line with *N* integers, where the *i*-th integer represents the total volume of snow melted on day *i*.

[ "3\n10 10 5\n5 7 2\n", "5\n30 25 20 15 10\n9 10 12 4 13\n" ]

[ "5 12 4\n", "9 20 35 11 25\n" ]

In the first sample, Bob first makes a snow pile of volume 10, which melts to the size of 5 on the same day. On the second day, he makes another pile of size 10. Since it is a bit warmer than the day before, the first pile disappears completely while the second pile shrinks to 3. At the end of the second day, he has only a single pile of size 3. On the third day he makes a smaller pile than usual, but as the temperature dropped too, both piles survive till the end of the day.

0

[ { "input": "3\n10 10 5\n5 7 2", "output": "5 12 4" }, { "input": "5\n30 25 20 15 10\n9 10 12 4 13", "output": "9 20 35 11 25" }, { "input": "4\n0 0 0 0\n1 2 3 4", "output": "0 0 0 0" }, { "input": "10\n11 39 16 34 25 3 12 11 31 16\n10 0 4 9 8 9 7 8 9 2", "output": "10 0 9 27 27 30 28 17 12 4" }, { "input": "10\n20 35 4 0 6 29 4 9 17 10\n0 9 4 7 5 1 4 3 9 4", "output": "0 18 12 14 10 3 12 9 26 12" }, { "input": "1\n4\n5", "output": "4" }, { "input": "1\n5\n4", "output": "4" }, { "input": "1\n5\n5", "output": "5" }, { "input": "2\n9 3\n8 2", "output": "8 3" }, { "input": "2\n9 3\n4 4", "output": "4 7" }, { "input": "2\n9 3\n10 2", "output": "9 2" }, { "input": "13\n1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1" } ]

1,656,931,727

2,147,483,647

Python 3

OK

TESTS

103

249

17,510,400

import heapq def producing_snow(ice_piles, temps): days = [] ans = [] prev = 0 for ice, temp in zip(ice_piles, temps): heapq.heappush(days, ice + prev) summ = 0 while days and days[0] <= temp + prev: summ += (heapq.heappop(days) - prev) summ += len(days) * temp prev += temp ans.append(summ) return ans x = int(input()) ice_piles = list(map(int, input().split())) temp = list(map(int, input().split())) snow = producing_snow(ice_piles, temp) print(" ".join(list(map(str, snow))))

Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Alice likes snow a lot! Unfortunately, this year's winter is already over, and she can't expect to have any more of it. Bob has thus bought her a gift — a large snow maker. He plans to make some amount of snow every day. On day *i* he will make a pile of snow of volume *V**i* and put it in her garden. Each day, every pile will shrink a little due to melting. More precisely, when the temperature on a given day is *T**i*, each pile will reduce its volume by *T**i*. If this would reduce the volume of a pile to or below zero, it disappears forever. All snow piles are independent of each other. Note that the pile made on day *i* already loses part of its volume on the same day. In an extreme case, this may mean that there are no piles left at the end of a particular day. You are given the initial pile sizes and the temperature on each day. Determine the total volume of snow melted on each day. Input Specification: The first line contains a single integer *N* (1<=≤<=*N*<=≤<=105) — the number of days. The second line contains *N* integers *V*1,<=*V*2,<=...,<=*V**N* (0<=≤<=*V**i*<=≤<=109), where *V**i* is the initial size of a snow pile made on the day *i*. The third line contains *N* integers *T*1,<=*T*2,<=...,<=*T**N* (0<=≤<=*T**i*<=≤<=109), where *T**i* is the temperature on the day *i*. Output Specification: Output a single line with *N* integers, where the *i*-th integer represents the total volume of snow melted on day *i*. Demo Input: ['3\n10 10 5\n5 7 2\n', '5\n30 25 20 15 10\n9 10 12 4 13\n'] Demo Output: ['5 12 4\n', '9 20 35 11 25\n'] Note: In the first sample, Bob first makes a snow pile of volume 10, which melts to the size of 5 on the same day. On the second day, he makes another pile of size 10. Since it is a bit warmer than the day before, the first pile disappears completely while the second pile shrinks to 3. At the end of the second day, he has only a single pile of size 3. On the third day he makes a smaller pile than usual, but as the temperature dropped too, both piles survive till the end of the day.

```python import heapq def producing_snow(ice_piles, temps): days = [] ans = [] prev = 0 for ice, temp in zip(ice_piles, temps): heapq.heappush(days, ice + prev) summ = 0 while days and days[0] <= temp + prev: summ += (heapq.heappop(days) - prev) summ += len(days) * temp prev += temp ans.append(summ) return ans x = int(input()) ice_piles = list(map(int, input().split())) temp = list(map(int, input().split())) snow = producing_snow(ice_piles, temp) print(" ".join(list(map(str, snow)))) ```

3

777

B

Game of Credit Cards

PROGRAMMING

1,300

[ "data structures", "dp", "greedy", "sortings" ]

null

After the fourth season Sherlock and Moriary have realized the whole foolishness of the battle between them and decided to continue their competitions in peaceful game of Credit Cards. Rules of this game are simple: each player bring his favourite *n*-digit credit card. Then both players name the digits written on their cards one by one. If two digits are not equal, then the player, whose digit is smaller gets a flick (knock in the forehead usually made with a forefinger) from the other player. For example, if *n*<==<=3, Sherlock's card is 123 and Moriarty's card has number 321, first Sherlock names 1 and Moriarty names 3 so Sherlock gets a flick. Then they both digit 2 so no one gets a flick. Finally, Sherlock names 3, while Moriarty names 1 and gets a flick. Of course, Sherlock will play honestly naming digits one by one in the order they are given, while Moriary, as a true villain, plans to cheat. He is going to name his digits in some other order (however, he is not going to change the overall number of occurences of each digit). For example, in case above Moriarty could name 1, 2, 3 and get no flicks at all, or he can name 2, 3 and 1 to give Sherlock two flicks. Your goal is to find out the minimum possible number of flicks Moriarty will get (no one likes flicks) and the maximum possible number of flicks Sherlock can get from Moriarty. Note, that these two goals are different and the optimal result may be obtained by using different strategies.

The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of digits in the cards Sherlock and Moriarty are going to use. The second line contains *n* digits — Sherlock's credit card number. The third line contains *n* digits — Moriarty's credit card number.

First print the minimum possible number of flicks Moriarty will get. Then print the maximum possible number of flicks that Sherlock can get from Moriarty.

[ "3\n123\n321\n", "2\n88\n00\n" ]

[ "0\n2\n", "2\n0\n" ]

First sample is elaborated in the problem statement. In the second sample, there is no way Moriarty can avoid getting two flicks.

1,000

[ { "input": "3\n123\n321", "output": "0\n2" }, { "input": "2\n88\n00", "output": "2\n0" }, { "input": "1\n4\n5", "output": "0\n1" }, { "input": "1\n8\n7", "output": "1\n0" }, { "input": "2\n55\n55", "output": "0\n0" }, { "input": "3\n534\n432", "output": "1\n1" }, { "input": "3\n486\n024", "output": "2\n0" }, { "input": "5\n22222\n22222", "output": "0\n0" }, { "input": "5\n72471\n05604", "output": "2\n3" }, { "input": "5\n72471\n72471", "output": "0\n3" }, { "input": "5\n72471\n41772", "output": "0\n3" }, { "input": "8\n99999999\n99999999", "output": "0\n0" }, { "input": "8\n01234567\n01234567", "output": "0\n7" }, { "input": "8\n07070707\n76543210", "output": "3\n4" }, { "input": "8\n88888888\n98769876", "output": "4\n2" }, { "input": "8\n23456789\n01234567", "output": "2\n5" }, { "input": "5\n11222\n22111", "output": "1\n2" }, { "input": "9\n777777777\n777777777", "output": "0\n0" }, { "input": "9\n353589343\n280419388", "output": "3\n5" }, { "input": "10\n8104381743\n8104381743", "output": "0\n8" }, { "input": "10\n8104381743\n8418134730", "output": "0\n8" }, { "input": "10\n1111122222\n2222211111", "output": "0\n5" }, { "input": "100\n6317494220822818719411404030346382869796138932712461187067886456209071515048745855973784223939110171\n6017563370120161528504797580620647099370814387367549926215651181421345104088127581963662589996747937", "output": "2\n86" }, { "input": "200\n89017372169770060638462517044634884577600285180365791227828841983192945639410766634962149214165390392679430585962408483864914959904870801002680423351144765728677610509881245693518626747873607530273392\n34804385048475325130258121398275821439066233953856051421626677848150660724595847484466293487857039579239864150199164135152374201294909986469345076423004279983866383035554588630496127880705497919788390", "output": "6\n175" }, { "input": "3\n112\n111", "output": "1\n0" }, { "input": "5\n66666\n11119", "output": "4\n1" }, { "input": "3\n232\n123", "output": "1\n1" } ]

1,601,645,016

2,147,483,647

Python 3

OK

TESTS

55

124

307,200

n=int(input()) m_flik=0;s_flik=0;j=0 s1=int(input());s=[] m1=int(input());m=[] for i in range(n): s.append(s1%10) s1=s1//10 for i in range(n): m.append(m1%10) m1=m1//10 s.sort() m.sort(reverse=True) m_big=m[j] for i in range(n-1,-1,-1): if(m_big>s[i]): m_flik+=1;j+=1 if(j<n): m_big=m[j] j=0 m_big=m[j] for i in range(n-1,-1,-1): if(m_big>=s[i]): s_flik+=1;j+=1 if(j<n): m_big=m[j] print(n-s_flik,m_flik)

Title: Game of Credit Cards Time Limit: None seconds Memory Limit: None megabytes Problem Description: After the fourth season Sherlock and Moriary have realized the whole foolishness of the battle between them and decided to continue their competitions in peaceful game of Credit Cards. Rules of this game are simple: each player bring his favourite *n*-digit credit card. Then both players name the digits written on their cards one by one. If two digits are not equal, then the player, whose digit is smaller gets a flick (knock in the forehead usually made with a forefinger) from the other player. For example, if *n*<==<=3, Sherlock's card is 123 and Moriarty's card has number 321, first Sherlock names 1 and Moriarty names 3 so Sherlock gets a flick. Then they both digit 2 so no one gets a flick. Finally, Sherlock names 3, while Moriarty names 1 and gets a flick. Of course, Sherlock will play honestly naming digits one by one in the order they are given, while Moriary, as a true villain, plans to cheat. He is going to name his digits in some other order (however, he is not going to change the overall number of occurences of each digit). For example, in case above Moriarty could name 1, 2, 3 and get no flicks at all, or he can name 2, 3 and 1 to give Sherlock two flicks. Your goal is to find out the minimum possible number of flicks Moriarty will get (no one likes flicks) and the maximum possible number of flicks Sherlock can get from Moriarty. Note, that these two goals are different and the optimal result may be obtained by using different strategies. Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of digits in the cards Sherlock and Moriarty are going to use. The second line contains *n* digits — Sherlock's credit card number. The third line contains *n* digits — Moriarty's credit card number. Output Specification: First print the minimum possible number of flicks Moriarty will get. Then print the maximum possible number of flicks that Sherlock can get from Moriarty. Demo Input: ['3\n123\n321\n', '2\n88\n00\n'] Demo Output: ['0\n2\n', '2\n0\n'] Note: First sample is elaborated in the problem statement. In the second sample, there is no way Moriarty can avoid getting two flicks.

```python n=int(input()) m_flik=0;s_flik=0;j=0 s1=int(input());s=[] m1=int(input());m=[] for i in range(n): s.append(s1%10) s1=s1//10 for i in range(n): m.append(m1%10) m1=m1//10 s.sort() m.sort(reverse=True) m_big=m[j] for i in range(n-1,-1,-1): if(m_big>s[i]): m_flik+=1;j+=1 if(j<n): m_big=m[j] j=0 m_big=m[j] for i in range(n-1,-1,-1): if(m_big>=s[i]): s_flik+=1;j+=1 if(j<n): m_big=m[j] print(n-s_flik,m_flik) ```

3

572

A

Arrays

PROGRAMMING

900

[ "sortings" ]

null

You are given two arrays *A* and *B* consisting of integers, sorted in non-decreasing order. Check whether it is possible to choose *k* numbers in array *A* and choose *m* numbers in array *B* so that any number chosen in the first array is strictly less than any number chosen in the second array.

The first line contains two integers *n**A*,<=*n**B* (1<=≤<=*n**A*,<=*n**B*<=≤<=105), separated by a space — the sizes of arrays *A* and *B*, correspondingly. The second line contains two integers *k* and *m* (1<=≤<=*k*<=≤<=*n**A*,<=1<=≤<=*m*<=≤<=*n**B*), separated by a space. The third line contains *n**A* numbers *a*1,<=*a*2,<=... *a**n**A* (<=-<=109<=≤<=*a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n**A*<=≤<=109), separated by spaces — elements of array *A*. The fourth line contains *n**B* integers *b*1,<=*b*2,<=... *b**n**B* (<=-<=109<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**n**B*<=≤<=109), separated by spaces — elements of array *B*.

Print "YES" (without the quotes), if you can choose *k* numbers in array *A* and *m* numbers in array *B* so that any number chosen in array *A* was strictly less than any number chosen in array *B*. Otherwise, print "NO" (without the quotes).

[ "3 3\n2 1\n1 2 3\n3 4 5\n", "3 3\n3 3\n1 2 3\n3 4 5\n", "5 2\n3 1\n1 1 1 1 1\n2 2\n" ]

[ "YES\n", "NO\n", "YES\n" ]

In the first sample test you can, for example, choose numbers 1 and 2 from array *A* and number 3 from array *B* (1 < 3 and 2 < 3). In the second sample test the only way to choose *k* elements in the first array and *m* elements in the second one is to choose all numbers in both arrays, but then not all the numbers chosen in *A* will be less than all the numbers chosen in *B*: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7280148ed5eab0a7d418d4f92b32061243a8ca58.png" style="max-width: 100.0%;max-height: 100.0%;"/>.

500

[ { "input": "3 3\n2 1\n1 2 3\n3 4 5", "output": "YES" }, { "input": "3 3\n3 3\n1 2 3\n3 4 5", "output": "NO" }, { "input": "5 2\n3 1\n1 1 1 1 1\n2 2", "output": "YES" }, { "input": "3 5\n1 1\n5 5 5\n5 5 5 5 5", "output": "NO" }, { "input": "1 1\n1 1\n1\n1", "output": "NO" }, { "input": "3 3\n1 1\n1 2 3\n1 2 3", "output": "YES" }, { "input": "3 3\n1 2\n1 2 3\n1 2 3", "output": "YES" }, { "input": "3 3\n2 2\n1 2 3\n1 2 3", "output": "NO" }, { "input": "10 15\n10 1\n1 1 5 17 22 29 32 36 39 48\n9 10 20 23 26 26 32 32 33 39 43 45 47 49 49", "output": "YES" }, { "input": "10 15\n1 15\n91 91 91 92 92 94 94 95 98 100\n92 92 93 93 93 94 95 96 97 98 98 99 99 100 100", "output": "YES" }, { "input": "15 10\n12 5\n9 25 25 32 32 38 40 41 46 46 48 51 64 64 73\n5 14 30 35 50 52 67 79 89 99", "output": "YES" }, { "input": "15 10\n4 10\n22 32 35 45 45 50 51 55 79 80 83 88 90 92 93\n46 48 52 55 60 60 68 75 80 81", "output": "YES" }, { "input": "20 30\n2 8\n6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 10 10 10 10 10\n1 1 2 2 2 2 2 2 2 3 3 4 5 5 5 5 6 6 6 6 6 6 7 7 7 8 8 9 10 10", "output": "NO" }, { "input": "20 30\n19 29\n1 1 2 2 2 3 4 4 7 7 7 8 8 8 8 8 9 9 9 9\n6 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 10 10 10 10 10", "output": "NO" }, { "input": "1 1\n1 1\n-1000000000\n30", "output": "YES" }, { "input": "3 3\n1 3\n1 3 3\n3 3 3", "output": "YES" }, { "input": "3 3\n1 1\n3 3 3\n2 2 2", "output": "NO" }, { "input": "5 5\n3 3\n1 5 6 7 8\n1 2 5 6 7", "output": "NO" }, { "input": "3 4\n2 2\n5 6 7\n1 2 3 4", "output": "NO" }, { "input": "3 3\n3 3\n1 2 3\n4 5 6", "output": "YES" }, { "input": "5 5\n4 5\n2 2 3 4 5\n5 6 7 8 9", "output": "YES" } ]

1,554,462,462

2,147,483,647

Python 3

WRONG_ANSWER

TESTS

5

93

0

m=input().split() x=input().split() a=int(x[0]) b=int(x[1]) emon=input().split() emon1=[] mishu=input().split() mishu1=[] for i in range(a): c=int(emon[i]) emon1.append(c) for i in range(b): c=int(mishu[i]) mishu1.append(c) emon1.sort() mishu1.sort() m=emon1[-1] n=mishu1[0] if (n>m): print("YES") else : print("NO")

Title: Arrays Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given two arrays *A* and *B* consisting of integers, sorted in non-decreasing order. Check whether it is possible to choose *k* numbers in array *A* and choose *m* numbers in array *B* so that any number chosen in the first array is strictly less than any number chosen in the second array. Input Specification: The first line contains two integers *n**A*,<=*n**B* (1<=≤<=*n**A*,<=*n**B*<=≤<=105), separated by a space — the sizes of arrays *A* and *B*, correspondingly. The second line contains two integers *k* and *m* (1<=≤<=*k*<=≤<=*n**A*,<=1<=≤<=*m*<=≤<=*n**B*), separated by a space. The third line contains *n**A* numbers *a*1,<=*a*2,<=... *a**n**A* (<=-<=109<=≤<=*a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n**A*<=≤<=109), separated by spaces — elements of array *A*. The fourth line contains *n**B* integers *b*1,<=*b*2,<=... *b**n**B* (<=-<=109<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**n**B*<=≤<=109), separated by spaces — elements of array *B*. Output Specification: Print "YES" (without the quotes), if you can choose *k* numbers in array *A* and *m* numbers in array *B* so that any number chosen in array *A* was strictly less than any number chosen in array *B*. Otherwise, print "NO" (without the quotes). Demo Input: ['3 3\n2 1\n1 2 3\n3 4 5\n', '3 3\n3 3\n1 2 3\n3 4 5\n', '5 2\n3 1\n1 1 1 1 1\n2 2\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n'] Note: In the first sample test you can, for example, choose numbers 1 and 2 from array *A* and number 3 from array *B* (1 < 3 and 2 < 3). In the second sample test the only way to choose *k* elements in the first array and *m* elements in the second one is to choose all numbers in both arrays, but then not all the numbers chosen in *A* will be less than all the numbers chosen in *B*: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7280148ed5eab0a7d418d4f92b32061243a8ca58.png" style="max-width: 100.0%;max-height: 100.0%;"/>.

```python m=input().split() x=input().split() a=int(x[0]) b=int(x[1]) emon=input().split() emon1=[] mishu=input().split() mishu1=[] for i in range(a): c=int(emon[i]) emon1.append(c) for i in range(b): c=int(mishu[i]) mishu1.append(c) emon1.sort() mishu1.sort() m=emon1[-1] n=mishu1[0] if (n>m): print("YES") else : print("NO") ```

0

703

A

Mishka and Game

PROGRAMMING

800

[ "implementation" ]

null

Mishka is a little polar bear. As known, little bears loves spending their free time playing dice for chocolates. Once in a wonderful sunny morning, walking around blocks of ice, Mishka met her friend Chris, and they started playing the game. Rules of the game are very simple: at first number of rounds *n* is defined. In every round each of the players throws a cubical dice with distinct numbers from 1 to 6 written on its faces. Player, whose value after throwing the dice is greater, wins the round. In case if player dice values are equal, no one of them is a winner. In average, player, who won most of the rounds, is the winner of the game. In case if two players won the same number of rounds, the result of the game is draw. Mishka is still very little and can't count wins and losses, so she asked you to watch their game and determine its result. Please help her!

The first line of the input contains single integer *n* *n* (1<=≤<=*n*<=≤<=100) — the number of game rounds. The next *n* lines contains rounds description. *i*-th of them contains pair of integers *m**i* and *c**i* (1<=≤<=*m**i*,<=<=*c**i*<=≤<=6) — values on dice upper face after Mishka's and Chris' throws in *i*-th round respectively.

If Mishka is the winner of the game, print "Mishka" (without quotes) in the only line. If Chris is the winner of the game, print "Chris" (without quotes) in the only line. If the result of the game is draw, print "Friendship is magic!^^" (without quotes) in the only line.

[ "3\n3 5\n2 1\n4 2\n", "2\n6 1\n1 6\n", "3\n1 5\n3 3\n2 2\n" ]

[ "Mishka", "Friendship is magic!^^", "Chris" ]

In the first sample case Mishka loses the first round, but wins second and third rounds and thus she is the winner of the game. In the second sample case Mishka wins the first round, Chris wins the second round, and the game ends with draw with score 1:1. In the third sample case Chris wins the first round, but there is no winner of the next two rounds. The winner of the game is Chris.

500

[ { "input": "3\n3 5\n2 1\n4 2", "output": "Mishka" }, { "input": "2\n6 1\n1 6", "output": "Friendship is magic!^^" }, { "input": "3\n1 5\n3 3\n2 2", "output": "Chris" }, { "input": "6\n4 1\n4 2\n5 3\n5 1\n5 3\n4 1", "output": "Mishka" }, { "input": "8\n2 4\n1 4\n1 5\n2 6\n2 5\n2 5\n2 4\n2 5", "output": "Chris" }, { "input": "8\n4 1\n2 6\n4 2\n2 5\n5 2\n3 5\n5 2\n1 5", "output": "Friendship is magic!^^" }, { "input": "9\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n1 3", "output": "Mishka" }, { "input": "9\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "9\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1", "output": "Chris" }, { "input": "9\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "10\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n1 4", "output": "Mishka" }, { "input": "10\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "10\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1", "output": "Chris" }, { "input": "10\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "100\n2 4\n6 6\n3 2\n1 5\n5 2\n1 5\n1 5\n3 1\n6 5\n4 3\n1 1\n5 1\n3 3\n2 4\n1 5\n3 4\n5 1\n5 5\n2 5\n2 1\n4 3\n6 5\n1 1\n2 1\n1 3\n1 1\n6 4\n4 6\n6 4\n2 1\n2 5\n6 2\n3 4\n5 5\n1 4\n4 6\n3 4\n1 6\n5 1\n4 3\n3 4\n2 2\n1 2\n2 3\n1 3\n4 4\n5 5\n4 5\n4 4\n3 1\n4 5\n2 3\n2 6\n6 5\n6 1\n6 6\n2 3\n6 4\n3 3\n2 5\n4 4\n3 1\n2 4\n6 1\n3 2\n1 3\n5 4\n6 6\n2 5\n5 1\n1 1\n2 5\n6 5\n3 6\n5 6\n4 3\n3 4\n3 4\n6 5\n5 2\n4 2\n1 1\n3 1\n2 6\n1 6\n1 2\n6 1\n3 4\n1 6\n3 1\n5 3\n1 3\n5 6\n2 1\n6 4\n3 1\n1 6\n6 3\n3 3\n4 3", "output": "Chris" }, { "input": "100\n4 1\n3 4\n4 6\n4 5\n6 5\n5 3\n6 2\n6 3\n5 2\n4 5\n1 5\n5 4\n1 4\n4 5\n4 6\n1 6\n4 4\n5 1\n6 4\n6 4\n4 6\n2 3\n6 2\n4 6\n1 4\n2 3\n4 3\n1 3\n6 2\n3 1\n3 4\n2 6\n4 5\n5 4\n2 2\n2 5\n4 1\n2 2\n3 3\n1 4\n5 6\n6 4\n4 2\n6 1\n5 5\n4 1\n2 1\n6 4\n4 4\n4 3\n5 3\n4 5\n5 3\n3 5\n6 3\n1 1\n3 4\n6 3\n6 1\n5 1\n2 4\n4 3\n2 2\n5 5\n1 5\n5 3\n4 6\n1 4\n6 3\n4 3\n2 4\n3 2\n2 4\n3 4\n6 2\n5 6\n1 2\n1 5\n5 5\n2 6\n5 1\n1 6\n5 3\n3 5\n2 6\n4 6\n6 2\n3 1\n5 5\n6 1\n3 6\n4 4\n1 1\n4 6\n5 3\n4 2\n5 1\n3 3\n2 1\n1 4", "output": "Mishka" }, { "input": "100\n6 3\n4 5\n4 3\n5 4\n5 1\n6 3\n4 2\n4 6\n3 1\n2 4\n2 2\n4 6\n5 3\n5 5\n4 2\n6 2\n2 3\n4 4\n6 4\n3 5\n2 4\n2 2\n5 2\n3 5\n2 4\n4 4\n3 5\n6 5\n1 3\n1 6\n2 2\n2 4\n3 2\n5 4\n1 6\n3 4\n4 1\n1 5\n1 4\n5 3\n2 2\n4 5\n6 3\n4 4\n1 1\n4 1\n2 4\n4 1\n4 5\n5 3\n1 1\n1 6\n5 6\n6 6\n4 2\n4 3\n3 4\n3 6\n3 4\n6 5\n3 4\n5 4\n5 1\n5 3\n5 1\n1 2\n2 6\n3 4\n6 5\n4 3\n1 1\n5 5\n5 1\n3 3\n5 2\n1 3\n6 6\n5 6\n1 4\n4 4\n1 4\n3 6\n6 5\n3 3\n3 6\n1 5\n1 2\n3 6\n3 6\n4 1\n5 2\n1 2\n5 2\n3 3\n4 4\n4 2\n6 2\n5 4\n6 1\n6 3", "output": "Mishka" }, { "input": "8\n4 1\n6 2\n4 1\n5 3\n4 1\n5 3\n6 2\n5 3", "output": "Mishka" }, { "input": "5\n3 6\n3 5\n3 5\n1 6\n3 5", "output": "Chris" }, { "input": "4\n4 1\n2 4\n5 3\n3 6", "output": "Friendship is magic!^^" }, { "input": "6\n6 3\n5 1\n6 3\n4 3\n4 3\n5 2", "output": "Mishka" }, { "input": "7\n3 4\n1 4\n2 5\n1 6\n1 6\n1 5\n3 4", "output": "Chris" }, { "input": "6\n6 2\n2 5\n5 2\n3 6\n4 3\n1 6", "output": "Friendship is magic!^^" }, { "input": "8\n6 1\n5 3\n4 3\n4 1\n5 1\n4 2\n4 2\n4 1", "output": "Mishka" }, { "input": "9\n2 5\n2 5\n1 4\n2 6\n2 4\n2 5\n2 6\n1 5\n2 5", "output": "Chris" }, { "input": "4\n6 2\n2 4\n4 2\n3 6", "output": "Friendship is magic!^^" }, { "input": "9\n5 2\n4 1\n4 1\n5 1\n6 2\n6 1\n5 3\n6 1\n6 2", "output": "Mishka" }, { "input": "8\n2 4\n3 6\n1 6\n1 6\n2 4\n3 4\n3 6\n3 4", "output": "Chris" }, { "input": "6\n5 3\n3 6\n6 2\n1 6\n5 1\n3 5", "output": "Friendship is magic!^^" }, { "input": "6\n5 2\n5 1\n6 1\n5 2\n4 2\n5 1", "output": "Mishka" }, { "input": "5\n1 4\n2 5\n3 4\n2 6\n3 4", "output": "Chris" }, { "input": "4\n6 2\n3 4\n5 1\n1 6", "output": "Friendship is magic!^^" }, { "input": "93\n4 3\n4 1\n4 2\n5 2\n5 3\n6 3\n4 3\n6 2\n6 3\n5 1\n4 2\n4 2\n5 1\n6 2\n6 3\n6 1\n4 1\n6 2\n5 3\n4 3\n4 1\n4 2\n5 2\n6 3\n5 2\n5 2\n6 3\n5 1\n6 2\n5 2\n4 1\n5 2\n5 1\n4 1\n6 1\n5 2\n4 3\n5 3\n5 3\n5 1\n4 3\n4 3\n4 2\n4 1\n6 2\n6 1\n4 1\n5 2\n5 2\n6 2\n5 3\n5 1\n6 2\n5 1\n6 3\n5 2\n6 2\n6 2\n4 2\n5 2\n6 1\n6 3\n6 3\n5 1\n5 1\n4 1\n5 1\n4 3\n5 3\n6 3\n4 1\n4 3\n6 1\n6 1\n4 2\n6 2\n4 2\n5 2\n4 1\n5 2\n4 1\n5 1\n5 2\n5 1\n4 1\n6 3\n6 2\n4 3\n4 1\n5 2\n4 3\n5 2\n5 1", "output": "Mishka" }, { "input": "11\n1 6\n1 6\n2 4\n2 5\n3 4\n1 5\n1 6\n1 5\n1 6\n2 6\n3 4", "output": "Chris" }, { "input": "70\n6 1\n3 6\n4 3\n2 5\n5 2\n1 4\n6 2\n1 6\n4 3\n1 4\n5 3\n2 4\n5 3\n1 6\n5 1\n3 5\n4 2\n2 4\n5 1\n3 5\n6 2\n1 5\n4 2\n2 5\n5 3\n1 5\n4 2\n1 4\n5 2\n2 6\n4 3\n1 5\n6 2\n3 4\n4 2\n3 5\n6 3\n3 4\n5 1\n1 4\n4 2\n1 4\n6 3\n2 6\n5 2\n1 6\n6 1\n2 6\n5 3\n1 5\n5 1\n1 6\n4 1\n1 5\n4 2\n2 4\n5 1\n2 5\n6 3\n1 4\n6 3\n3 6\n5 1\n1 4\n5 3\n3 5\n4 2\n3 4\n6 2\n1 4", "output": "Friendship is magic!^^" }, { "input": "59\n4 1\n5 3\n6 1\n4 2\n5 1\n4 3\n6 1\n5 1\n4 3\n4 3\n5 2\n5 3\n4 1\n6 2\n5 1\n6 3\n6 3\n5 2\n5 2\n6 1\n4 1\n6 1\n4 3\n5 3\n5 3\n4 3\n4 2\n4 2\n6 3\n6 3\n6 1\n4 3\n5 1\n6 2\n6 1\n4 1\n6 1\n5 3\n4 2\n5 1\n6 2\n6 2\n4 3\n5 3\n4 3\n6 3\n5 2\n5 2\n4 3\n5 1\n5 3\n6 1\n6 3\n6 3\n4 3\n5 2\n5 2\n5 2\n4 3", "output": "Mishka" }, { "input": "42\n1 5\n1 6\n1 6\n1 4\n2 5\n3 6\n1 6\n3 4\n2 5\n2 5\n2 4\n1 4\n3 4\n2 4\n2 6\n1 5\n3 6\n2 6\n2 6\n3 5\n1 4\n1 5\n2 6\n3 6\n1 4\n3 4\n2 4\n1 6\n3 4\n2 4\n2 6\n1 6\n1 4\n1 6\n1 6\n2 4\n1 5\n1 6\n2 5\n3 6\n3 5\n3 4", "output": "Chris" }, { "input": "78\n4 3\n3 5\n4 3\n1 5\n5 1\n1 5\n4 3\n1 4\n6 3\n1 5\n4 1\n2 4\n4 3\n2 4\n5 1\n3 6\n4 2\n3 6\n6 3\n3 4\n4 3\n3 6\n5 3\n1 5\n4 1\n2 6\n4 2\n2 4\n4 1\n3 5\n5 2\n3 6\n4 3\n2 4\n6 3\n1 6\n4 3\n3 5\n6 3\n2 6\n4 1\n2 4\n6 2\n1 6\n4 2\n1 4\n4 3\n1 4\n4 3\n2 4\n6 2\n3 5\n6 1\n3 6\n5 3\n1 6\n6 1\n2 6\n4 2\n1 5\n6 2\n2 6\n6 3\n2 4\n4 2\n3 5\n6 1\n2 5\n5 3\n2 6\n5 1\n3 6\n4 3\n3 6\n6 3\n2 5\n6 1\n2 6", "output": "Friendship is magic!^^" }, { "input": "76\n4 1\n5 2\n4 3\n5 2\n5 3\n5 2\n6 1\n4 2\n6 2\n5 3\n4 2\n6 2\n4 1\n4 2\n5 1\n5 1\n6 2\n5 2\n5 3\n6 3\n5 2\n4 3\n6 3\n6 1\n4 3\n6 2\n6 1\n4 1\n6 1\n5 3\n4 1\n5 3\n4 2\n5 2\n4 3\n6 1\n6 2\n5 2\n6 1\n5 3\n4 3\n5 1\n5 3\n4 3\n5 1\n5 1\n4 1\n4 1\n4 1\n4 3\n5 3\n6 3\n6 3\n5 2\n6 2\n6 3\n5 1\n6 3\n5 3\n6 1\n5 3\n4 1\n5 3\n6 1\n4 2\n6 2\n4 3\n4 1\n6 2\n4 3\n5 3\n5 2\n5 3\n5 1\n6 3\n5 2", "output": "Mishka" }, { "input": "84\n3 6\n3 4\n2 5\n2 4\n1 6\n3 4\n1 5\n1 6\n3 5\n1 6\n2 4\n2 6\n2 6\n2 4\n3 5\n1 5\n3 6\n3 6\n3 4\n3 4\n2 6\n1 6\n1 6\n3 5\n3 4\n1 6\n3 4\n3 5\n2 4\n2 5\n2 5\n3 5\n1 6\n3 4\n2 6\n2 6\n3 4\n3 4\n2 5\n2 5\n2 4\n3 4\n2 5\n3 4\n3 4\n2 6\n2 6\n1 6\n2 4\n1 5\n3 4\n2 5\n2 5\n3 4\n2 4\n2 6\n2 6\n1 4\n3 5\n3 5\n2 4\n2 5\n3 4\n1 5\n1 5\n2 6\n1 5\n3 5\n2 4\n2 5\n3 4\n2 6\n1 6\n2 5\n3 5\n3 5\n3 4\n2 5\n2 6\n3 4\n1 6\n2 5\n2 6\n1 4", "output": "Chris" }, { "input": "44\n6 1\n1 6\n5 2\n1 4\n6 2\n2 5\n5 3\n3 6\n5 2\n1 6\n4 1\n2 4\n6 1\n3 4\n6 3\n3 6\n4 3\n2 4\n6 1\n3 4\n6 1\n1 6\n4 1\n3 5\n6 1\n3 6\n4 1\n1 4\n4 2\n2 6\n6 1\n2 4\n6 2\n1 4\n6 2\n2 4\n5 2\n3 6\n6 3\n2 6\n5 3\n3 4\n5 3\n2 4", "output": "Friendship is magic!^^" }, { "input": "42\n5 3\n5 1\n5 2\n4 1\n6 3\n6 1\n6 2\n4 1\n4 3\n4 1\n5 1\n5 3\n5 1\n4 1\n4 2\n6 1\n6 3\n5 1\n4 1\n4 1\n6 3\n4 3\n6 3\n5 2\n6 1\n4 1\n5 3\n4 3\n5 2\n6 3\n6 1\n5 1\n4 2\n4 3\n5 2\n5 3\n6 3\n5 2\n5 1\n5 3\n6 2\n6 1", "output": "Mishka" }, { "input": "50\n3 6\n2 6\n1 4\n1 4\n1 4\n2 5\n3 4\n3 5\n2 6\n1 6\n3 5\n1 5\n2 6\n2 4\n2 4\n3 5\n1 6\n1 5\n1 5\n1 4\n3 5\n1 6\n3 5\n1 4\n1 5\n1 4\n3 6\n1 6\n1 4\n1 4\n1 4\n1 5\n3 6\n1 6\n1 6\n2 4\n1 5\n2 6\n2 5\n3 5\n3 6\n3 4\n2 4\n2 6\n3 4\n2 5\n3 6\n3 5\n2 4\n2 4", "output": "Chris" }, { "input": "86\n6 3\n2 4\n6 3\n3 5\n6 3\n1 5\n5 2\n2 4\n4 3\n2 6\n4 1\n2 6\n5 2\n1 4\n5 1\n2 4\n4 1\n1 4\n6 2\n3 5\n4 2\n2 4\n6 2\n1 5\n5 3\n2 5\n5 1\n1 6\n6 1\n1 4\n4 3\n3 4\n5 2\n2 4\n5 3\n2 5\n4 3\n3 4\n4 1\n1 5\n6 3\n3 4\n4 3\n3 4\n4 1\n3 4\n5 1\n1 6\n4 2\n1 6\n5 1\n2 4\n5 1\n3 6\n4 1\n1 5\n5 2\n1 4\n4 3\n2 5\n5 1\n1 5\n6 2\n2 6\n4 2\n2 4\n4 1\n2 5\n5 3\n3 4\n5 1\n3 4\n6 3\n3 4\n4 3\n2 6\n6 2\n2 5\n5 2\n3 5\n4 2\n3 6\n6 2\n3 4\n4 2\n2 4", "output": "Friendship is magic!^^" }, { "input": "84\n6 1\n6 3\n6 3\n4 1\n4 3\n4 2\n6 3\n5 3\n6 1\n6 3\n4 3\n5 2\n5 3\n5 1\n6 2\n6 2\n6 1\n4 1\n6 3\n5 2\n4 1\n5 3\n6 3\n4 2\n6 2\n6 3\n4 3\n4 1\n4 3\n5 1\n5 1\n5 1\n4 1\n6 1\n4 3\n6 2\n5 1\n5 1\n6 2\n5 2\n4 1\n6 1\n6 1\n6 3\n6 2\n4 3\n6 3\n6 2\n5 2\n5 1\n4 3\n6 2\n4 1\n6 2\n6 1\n5 2\n5 1\n6 2\n6 1\n5 3\n5 2\n6 1\n6 3\n5 2\n6 1\n6 3\n4 3\n5 1\n6 3\n6 1\n5 3\n4 3\n5 2\n5 1\n6 2\n5 3\n6 1\n5 1\n4 1\n5 1\n5 1\n5 2\n5 2\n5 1", "output": "Mishka" }, { "input": "92\n1 5\n2 4\n3 5\n1 6\n2 5\n1 6\n3 6\n1 6\n2 4\n3 4\n3 4\n3 6\n1 5\n2 5\n1 5\n1 5\n2 6\n2 4\n3 6\n1 4\n1 6\n2 6\n3 4\n2 6\n2 6\n1 4\n3 5\n2 5\n2 6\n1 5\n1 4\n1 5\n3 6\n3 5\n2 5\n1 5\n3 5\n3 6\n2 6\n2 6\n1 5\n3 4\n2 4\n3 6\n2 5\n1 5\n2 4\n1 4\n2 6\n2 6\n2 6\n1 5\n3 6\n3 6\n2 5\n1 4\n2 4\n3 4\n1 5\n2 5\n2 4\n2 5\n3 5\n3 4\n3 6\n2 6\n3 5\n1 4\n3 4\n1 6\n3 6\n2 6\n1 4\n3 6\n3 6\n2 5\n2 6\n1 6\n2 6\n3 5\n2 5\n3 6\n2 5\n2 6\n1 5\n2 4\n1 4\n2 4\n1 5\n2 5\n2 5\n2 6", "output": "Chris" }, { "input": "20\n5 1\n1 4\n4 3\n1 5\n4 2\n3 6\n6 2\n1 6\n4 1\n1 4\n5 2\n3 4\n5 1\n1 6\n5 1\n2 6\n6 3\n2 5\n6 2\n2 4", "output": "Friendship is magic!^^" }, { "input": "100\n4 3\n4 3\n4 2\n4 3\n4 1\n4 3\n5 2\n5 2\n6 2\n4 2\n5 1\n4 2\n5 2\n6 1\n4 1\n6 3\n5 3\n5 1\n5 1\n5 1\n5 3\n6 1\n6 1\n4 1\n5 2\n5 2\n6 1\n6 3\n4 2\n4 1\n5 3\n4 1\n5 3\n5 1\n6 3\n6 3\n6 1\n5 2\n5 3\n5 3\n6 1\n4 1\n6 2\n6 1\n6 2\n6 3\n4 3\n4 3\n6 3\n4 2\n4 2\n5 3\n5 2\n5 2\n4 3\n5 3\n5 2\n4 2\n5 1\n4 2\n5 1\n5 3\n6 3\n5 3\n5 3\n4 2\n4 1\n4 2\n4 3\n6 3\n4 3\n6 2\n6 1\n5 3\n5 2\n4 1\n6 1\n5 2\n6 2\n4 2\n6 3\n4 3\n5 1\n6 3\n5 2\n4 3\n5 3\n5 3\n4 3\n6 3\n4 3\n4 1\n5 1\n6 2\n6 3\n5 3\n6 1\n6 3\n5 3\n6 1", "output": "Mishka" }, { "input": "100\n1 5\n1 4\n1 5\n2 4\n2 6\n3 6\n3 5\n1 5\n2 5\n3 6\n3 5\n1 6\n1 4\n1 5\n1 6\n2 6\n1 5\n3 5\n3 4\n2 6\n2 6\n2 5\n3 4\n1 6\n1 4\n2 4\n1 5\n1 6\n3 5\n1 6\n2 6\n3 5\n1 6\n3 4\n3 5\n1 6\n3 6\n2 4\n2 4\n3 5\n2 6\n1 5\n3 5\n3 6\n2 4\n2 4\n2 6\n3 4\n3 4\n1 5\n1 4\n2 5\n3 4\n1 4\n2 6\n2 5\n2 4\n2 4\n2 5\n1 5\n1 6\n1 5\n1 5\n1 5\n1 6\n3 4\n2 4\n3 5\n3 5\n1 6\n3 5\n1 5\n1 6\n3 6\n3 4\n1 5\n3 5\n3 6\n1 4\n3 6\n1 5\n3 5\n3 6\n3 5\n1 4\n3 4\n2 4\n2 4\n2 5\n3 6\n3 5\n1 5\n2 4\n1 4\n3 4\n1 5\n3 4\n3 6\n3 5\n3 4", "output": "Chris" }, { "input": "100\n4 3\n3 4\n5 1\n2 5\n5 3\n1 5\n6 3\n2 4\n5 2\n2 6\n5 2\n1 5\n6 3\n1 5\n6 3\n3 4\n5 2\n1 5\n6 1\n1 5\n4 2\n3 5\n6 3\n2 6\n6 3\n1 4\n6 2\n3 4\n4 1\n3 6\n5 1\n2 4\n5 1\n3 4\n6 2\n3 5\n4 1\n2 6\n4 3\n2 6\n5 2\n3 6\n6 2\n3 5\n4 3\n1 5\n5 3\n3 6\n4 2\n3 4\n6 1\n3 4\n5 2\n2 6\n5 2\n2 4\n6 2\n3 6\n4 3\n2 4\n4 3\n2 6\n4 2\n3 4\n6 3\n2 4\n6 3\n3 5\n5 2\n1 5\n6 3\n3 6\n4 3\n1 4\n5 2\n1 6\n4 1\n2 5\n4 1\n2 4\n4 2\n2 5\n6 1\n2 4\n6 3\n1 5\n4 3\n2 6\n6 3\n2 6\n5 3\n1 5\n4 1\n1 5\n6 2\n2 5\n5 1\n3 6\n4 3\n3 4", "output": "Friendship is magic!^^" }, { "input": "99\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n1 3", "output": "Mishka" }, { "input": "99\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "99\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1", "output": "Chris" }, { "input": "99\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "100\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n1 4", "output": "Mishka" }, { "input": "100\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "100\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1", "output": "Chris" }, { "input": "100\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "84\n6 2\n1 5\n6 2\n2 3\n5 5\n1 2\n3 4\n3 4\n6 5\n6 4\n2 5\n4 1\n1 2\n1 1\n1 4\n2 5\n5 6\n6 3\n2 4\n5 5\n2 6\n3 4\n5 1\n3 3\n5 5\n4 6\n4 6\n2 4\n4 1\n5 2\n2 2\n3 6\n3 3\n4 6\n1 1\n2 4\n6 5\n5 2\n6 5\n5 5\n2 5\n6 4\n1 1\n6 2\n3 6\n6 5\n4 4\n1 5\n5 6\n4 4\n3 5\n6 1\n3 4\n1 5\n4 6\n4 6\n4 1\n3 6\n6 2\n1 1\n4 5\n5 4\n5 3\n3 4\n6 4\n1 1\n5 2\n6 5\n6 1\n2 2\n2 4\n3 3\n4 6\n1 3\n6 6\n5 2\n1 6\n6 2\n6 6\n4 1\n3 6\n6 4\n2 3\n3 4", "output": "Chris" }, { "input": "70\n3 4\n2 3\n2 3\n6 5\n6 6\n4 3\n2 3\n3 1\n3 5\n5 6\n1 6\n2 5\n5 3\n2 5\n4 6\n5 1\n6 1\n3 1\n3 3\n5 3\n2 1\n3 3\n6 4\n6 3\n4 3\n4 5\n3 5\n5 5\n5 2\n1 6\n3 4\n5 2\n2 4\n1 6\n4 3\n4 3\n6 2\n1 3\n1 5\n6 1\n3 1\n1 1\n1 3\n2 2\n3 2\n6 4\n1 1\n4 4\n3 1\n4 5\n4 2\n6 3\n4 4\n3 2\n1 2\n2 6\n3 3\n1 5\n1 1\n6 5\n2 2\n3 1\n5 4\n5 2\n6 4\n6 3\n6 6\n6 3\n3 3\n5 4", "output": "Mishka" }, { "input": "56\n6 4\n3 4\n6 1\n3 3\n1 4\n2 3\n1 5\n2 5\n1 5\n5 5\n2 3\n1 1\n3 2\n3 5\n4 6\n4 4\n5 2\n4 3\n3 1\n3 6\n2 3\n3 4\n5 6\n5 2\n5 6\n1 5\n1 5\n4 1\n6 3\n2 2\n2 1\n5 5\n2 1\n4 1\n5 4\n2 5\n4 1\n6 2\n3 4\n4 2\n6 4\n5 4\n4 2\n4 3\n6 2\n6 2\n3 1\n1 4\n3 6\n5 1\n5 5\n3 6\n6 4\n2 3\n6 5\n3 3", "output": "Mishka" }, { "input": "94\n2 4\n6 4\n1 6\n1 4\n5 1\n3 3\n4 3\n6 1\n6 5\n3 2\n2 3\n5 1\n5 3\n1 2\n4 3\n3 2\n2 3\n4 6\n1 3\n6 3\n1 1\n3 2\n4 3\n1 5\n4 6\n3 2\n6 3\n1 6\n1 1\n1 2\n3 5\n1 3\n3 5\n4 4\n4 2\n1 4\n4 5\n1 3\n1 2\n1 1\n5 4\n5 5\n6 1\n2 1\n2 6\n6 6\n4 2\n3 6\n1 6\n6 6\n1 5\n3 2\n1 2\n4 4\n6 4\n4 1\n1 5\n3 3\n1 3\n3 4\n4 4\n1 1\n2 5\n4 5\n3 1\n3 1\n3 6\n3 2\n1 4\n1 6\n6 3\n2 4\n1 1\n2 2\n2 2\n2 1\n5 4\n1 2\n6 6\n2 2\n3 3\n6 3\n6 3\n1 6\n2 3\n2 4\n2 3\n6 6\n2 6\n6 3\n3 5\n1 4\n1 1\n3 5", "output": "Chris" }, { "input": "81\n4 2\n1 2\n2 3\n4 5\n6 2\n1 6\n3 6\n3 4\n4 6\n4 4\n3 5\n4 6\n3 6\n3 5\n3 1\n1 3\n5 3\n3 4\n1 1\n4 1\n1 2\n6 1\n1 3\n6 5\n4 5\n4 2\n4 5\n6 2\n1 2\n2 6\n5 2\n1 5\n2 4\n4 3\n5 4\n1 2\n5 3\n2 6\n6 4\n1 1\n1 3\n3 1\n3 1\n6 5\n5 5\n6 1\n6 6\n5 2\n1 3\n1 4\n2 3\n5 5\n3 1\n3 1\n4 4\n1 6\n6 4\n2 2\n4 6\n4 4\n2 6\n2 4\n2 4\n4 1\n1 6\n1 4\n1 3\n6 5\n5 1\n1 3\n5 1\n1 4\n3 5\n2 6\n1 3\n5 6\n3 5\n4 4\n5 5\n5 6\n4 3", "output": "Chris" }, { "input": "67\n6 5\n3 6\n1 6\n5 3\n5 4\n5 1\n1 6\n1 1\n3 2\n4 4\n3 1\n4 1\n1 5\n5 3\n3 3\n6 4\n2 4\n2 2\n4 3\n1 4\n1 4\n6 1\n1 2\n2 2\n5 1\n6 2\n3 5\n5 5\n2 2\n6 5\n6 2\n4 4\n3 1\n4 2\n6 6\n6 4\n5 1\n2 2\n4 5\n5 5\n4 6\n1 5\n6 3\n4 4\n1 5\n6 4\n3 6\n3 4\n1 6\n2 4\n2 1\n2 5\n6 5\n6 4\n4 1\n3 2\n1 2\n5 1\n5 6\n1 5\n3 5\n3 1\n5 3\n3 2\n5 1\n4 6\n6 6", "output": "Mishka" }, { "input": "55\n6 6\n6 5\n2 2\n2 2\n6 4\n5 5\n6 5\n5 3\n1 3\n2 2\n5 6\n3 3\n3 3\n6 5\n3 5\n5 5\n1 2\n1 1\n4 6\n1 2\n5 5\n6 2\n6 3\n1 2\n5 1\n1 3\n3 3\n4 4\n2 5\n1 1\n5 3\n4 3\n2 2\n4 5\n5 6\n4 5\n6 3\n1 6\n6 4\n3 6\n1 6\n5 2\n6 3\n2 3\n5 5\n4 3\n3 1\n4 2\n1 1\n2 5\n5 3\n2 2\n6 3\n4 5\n2 2", "output": "Mishka" }, { "input": "92\n2 3\n1 3\n2 6\n5 1\n5 5\n3 2\n5 6\n2 5\n3 1\n3 6\n4 5\n2 5\n1 2\n2 3\n6 5\n3 6\n4 4\n6 2\n4 5\n4 4\n5 1\n6 1\n3 4\n3 5\n6 6\n3 2\n6 4\n2 2\n3 5\n6 4\n6 3\n6 6\n3 4\n3 3\n6 1\n5 4\n6 2\n2 6\n5 6\n1 4\n4 6\n6 3\n3 1\n4 1\n6 6\n3 5\n6 3\n6 1\n1 6\n3 2\n6 6\n4 3\n3 4\n1 3\n3 5\n5 3\n6 5\n4 3\n5 5\n4 1\n1 5\n6 4\n2 3\n2 3\n1 5\n1 2\n5 2\n4 3\n3 6\n5 5\n5 4\n1 4\n3 3\n1 6\n5 6\n5 4\n5 3\n1 1\n6 2\n5 5\n2 5\n4 3\n6 6\n5 1\n1 1\n4 6\n4 6\n3 1\n6 4\n2 4\n2 2\n2 1", "output": "Chris" }, { "input": "79\n5 3\n4 6\n3 6\n2 1\n5 2\n2 3\n4 4\n6 2\n2 5\n1 6\n6 6\n2 6\n3 3\n4 5\n6 2\n2 1\n1 5\n5 1\n2 1\n2 6\n5 3\n6 2\n2 6\n2 3\n1 5\n4 4\n6 3\n5 2\n3 2\n1 3\n1 3\n6 3\n2 6\n3 6\n5 3\n4 5\n6 1\n3 5\n3 5\n6 5\n1 5\n4 2\n6 2\n2 3\n4 6\n3 6\n2 5\n4 4\n1 1\n4 6\n2 6\n6 4\n3 2\n4 1\n1 2\n6 4\n5 6\n1 4\n2 2\n5 4\n3 2\n1 2\n2 4\n2 5\n2 1\n3 6\n3 3\n1 1\n2 2\n4 4\n4 5\n3 3\n5 3\n6 2\n4 5\n6 5\n2 5\n5 6\n2 2", "output": "Chris" }, { "input": "65\n1 1\n5 1\n2 2\n5 4\n4 5\n2 5\n3 2\n5 6\n6 3\n1 1\n6 1\n1 5\n1 1\n5 2\n6 4\n1 6\n1 1\n4 3\n2 3\n5 6\n4 4\n6 2\n1 3\n4 3\n1 3\n6 3\n3 5\n4 2\n4 1\n6 1\n3 2\n2 6\n3 2\n3 5\n6 3\n4 3\n1 5\n2 6\n1 3\n4 1\n4 1\n2 5\n2 5\n6 2\n5 3\n3 1\n3 3\n5 1\n2 4\n5 3\n3 3\n1 1\n6 3\n3 3\n5 1\n1 6\n4 5\n6 6\n5 5\n2 5\n4 1\n2 2\n1 4\n1 6\n6 5", "output": "Mishka" }, { "input": "1\n1 1", "output": "Friendship is magic!^^" } ]

1,698,558,373

2,147,483,647

Python 3

OK

TESTS

69

46

0

n = int(input()) m = 0 k = 0 for i in range(n): a,b=map(int,input().split()) if a>b: m+=1 elif a<b: k+=1 if m>k: print("Mishka") elif m<k: print("Chris") else: print("Friendship is magic!^^")

Title: Mishka and Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mishka is a little polar bear. As known, little bears loves spending their free time playing dice for chocolates. Once in a wonderful sunny morning, walking around blocks of ice, Mishka met her friend Chris, and they started playing the game. Rules of the game are very simple: at first number of rounds *n* is defined. In every round each of the players throws a cubical dice with distinct numbers from 1 to 6 written on its faces. Player, whose value after throwing the dice is greater, wins the round. In case if player dice values are equal, no one of them is a winner. In average, player, who won most of the rounds, is the winner of the game. In case if two players won the same number of rounds, the result of the game is draw. Mishka is still very little and can't count wins and losses, so she asked you to watch their game and determine its result. Please help her! Input Specification: The first line of the input contains single integer *n* *n* (1<=≤<=*n*<=≤<=100) — the number of game rounds. The next *n* lines contains rounds description. *i*-th of them contains pair of integers *m**i* and *c**i* (1<=≤<=*m**i*,<=<=*c**i*<=≤<=6) — values on dice upper face after Mishka's and Chris' throws in *i*-th round respectively. Output Specification: If Mishka is the winner of the game, print "Mishka" (without quotes) in the only line. If Chris is the winner of the game, print "Chris" (without quotes) in the only line. If the result of the game is draw, print "Friendship is magic!^^" (without quotes) in the only line. Demo Input: ['3\n3 5\n2 1\n4 2\n', '2\n6 1\n1 6\n', '3\n1 5\n3 3\n2 2\n'] Demo Output: ['Mishka', 'Friendship is magic!^^', 'Chris'] Note: In the first sample case Mishka loses the first round, but wins second and third rounds and thus she is the winner of the game. In the second sample case Mishka wins the first round, Chris wins the second round, and the game ends with draw with score 1:1. In the third sample case Chris wins the first round, but there is no winner of the next two rounds. The winner of the game is Chris.

```python n = int(input()) m = 0 k = 0 for i in range(n): a,b=map(int,input().split()) if a>b: m+=1 elif a<b: k+=1 if m>k: print("Mishka") elif m<k: print("Chris") else: print("Friendship is magic!^^") ```

3

386

A

Second-Price Auction

PROGRAMMING

800

[ "implementation" ]

null

In this problem we consider a special type of an auction, which is called the second-price auction. As in regular auction *n* bidders place a bid which is price a bidder ready to pay. The auction is closed, that is, each bidder secretly informs the organizer of the auction price he is willing to pay. After that, the auction winner is the participant who offered the highest price. However, he pay not the price he offers, but the highest price among the offers of other participants (hence the name: the second-price auction). Write a program that reads prices offered by bidders and finds the winner and the price he will pay. Consider that all of the offered prices are different.

The first line of the input contains *n* (2<=≤<=*n*<=≤<=1000) — number of bidders. The second line contains *n* distinct integer numbers *p*1,<=*p*2,<=... *p**n*, separated by single spaces (1<=≤<=*p**i*<=≤<=10000), where *p**i* stands for the price offered by the *i*-th bidder.

The single output line should contain two integers: index of the winner and the price he will pay. Indices are 1-based.

[ "2\n5 7\n", "3\n10 2 8\n", "6\n3 8 2 9 4 14\n" ]

[ "2 5\n", "1 8\n", "6 9\n" ]

none

500

[ { "input": "2\n5 7", "output": "2 5" }, { "input": "3\n10 2 8", "output": "1 8" }, { "input": "6\n3 8 2 9 4 14", "output": "6 9" }, { "input": "4\n4707 7586 4221 5842", "output": "2 5842" }, { "input": "5\n3304 4227 4869 6937 6002", "output": "4 6002" }, { "input": "6\n5083 3289 7708 5362 9031 7458", "output": "5 7708" }, { "input": "7\n9038 6222 3392 1706 3778 1807 2657", "output": "1 6222" }, { "input": "8\n7062 2194 4481 3864 7470 1814 8091 733", "output": "7 7470" }, { "input": "9\n2678 5659 9199 2628 7906 7496 4524 2663 3408", "output": "3 7906" }, { "input": "2\n3458 1504", "output": "1 1504" }, { "input": "50\n9237 3904 407 9052 6657 9229 9752 3888 7732 2512 4614 1055 2355 7108 6506 6849 2529 8862 159 8630 7906 7941 960 8470 333 8659 54 9475 3163 5625 6393 6814 2656 3388 169 7918 4881 8468 9983 6281 6340 280 5108 2996 101 7617 3313 8172 326 1991", "output": "39 9752" }, { "input": "100\n2515 3324 7975 6171 4240 1217 4829 5203 8603 6900 3031 4699 4732 6070 4221 3228 6497 7359 9130 4346 4619 1109 3945 5442 3271 16 9711 2045 6410 2301 3406 8125 6003 1892 1260 9661 3940 6692 4708 7027 4930 6925 1979 5361 4263 3144 867 8639 6230 5562 9714 3676 4231 3347 4733 4920 4881 3431 1059 7313 8912 3038 9308 72 9583 7009 3034 7425 2398 6141 3245 2495 2933 6710 8289 9806 1226 8393 7349 6462 1618 9613 3546 6012 2964 9995 1578 210 2123 4874 1252 8625 348 8020 803 7244 9080 5088 706 2602", "output": "86 9806" }, { "input": "2\n2 1", "output": "1 1" }, { "input": "2\n1 2", "output": "2 1" }, { "input": "3\n10 20 30", "output": "3 20" }, { "input": "3\n10 30 20", "output": "2 20" }, { "input": "3\n20 10 30", "output": "3 20" }, { "input": "3\n20 30 10", "output": "2 20" }, { "input": "3\n30 10 20", "output": "1 20" }, { "input": "3\n30 20 10", "output": "1 20" }, { "input": "2\n1 10000", "output": "2 1" }, { "input": "2\n10000 999", "output": "1 999" }, { "input": "3\n3 4 1", "output": "2 3" }, { "input": "6\n1 2 24 6 5 7", "output": "3 7" } ]

1,618,484,612

2,147,483,647

Python 3

WRONG_ANSWER

TESTS

0

61

0

input() l=list(map(int,input().split())) a=l.index(max(l)) l.remove(max(l)) l.sort() print(a,l[-1],sep=' ')

Title: Second-Price Auction Time Limit: None seconds Memory Limit: None megabytes Problem Description: In this problem we consider a special type of an auction, which is called the second-price auction. As in regular auction *n* bidders place a bid which is price a bidder ready to pay. The auction is closed, that is, each bidder secretly informs the organizer of the auction price he is willing to pay. After that, the auction winner is the participant who offered the highest price. However, he pay not the price he offers, but the highest price among the offers of other participants (hence the name: the second-price auction). Write a program that reads prices offered by bidders and finds the winner and the price he will pay. Consider that all of the offered prices are different. Input Specification: The first line of the input contains *n* (2<=≤<=*n*<=≤<=1000) — number of bidders. The second line contains *n* distinct integer numbers *p*1,<=*p*2,<=... *p**n*, separated by single spaces (1<=≤<=*p**i*<=≤<=10000), where *p**i* stands for the price offered by the *i*-th bidder. Output Specification: The single output line should contain two integers: index of the winner and the price he will pay. Indices are 1-based. Demo Input: ['2\n5 7\n', '3\n10 2 8\n', '6\n3 8 2 9 4 14\n'] Demo Output: ['2 5\n', '1 8\n', '6 9\n'] Note: none

```python input() l=list(map(int,input().split())) a=l.index(max(l)) l.remove(max(l)) l.sort() print(a,l[-1],sep=' ') ```

0

777

C

Alyona and Spreadsheet

PROGRAMMING

1,600

[ "binary search", "data structures", "dp", "greedy", "implementation", "two pointers" ]

null

During the lesson small girl Alyona works with one famous spreadsheet computer program and learns how to edit tables. Now she has a table filled with integers. The table consists of *n* rows and *m* columns. By *a**i*,<=*j* we will denote the integer located at the *i*-th row and the *j*-th column. We say that the table is sorted in non-decreasing order in the column *j* if *a**i*,<=*j*<=≤<=*a**i*<=+<=1,<=*j* for all *i* from 1 to *n*<=-<=1. Teacher gave Alyona *k* tasks. For each of the tasks two integers *l* and *r* are given and Alyona has to answer the following question: if one keeps the rows from *l* to *r* inclusive and deletes all others, will the table be sorted in non-decreasing order in at least one column? Formally, does there exist such *j* that *a**i*,<=*j*<=≤<=*a**i*<=+<=1,<=*j* for all *i* from *l* to *r*<=-<=1 inclusive. Alyona is too small to deal with this task and asks you to help!

The first line of the input contains two positive integers *n* and *m* (1<=≤<=*n*·*m*<=≤<=100<=000) — the number of rows and the number of columns in the table respectively. Note that your are given a constraint that bound the product of these two integers, i.e. the number of elements in the table. Each of the following *n* lines contains *m* integers. The *j*-th integers in the *i* of these lines stands for *a**i*,<=*j* (1<=≤<=*a**i*,<=*j*<=≤<=109). The next line of the input contains an integer *k* (1<=≤<=*k*<=≤<=100<=000) — the number of task that teacher gave to Alyona. The *i*-th of the next *k* lines contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*).

Print "Yes" to the *i*-th line of the output if the table consisting of rows from *l**i* to *r**i* inclusive is sorted in non-decreasing order in at least one column. Otherwise, print "No".

[ "5 4\n1 2 3 5\n3 1 3 2\n4 5 2 3\n5 5 3 2\n4 4 3 4\n6\n1 1\n2 5\n4 5\n3 5\n1 3\n1 5\n" ]

[ "Yes\nNo\nYes\nYes\nYes\nNo\n" ]

In the sample, the whole table is not sorted in any column. However, rows 1–3 are sorted in column 1, while rows 4–5 are sorted in column 3.

1,500

[ { "input": "5 4\n1 2 3 5\n3 1 3 2\n4 5 2 3\n5 5 3 2\n4 4 3 4\n6\n1 1\n2 5\n4 5\n3 5\n1 3\n1 5", "output": "Yes\nNo\nYes\nYes\nYes\nNo" }, { "input": "1 1\n1\n1\n1 1", "output": "Yes" }, { "input": "10 1\n523130301\n127101624\n15573616\n703140639\n628818570\n957494759\n161270109\n386865653\n67832626\n53360557\n17\n4 5\n4 7\n8 8\n9 9\n3 9\n8 10\n8 9\n7 9\n4 5\n2 9\n4 6\n2 4\n2 6\n4 6\n7 9\n2 4\n8 10", "output": "No\nNo\nYes\nYes\nNo\nNo\nNo\nNo\nNo\nNo\nNo\nNo\nNo\nNo\nNo\nNo\nNo" }, { "input": "15 1\n556231456\n573340933\n626155933\n397229387\n10255952\n376567394\n906742013\n269437009\n31298788\n712285290\n620239975\n379221898\n229140718\n95080095\n997123854\n18\n5 15\n1 12\n4 10\n2 15\n12 15\n15 15\n2 2\n15 15\n15 15\n13 13\n10 14\n3 6\n14 15\n3 6\n4 4\n14 15\n12 14\n1 9", "output": "No\nNo\nNo\nNo\nNo\nYes\nYes\nYes\nYes\nYes\nNo\nNo\nYes\nNo\nYes\nYes\nNo\nNo" }, { "input": "11 1\n501465490\n366941771\n415080944\n385243536\n445132523\n697044413\n894369800\n812743722\n23684788\n466526046\n953916313\n45\n2 4\n8 9\n7 7\n4 9\n2 9\n2 11\n4 4\n5 7\n1 2\n5 10\n4 6\n1 7\n4 4\n1 6\n4 7\n10 11\n1 8\n6 11\n8 8\n8 10\n1 1\n5 10\n9 10\n6 9\n6 11\n1 1\n9 9\n5 11\n1 2\n9 11\n2 6\n3 7\n11 11\n6 7\n11 11\n7 8\n5 8\n11 11\n5 6\n4 5\n2 6\n5 10\n9 9\n1 1\n1 1", "output": "No\nNo\nYes\nNo\nNo\nNo\nYes\nYes\nNo\nNo\nYes\nNo\nYes\nNo\nYes\nYes\nNo\nNo\nYes\nNo\nYes\nNo\nYes\nNo\nNo\nYes\nYes\nNo\nNo\nYes\nNo\nNo\nYes\nYes\nYes\nNo\nNo\nYes\nYes\nYes\nNo\nNo\nYes\nYes\nYes" } ]

1,510,497,756

5,256

PyPy 3

TIME_LIMIT_EXCEEDED

TESTS

2

1,000

8,499,200

def main(): read = lambda: tuple(map(int, input().split())) n, m = read() arr = [[0]*m for i in range(n+1)] prev = [0]*m def addN(y, x, v): if v >= prev[x]: arr[y][x] = arr[y-1][x] + 1 else: arr[y][x] = 0 prev[x] = v for y in range(n): for x, v in enumerate(read()): addN(y+1, x, v) q = read()[0] maxx = [0] * (n + 1) for y in range(n+1): maxx[y] = max(arr[y]) for i in range(q): l, r = read() #print("Q") #ll = [arr[r][x]-arr[l][x] for x in range(m)] print("Yes" if r - l <= maxx[r] else "No ") main()

Title: Alyona and Spreadsheet Time Limit: None seconds Memory Limit: None megabytes Problem Description: During the lesson small girl Alyona works with one famous spreadsheet computer program and learns how to edit tables. Now she has a table filled with integers. The table consists of *n* rows and *m* columns. By *a**i*,<=*j* we will denote the integer located at the *i*-th row and the *j*-th column. We say that the table is sorted in non-decreasing order in the column *j* if *a**i*,<=*j*<=≤<=*a**i*<=+<=1,<=*j* for all *i* from 1 to *n*<=-<=1. Teacher gave Alyona *k* tasks. For each of the tasks two integers *l* and *r* are given and Alyona has to answer the following question: if one keeps the rows from *l* to *r* inclusive and deletes all others, will the table be sorted in non-decreasing order in at least one column? Formally, does there exist such *j* that *a**i*,<=*j*<=≤<=*a**i*<=+<=1,<=*j* for all *i* from *l* to *r*<=-<=1 inclusive. Alyona is too small to deal with this task and asks you to help! Input Specification: The first line of the input contains two positive integers *n* and *m* (1<=≤<=*n*·*m*<=≤<=100<=000) — the number of rows and the number of columns in the table respectively. Note that your are given a constraint that bound the product of these two integers, i.e. the number of elements in the table. Each of the following *n* lines contains *m* integers. The *j*-th integers in the *i* of these lines stands for *a**i*,<=*j* (1<=≤<=*a**i*,<=*j*<=≤<=109). The next line of the input contains an integer *k* (1<=≤<=*k*<=≤<=100<=000) — the number of task that teacher gave to Alyona. The *i*-th of the next *k* lines contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). Output Specification: Print "Yes" to the *i*-th line of the output if the table consisting of rows from *l**i* to *r**i* inclusive is sorted in non-decreasing order in at least one column. Otherwise, print "No". Demo Input: ['5 4\n1 2 3 5\n3 1 3 2\n4 5 2 3\n5 5 3 2\n4 4 3 4\n6\n1 1\n2 5\n4 5\n3 5\n1 3\n1 5\n'] Demo Output: ['Yes\nNo\nYes\nYes\nYes\nNo\n'] Note: In the sample, the whole table is not sorted in any column. However, rows 1–3 are sorted in column 1, while rows 4–5 are sorted in column 3.

```python def main(): read = lambda: tuple(map(int, input().split())) n, m = read() arr = [[0]*m for i in range(n+1)] prev = [0]*m def addN(y, x, v): if v >= prev[x]: arr[y][x] = arr[y-1][x] + 1 else: arr[y][x] = 0 prev[x] = v for y in range(n): for x, v in enumerate(read()): addN(y+1, x, v) q = read()[0] maxx = [0] * (n + 1) for y in range(n+1): maxx[y] = max(arr[y]) for i in range(q): l, r = read() #print("Q") #ll = [arr[r][x]-arr[l][x] for x in range(m)] print("Yes" if r - l <= maxx[r] else "No ") main() ```

0

none

0

[ "none" ]

null

Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be. In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard. You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once.

The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters.

If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print «-1» (without quotes). Otherwise, the first line of output should contain the only integer *k* (*k*<=≥<=0) — the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct. If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair. Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes.

[ "helloworld\nehoolwlroz\n", "hastalavistababy\nhastalavistababy\n", "merrychristmas\nchristmasmerry\n" ]

[ "3\nh e\nl o\nd z\n", "0\n", "-1\n" ]

none

0

[ { "input": "helloworld\nehoolwlroz", "output": "3\nh e\nl o\nd z" }, { "input": "hastalavistababy\nhastalavistababy", "output": "0" }, { "input": "merrychristmas\nchristmasmerry", "output": "-1" }, { "input": "kusyvdgccw\nkusyvdgccw", "output": "0" }, { "input": "bbbbbabbab\naaaaabaaba", "output": "1\nb a" }, { "input": "zzzzzzzzzzzzzzzzzzzzz\nqwertyuiopasdfghjklzx", "output": "-1" }, { "input": "accdccdcdccacddbcacc\naccbccbcbccacbbdcacc", "output": "1\nd b" }, { "input": "giiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd\ngiiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd", "output": "0" }, { "input": "gndggadlmdefgejidmmcglbjdcmglncfmbjjndjcibnjbabfab\nfihffahlmhogfojnhmmcflkjhcmflicgmkjjihjcnkijkakgak", "output": "5\ng f\nn i\nd h\ne o\nb k" }, { "input": "ijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc\nijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc", "output": "0" }, { "input": "ab\naa", "output": "-1" }, { "input": "a\nz", "output": "1\na z" }, { "input": "zz\nzy", "output": "-1" }, { "input": "as\ndf", "output": "2\na d\ns f" }, { "input": "abc\nbca", "output": "-1" }, { "input": "rtfg\nrftg", "output": "1\nt f" }, { "input": "y\ny", "output": "0" }, { "input": "qwertyuiopasdfghjklzx\nzzzzzzzzzzzzzzzzzzzzz", "output": "-1" }, { "input": "qazwsxedcrfvtgbyhnujmik\nqwertyuiasdfghjkzxcvbnm", "output": "-1" }, { "input": "aaaaaa\nabcdef", "output": "-1" }, { "input": "qwerty\nffffff", "output": "-1" }, { "input": "dofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh\ndofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh", "output": "0" }, { "input": "acdbccddadbcbabbebbaebdcedbbcebeaccecdabadeabeecbacacdcbccedeadadedeccedecdaabcedccccbbcbcedcaccdede\ndcbaccbbdbacadaaeaadeabcebaaceaedccecbdadbedaeecadcdcbcaccebedbdbebeccebecbddacebccccaacacebcdccbebe", "output": "-1" }, { "input": "bacccbbacabbcaacbbba\nbacccbbacabbcaacbbba", "output": "0" }, { "input": "dbadbddddb\nacbacaaaac", "output": "-1" }, { "input": "dacbdbbbdd\nadbdadddaa", "output": "-1" }, { "input": "bbbbcbcbbc\ndaddbabddb", "output": "-1" }, { "input": "dddddbcdbd\nbcbbbdacdb", "output": "-1" }, { "input": "cbadcbcdaa\nabbbababbb", "output": "-1" }, { "input": "dmkgadidjgdjikgkehhfkhgkeamhdkfemikkjhhkdjfaenmkdgenijinamngjgkmgmmedfdehkhdigdnnkhmdkdindhkhndnakdgdhkdefagkedndnijekdmkdfedkhekgdkhgkimfeakdhhhgkkff\nbdenailbmnbmlcnehjjkcgnehadgickhdlecmggcimkahfdeinhflmlfadfnmncdnddhbkbhgejblnbffcgdbeilfigegfifaebnijeihkanehififlmhcbdcikhieghenbejneldkhaebjggncckk", "output": "-1" }, { "input": "acbbccabaa\nabbbbbabaa", "output": "-1" }, { "input": "ccccaccccc\naaaabaaaac", "output": "-1" }, { "input": "acbacacbbb\nacbacacbbb", "output": "0" }, { "input": "abbababbcc\nccccccccbb", "output": "-1" }, { "input": "jbcbbjiifdcbeajgdeabddbfcecafejddcigfcaedbgicjihifgbahjihcjefgabgbccdiibfjgacehbbdjceacdbdeaiibaicih\nhhihhhddcfihddhjfddhffhcididcdhffidjciddfhjdihdhdcjhdhhdhihdcjdhjhiifddhchjdidhhhfhiddifhfddddhddidh", "output": "-1" }, { "input": "ahaeheedefeehahfefhjhhedheeeedhehhfhdejdhffhhejhhhejadhefhahhadjjhdhheeeehfdaffhhefehhhefhhhhehehjda\neiefbdfgdhffieihfhjajifgjddffgifjbhigfagjhhjicaijbdaegidhiejiegaabgjidcfcjhgehhjjchcbjjdhjbiidjdjage", "output": "-1" }, { "input": "fficficbidbcbfaddifbffdbbiaccbbciiaidbcbbiadcccbccbbaibabcbbdbcibcciibiccfifbiiicadibbiaafadacdficbc\nddjhdghbgcbhadeccjdbddcbfjeiiaaigjejcaiabgechiiahibfejbeahafcfhjbihgjfgihdgdagjjhecjafjeedecehcdjhai", "output": "-1" }, { "input": "z\nz", "output": "0" }, { "input": "a\nz", "output": "1\na z" }, { "input": "z\na", "output": "1\nz a" }, { "input": "aa\nzz", "output": "1\na z" }, { "input": "az\nza", "output": "1\na z" }, { "input": "aa\nza", "output": "-1" }, { "input": "za\nzz", "output": "-1" }, { "input": "aa\nab", "output": "-1" }, { "input": "hehe\nheeh", "output": "-1" }, { "input": "bd\ncc", "output": "-1" }, { "input": "he\nhh", "output": "-1" }, { "input": "hee\nheh", "output": "-1" }, { "input": "aa\nac", "output": "-1" }, { "input": "ab\naa", "output": "-1" }, { "input": "hello\nehlol", "output": "-1" }, { "input": "ac\naa", "output": "-1" }, { "input": "aaabbb\nbbbaab", "output": "-1" }, { "input": "aa\nfa", "output": "-1" }, { "input": "hg\nee", "output": "-1" }, { "input": "helloworld\nehoolwlrow", "output": "-1" }, { "input": "abb\nbab", "output": "-1" }, { "input": "aaa\naae", "output": "-1" }, { "input": "aba\nbaa", "output": "-1" }, { "input": "aa\nba", "output": "-1" }, { "input": "da\naa", "output": "-1" }, { "input": "aaa\naab", "output": "-1" }, { "input": "xy\nzz", "output": "-1" } ]

1,482,659,631

2,931

Python 3

WRONG_ANSWER

PRETESTS

5

61

4,608,000

s1 = str(input()) s2 = str(input()) m1 = {} m2 = {} res = True for i in range(s1.__len__()): if s1[i] != s2[i]: if s1[i] not in m1: if s1[i] not in m2: m1[s1[i]] = s2[i] m2[s2[i]] = s1[i] else: if m2[s1[i]] != s2[i]: res = False break if res: print(m1.__len__()) for x in m1: print(x + " " + m1[x]) else: print(-1)

Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be. In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard. You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once. Input Specification: The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters. Output Specification: If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print «-1» (without quotes). Otherwise, the first line of output should contain the only integer *k* (*k*<=≥<=0) — the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct. If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair. Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes. Demo Input: ['helloworld\nehoolwlroz\n', 'hastalavistababy\nhastalavistababy\n', 'merrychristmas\nchristmasmerry\n'] Demo Output: ['3\nh e\nl o\nd z\n', '0\n', '-1\n'] Note: none

```python s1 = str(input()) s2 = str(input()) m1 = {} m2 = {} res = True for i in range(s1.__len__()): if s1[i] != s2[i]: if s1[i] not in m1: if s1[i] not in m2: m1[s1[i]] = s2[i] m2[s2[i]] = s1[i] else: if m2[s1[i]] != s2[i]: res = False break if res: print(m1.__len__()) for x in m1: print(x + " " + m1[x]) else: print(-1) ```

0

409

H

A + B Strikes Back

PROGRAMMING

1,500

[ "*special", "brute force", "constructive algorithms", "dsu", "implementation" ]

null

A + B is often used as an example of the easiest problem possible to show some contest platform. However, some scientists have observed that sometimes this problem is not so easy to get accepted. Want to try?

The input contains two integers *a* and *b* (0<=≤<=*a*,<=*b*<=≤<=103), separated by a single space.

Output the sum of the given integers.

[ "5 14\n", "381 492\n" ]

[ "19\n", "873\n" ]

none

0

[ { "input": "5 14", "output": "19" }, { "input": "381 492", "output": "873" }, { "input": "536 298", "output": "834" }, { "input": "143 522", "output": "665" }, { "input": "433 126", "output": "559" }, { "input": "723 350", "output": "1073" }, { "input": "632 264", "output": "896" }, { "input": "923 488", "output": "1411" }, { "input": "522 92", "output": "614" }, { "input": "953 553", "output": "1506" }, { "input": "242 86", "output": "328" }, { "input": "151 691", "output": "842" }, { "input": "441 915", "output": "1356" }, { "input": "740 519", "output": "1259" }, { "input": "339 433", "output": "772" }, { "input": "629 657", "output": "1286" }, { "input": "538 261", "output": "799" }, { "input": "828 485", "output": "1313" }, { "input": "117 399", "output": "516" }, { "input": "399 280", "output": "679" } ]

1,616,646,950

2,147,483,647

Python 3

COMPILATION_ERROR

TESTS

0

a=input().split() a=[0]int(a[0]) a=[1]int(a[1]) print(a[0]+a[1])

Title: A + B Strikes Back Time Limit: None seconds Memory Limit: None megabytes Problem Description: A + B is often used as an example of the easiest problem possible to show some contest platform. However, some scientists have observed that sometimes this problem is not so easy to get accepted. Want to try? Input Specification: The input contains two integers *a* and *b* (0<=≤<=*a*,<=*b*<=≤<=103), separated by a single space. Output Specification: Output the sum of the given integers. Demo Input: ['5 14\n', '381 492\n'] Demo Output: ['19\n', '873\n'] Note: none

```python a=input().split() a=[0]int(a[0]) a=[1]int(a[1]) print(a[0]+a[1]) ```

-1

961

B

Lecture Sleep

PROGRAMMING

1,200

[ "data structures", "dp", "implementation", "two pointers" ]

null

Your friend Mishka and you attend a calculus lecture. Lecture lasts *n* minutes. Lecturer tells *a**i* theorems during the *i*-th minute. Mishka is really interested in calculus, though it is so hard to stay awake for all the time of lecture. You are given an array *t* of Mishka's behavior. If Mishka is asleep during the *i*-th minute of the lecture then *t**i* will be equal to 0, otherwise it will be equal to 1. When Mishka is awake he writes down all the theorems he is being told — *a**i* during the *i*-th minute. Otherwise he writes nothing. You know some secret technique to keep Mishka awake for *k* minutes straight. However you can use it only once. You can start using it at the beginning of any minute between 1 and *n*<=-<=*k*<=+<=1. If you use it on some minute *i* then Mishka will be awake during minutes *j* such that and will write down all the theorems lecturer tells. You task is to calculate the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up.

The first line of the input contains two integer numbers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105) — the duration of the lecture in minutes and the number of minutes you can keep Mishka awake. The second line of the input contains *n* integer numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=104) — the number of theorems lecturer tells during the *i*-th minute. The third line of the input contains *n* integer numbers *t*1,<=*t*2,<=... *t**n* (0<=≤<=*t**i*<=≤<=1) — type of Mishka's behavior at the *i*-th minute of the lecture.

Print only one integer — the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up.

[ "6 3\n1 3 5 2 5 4\n1 1 0 1 0 0\n" ]

[ "16\n" ]

In the sample case the better way is to use the secret technique at the beginning of the third minute. Then the number of theorems Mishka will be able to write down will be equal to 16.

0

[ { "input": "6 3\n1 3 5 2 5 4\n1 1 0 1 0 0", "output": "16" }, { "input": "5 3\n1 9999 10000 10000 10000\n0 0 0 0 0", "output": "30000" }, { "input": "3 3\n10 10 10\n1 1 0", "output": "30" }, { "input": "1 1\n423\n0", "output": "423" }, { "input": "6 6\n1 3 5 2 5 4\n1 1 0 1 0 0", "output": "20" }, { "input": "5 2\n1 2 3 4 20\n0 0 0 1 0", "output": "24" }, { "input": "3 1\n1 2 3\n0 0 1", "output": "5" }, { "input": "4 2\n4 5 6 8\n1 0 1 0", "output": "18" }, { "input": "6 3\n1 3 5 2 1 15\n1 1 0 1 0 0", "output": "22" }, { "input": "5 5\n1 2 3 4 5\n1 1 1 0 1", "output": "15" }, { "input": "3 3\n3 3 3\n1 0 1", "output": "9" }, { "input": "5 5\n500 44 3 4 50\n1 0 0 0 0", "output": "601" }, { "input": "2 2\n3 2\n1 0", "output": "5" }, { "input": "7 6\n4 9 1 7 1 8 4\n0 0 0 1 0 1 0", "output": "30" }, { "input": "4 3\n6 5 9 6\n1 1 0 1", "output": "26" }, { "input": "2 1\n3 2\n0 0", "output": "3" }, { "input": "1 1\n10\n0", "output": "10" }, { "input": "2 1\n3 2\n1 0", "output": "5" }, { "input": "4 2\n3 6 7 2\n0 0 1 1", "output": "18" }, { "input": "10 5\n3 5 9 2 5 9 3 8 8 1\n0 1 1 1 0 1 0 0 0 0", "output": "49" }, { "input": "10 4\n9 5 6 4 3 9 5 1 10 7\n0 0 0 0 0 0 1 0 0 1", "output": "36" }, { "input": "9 8\n3 3 7 7 1 9 10 7 1\n1 1 1 1 1 1 1 1 1", "output": "48" }, { "input": "2 1\n3 4\n0 0", "output": "4" }, { "input": "2 1\n3 2\n0 1", "output": "5" }, { "input": "10 1\n6 6 8 7 6 6 3 2 5 6\n0 0 1 0 0 1 0 1 1 1", "output": "34" }, { "input": "3 2\n10 10 6\n0 0 0", "output": "20" }, { "input": "6 3\n1 3 5 2 5 4\n1 1 1 1 1 1", "output": "20" }, { "input": "10 5\n1 1 1 1 1 1 1 1 10000 1\n1 1 1 1 1 1 1 1 0 1", "output": "10009" } ]

1,600,301,956

2,147,483,647

Python 3

WRONG_ANSWER

TESTS

3

296

10,547,200

n_k = input().split() n = int(n_k[0]) k = int(n_k[1]) aulas = input().split() estado = input().split() soma_aulas = [] soma_acordado = [] s_aulas = 0 s_acordado = 0 for i in range(n): s_aulas += int(aulas[i]) soma_aulas.append(s_aulas) if(estado[i] == "1"): s_acordado += int(aulas[i]) soma_acordado.append(s_acordado) saida = 0 for j in range(n-k+1): a = j+k-1 s1 = soma_aulas[a]-soma_aulas[j-1] s2 = soma_acordado[a]-soma_acordado[j-1] s = s1 - s2 if s > saida: saida = s print (soma_acordado[n-1] + saida)

Title: Lecture Sleep Time Limit: None seconds Memory Limit: None megabytes Problem Description: Your friend Mishka and you attend a calculus lecture. Lecture lasts *n* minutes. Lecturer tells *a**i* theorems during the *i*-th minute. Mishka is really interested in calculus, though it is so hard to stay awake for all the time of lecture. You are given an array *t* of Mishka's behavior. If Mishka is asleep during the *i*-th minute of the lecture then *t**i* will be equal to 0, otherwise it will be equal to 1. When Mishka is awake he writes down all the theorems he is being told — *a**i* during the *i*-th minute. Otherwise he writes nothing. You know some secret technique to keep Mishka awake for *k* minutes straight. However you can use it only once. You can start using it at the beginning of any minute between 1 and *n*<=-<=*k*<=+<=1. If you use it on some minute *i* then Mishka will be awake during minutes *j* such that and will write down all the theorems lecturer tells. You task is to calculate the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up. Input Specification: The first line of the input contains two integer numbers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105) — the duration of the lecture in minutes and the number of minutes you can keep Mishka awake. The second line of the input contains *n* integer numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=104) — the number of theorems lecturer tells during the *i*-th minute. The third line of the input contains *n* integer numbers *t*1,<=*t*2,<=... *t**n* (0<=≤<=*t**i*<=≤<=1) — type of Mishka's behavior at the *i*-th minute of the lecture. Output Specification: Print only one integer — the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up. Demo Input: ['6 3\n1 3 5 2 5 4\n1 1 0 1 0 0\n'] Demo Output: ['16\n'] Note: In the sample case the better way is to use the secret technique at the beginning of the third minute. Then the number of theorems Mishka will be able to write down will be equal to 16.

```python n_k = input().split() n = int(n_k[0]) k = int(n_k[1]) aulas = input().split() estado = input().split() soma_aulas = [] soma_acordado = [] s_aulas = 0 s_acordado = 0 for i in range(n): s_aulas += int(aulas[i]) soma_aulas.append(s_aulas) if(estado[i] == "1"): s_acordado += int(aulas[i]) soma_acordado.append(s_acordado) saida = 0 for j in range(n-k+1): a = j+k-1 s1 = soma_aulas[a]-soma_aulas[j-1] s2 = soma_acordado[a]-soma_acordado[j-1] s = s1 - s2 if s > saida: saida = s print (soma_acordado[n-1] + saida) ```

0

279

B

Books

PROGRAMMING

1,400

[ "binary search", "brute force", "implementation", "two pointers" ]

null

When Valera has got some free time, he goes to the library to read some books. Today he's got *t* free minutes to read. That's why Valera took *n* books in the library and for each book he estimated the time he is going to need to read it. Let's number the books by integers from 1 to *n*. Valera needs *a**i* minutes to read the *i*-th book. Valera decided to choose an arbitrary book with number *i* and read the books one by one, starting from this book. In other words, he will first read book number *i*, then book number *i*<=+<=1, then book number *i*<=+<=2 and so on. He continues the process until he either runs out of the free time or finishes reading the *n*-th book. Valera reads each book up to the end, that is, he doesn't start reading the book if he doesn't have enough free time to finish reading it. Print the maximum number of books Valera can read.

The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=105; 1<=≤<=*t*<=≤<=109) — the number of books and the number of free minutes Valera's got. The second line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104), where number *a**i* shows the number of minutes that the boy needs to read the *i*-th book.

Print a single integer — the maximum number of books Valera can read.

[ "4 5\n3 1 2 1\n", "3 3\n2 2 3\n" ]

[ "3\n", "1\n" ]

none

1,000

[ { "input": "4 5\n3 1 2 1", "output": "3" }, { "input": "3 3\n2 2 3", "output": "1" }, { "input": "1 3\n5", "output": "0" }, { "input": "1 10\n4", "output": "1" }, { "input": "2 10\n6 4", "output": "2" }, { "input": "6 10\n2 3 4 2 1 1", "output": "4" }, { "input": "7 13\n6 8 14 9 4 11 10", "output": "2" }, { "input": "10 15\n10 9 1 1 5 10 5 3 7 2", "output": "3" }, { "input": "20 30\n8 1 2 6 9 4 1 9 9 10 4 7 8 9 5 7 1 8 7 4", "output": "6" }, { "input": "30 60\n16 13 22 38 13 35 17 17 20 38 12 19 9 22 20 3 35 34 34 21 35 40 22 3 27 19 12 4 8 19", "output": "4" }, { "input": "100 100\n75 92 18 6 81 67 7 92 100 65 82 32 50 67 85 31 80 91 84 63 39 52 92 81 1 98 24 12 43 48 17 86 51 72 48 95 45 50 12 66 19 79 49 89 34 1 97 75 20 33 96 27 42 23 73 71 93 1 85 19 66 14 17 61 20 39 36 33 42 61 56 64 23 91 80 99 40 74 13 18 98 85 74 39 62 84 46 74 50 23 38 11 79 14 9 25 66 100 25 52", "output": "3" }, { "input": "10 1\n4418 7528 8170 1736 1317 3205 8183 4995 8039 4708", "output": "0" }, { "input": "50 2\n124 214 63 73 996 760 38 571 451 300 970 1 706 937 837 494 619 88 851 411 957 990 842 613 821 649 627 34 693 678 734 116 816 985 705 940 499 493 922 967 854 439 112 644 961 438 189 572 655 550", "output": "1" } ]

1,690,456,967

2,147,483,647

Python 3

OK

TESTS

38

186

13,824,000

n,t=map(int,input().split()) l=list(map(int,input().split())) s=0 c=0 j=0 for i in range(n): s=s+l[i] if s<=t: c+=1 else: s=s-l[j] j+=1 #print(i,j,s) print(c)

Title: Books Time Limit: None seconds Memory Limit: None megabytes Problem Description: When Valera has got some free time, he goes to the library to read some books. Today he's got *t* free minutes to read. That's why Valera took *n* books in the library and for each book he estimated the time he is going to need to read it. Let's number the books by integers from 1 to *n*. Valera needs *a**i* minutes to read the *i*-th book. Valera decided to choose an arbitrary book with number *i* and read the books one by one, starting from this book. In other words, he will first read book number *i*, then book number *i*<=+<=1, then book number *i*<=+<=2 and so on. He continues the process until he either runs out of the free time or finishes reading the *n*-th book. Valera reads each book up to the end, that is, he doesn't start reading the book if he doesn't have enough free time to finish reading it. Print the maximum number of books Valera can read. Input Specification: The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=105; 1<=≤<=*t*<=≤<=109) — the number of books and the number of free minutes Valera's got. The second line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104), where number *a**i* shows the number of minutes that the boy needs to read the *i*-th book. Output Specification: Print a single integer — the maximum number of books Valera can read. Demo Input: ['4 5\n3 1 2 1\n', '3 3\n2 2 3\n'] Demo Output: ['3\n', '1\n'] Note: none

```python n,t=map(int,input().split()) l=list(map(int,input().split())) s=0 c=0 j=0 for i in range(n): s=s+l[i] if s<=t: c+=1 else: s=s-l[j] j+=1 #print(i,j,s) print(c) ```

3

699

A

Launch of Collider

PROGRAMMING

1,000

[ "implementation" ]

null

There will be a launch of a new, powerful and unusual collider very soon, which located along a straight line. *n* particles will be launched inside it. All of them are located in a straight line and there can not be two or more particles located in the same point. The coordinates of the particles coincide with the distance in meters from the center of the collider, *x**i* is the coordinate of the *i*-th particle and its position in the collider at the same time. All coordinates of particle positions are even integers. You know the direction of each particle movement — it will move to the right or to the left after the collider's launch start. All particles begin to move simultaneously at the time of the collider's launch start. Each particle will move straight to the left or straight to the right with the constant speed of 1 meter per microsecond. The collider is big enough so particles can not leave it in the foreseeable time. Write the program which finds the moment of the first collision of any two particles of the collider. In other words, find the number of microseconds before the first moment when any two particles are at the same point.

The first line contains the positive integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of particles. The second line contains *n* symbols "L" and "R". If the *i*-th symbol equals "L", then the *i*-th particle will move to the left, otherwise the *i*-th symbol equals "R" and the *i*-th particle will move to the right. The third line contains the sequence of pairwise distinct even integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=109) — the coordinates of particles in the order from the left to the right. It is guaranteed that the coordinates of particles are given in the increasing order.

In the first line print the only integer — the first moment (in microseconds) when two particles are at the same point and there will be an explosion. Print the only integer -1, if the collision of particles doesn't happen.

[ "4\nRLRL\n2 4 6 10\n", "3\nLLR\n40 50 60\n" ]

[ "1\n", "-1\n" ]

In the first sample case the first explosion will happen in 1 microsecond because the particles number 1 and 2 will simultaneously be at the same point with the coordinate 3. In the second sample case there will be no explosion because there are no particles which will simultaneously be at the same point.

500

[ { "input": "4\nRLRL\n2 4 6 10", "output": "1" }, { "input": "3\nLLR\n40 50 60", "output": "-1" }, { "input": "4\nRLLR\n46 230 264 470", "output": "92" }, { "input": "6\nLLRLLL\n446 492 650 844 930 970", "output": "97" }, { "input": "8\nRRLLLLLL\n338 478 512 574 594 622 834 922", "output": "17" }, { "input": "10\nLRLRLLRRLR\n82 268 430 598 604 658 670 788 838 1000", "output": "3" }, { "input": "2\nRL\n0 1000000000", "output": "500000000" }, { "input": "12\nLRLLRRRRLRLL\n254 1260 1476 1768 2924 4126 4150 4602 5578 7142 8134 9082", "output": "108" }, { "input": "14\nRLLRRLRLLRLLLR\n698 2900 3476 3724 3772 3948 4320 4798 5680 6578 7754 8034 8300 8418", "output": "88" }, { "input": "16\nRRLLLRLRLLLLRLLR\n222 306 968 1060 1636 1782 2314 2710 3728 4608 5088 6790 6910 7156 7418 7668", "output": "123" }, { "input": "18\nRLRLLRRRLLLRLRRLRL\n1692 2028 2966 3008 3632 4890 5124 5838 6596 6598 6890 8294 8314 8752 8868 9396 9616 9808", "output": "10" }, { "input": "20\nRLLLLLLLRRRRLRRLRRLR\n380 902 1400 1834 2180 2366 2562 2596 2702 2816 3222 3238 3742 5434 6480 7220 7410 8752 9708 9970", "output": "252" }, { "input": "22\nLRRRRRRRRRRRLLRRRRRLRL\n1790 2150 2178 2456 2736 3282 3622 4114 4490 4772 5204 5240 5720 5840 5910 5912 6586 7920 8584 9404 9734 9830", "output": "48" }, { "input": "24\nLLRLRRLLRLRRRRLLRRLRLRRL\n100 360 864 1078 1360 1384 1438 2320 2618 3074 3874 3916 3964 5178 5578 6278 6630 6992 8648 8738 8922 8930 9276 9720", "output": "27" }, { "input": "26\nRLLLLLLLRLRRLRLRLRLRLLLRRR\n908 1826 2472 2474 2728 3654 3716 3718 3810 3928 4058 4418 4700 5024 5768 6006 6128 6386 6968 7040 7452 7774 7822 8726 9338 9402", "output": "59" }, { "input": "28\nRRLRLRRRRRRLLLRRLRRLLLRRLLLR\n156 172 1120 1362 2512 3326 3718 4804 4990 5810 6242 6756 6812 6890 6974 7014 7088 7724 8136 8596 8770 8840 9244 9250 9270 9372 9400 9626", "output": "10" }, { "input": "30\nRLLRLRLLRRRLRRRLLLLLLRRRLRRLRL\n128 610 1680 2436 2896 2994 3008 3358 3392 4020 4298 4582 4712 4728 5136 5900 6088 6232 6282 6858 6934 7186 7224 7256 7614 8802 8872 9170 9384 9794", "output": "7" }, { "input": "10\nLLLLRRRRRR\n0 2 4 6 8 10 12 14 16 18", "output": "-1" }, { "input": "5\nLLLLL\n0 10 20 30 40", "output": "-1" }, { "input": "6\nRRRRRR\n40 50 60 70 80 100", "output": "-1" }, { "input": "1\nR\n0", "output": "-1" }, { "input": "2\nRL\n2 1000000000", "output": "499999999" }, { "input": "2\nRL\n0 400000", "output": "200000" }, { "input": "2\nRL\n0 200002", "output": "100001" }, { "input": "2\nRL\n2 20000000", "output": "9999999" }, { "input": "4\nLLRL\n2 4 10 100", "output": "45" }, { "input": "4\nRLRL\n2 10 12 14", "output": "1" }, { "input": "2\nRL\n0 100000000", "output": "50000000" }, { "input": "2\nRL\n2 600002", "output": "300000" }, { "input": "1\nL\n0", "output": "-1" }, { "input": "2\nRL\n0 600000", "output": "300000" }, { "input": "5\nRRRRR\n0 2 4 6 8", "output": "-1" }, { "input": "2\nRL\n2 200000000", "output": "99999999" }, { "input": "2\nRL\n0 267382766", "output": "133691383" }, { "input": "3\nRRL\n4 8 999999998", "output": "499999995" }, { "input": "2\nRL\n0 2", "output": "1" }, { "input": "2\nRL\n2 400002", "output": "200000" }, { "input": "2\nLL\n2 4", "output": "-1" }, { "input": "2\nLL\n0 2", "output": "-1" }, { "input": "2\nRL\n0 100000", "output": "50000" }, { "input": "2\nRL\n2 200000020", "output": "100000009" }, { "input": "2\nRL\n2000000 4000000", "output": "1000000" }, { "input": "2\nRL\n0 199998", "output": "99999" }, { "input": "3\nLRR\n40 50 60", "output": "-1" }, { "input": "2\nRL\n200 400400", "output": "200100" }, { "input": "2\nRL\n2 400004", "output": "200001" }, { "input": "2\nRL\n0 200000000", "output": "100000000" } ]

1,469,127,441

2,147,483,647

Python 3

COMPILATION_ERROR

TESTS

0

#include <cstdlib> #include <cstdio> #include <cstring> #include <cmath> #include <list> #include <iostream> #include <string> #include <vector> #include <deque> #include <queue> #include <ctime> #include <stack> #include <map> #include <set> #include <algorithm> using namespace std; #define REP(i,n) for(int i=0; i<n; i++) #define FORR(i,a,b) for (int i=a; i<=b; i++) #define FORD(i,a,b) for (int i=a; i>=b; i--) #define mset(a,b) memset(a,b,sizeof(a)) #define sz(a) int( a.size() ) #define all(A) A.begin(),A.end() #define mp(a,b) make_pair(a,b) #define pb(a) push_back(a) #define X first #define Y second typedef long long i64; typedef vector<int> VI; typedef vector< VI > VVI; typedef pair<int,int> PII; typedef vector<string> VS; int main(){ #ifdef LocalHost freopen("input.txt","r", stdin); #endif int n; char s[2020000]; scanf("%d\n", &n); gets(s); int ans = -1; int pr, cur; scanf("%d", &pr); REP(i, n-1) { scanf("%d", &cur); if (s[i]=='R' && s[i+1]=='L') { int d = (cur - pr) /2; if (ans == -1) { ans = d; } if (ans > d) { ans = d; } } pr = cur; } printf("%d\n", ans); return 0; }

Title: Launch of Collider Time Limit: None seconds Memory Limit: None megabytes Problem Description: There will be a launch of a new, powerful and unusual collider very soon, which located along a straight line. *n* particles will be launched inside it. All of them are located in a straight line and there can not be two or more particles located in the same point. The coordinates of the particles coincide with the distance in meters from the center of the collider, *x**i* is the coordinate of the *i*-th particle and its position in the collider at the same time. All coordinates of particle positions are even integers. You know the direction of each particle movement — it will move to the right or to the left after the collider's launch start. All particles begin to move simultaneously at the time of the collider's launch start. Each particle will move straight to the left or straight to the right with the constant speed of 1 meter per microsecond. The collider is big enough so particles can not leave it in the foreseeable time. Write the program which finds the moment of the first collision of any two particles of the collider. In other words, find the number of microseconds before the first moment when any two particles are at the same point. Input Specification: The first line contains the positive integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of particles. The second line contains *n* symbols "L" and "R". If the *i*-th symbol equals "L", then the *i*-th particle will move to the left, otherwise the *i*-th symbol equals "R" and the *i*-th particle will move to the right. The third line contains the sequence of pairwise distinct even integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=109) — the coordinates of particles in the order from the left to the right. It is guaranteed that the coordinates of particles are given in the increasing order. Output Specification: In the first line print the only integer — the first moment (in microseconds) when two particles are at the same point and there will be an explosion. Print the only integer -1, if the collision of particles doesn't happen. Demo Input: ['4\nRLRL\n2 4 6 10\n', '3\nLLR\n40 50 60\n'] Demo Output: ['1\n', '-1\n'] Note: In the first sample case the first explosion will happen in 1 microsecond because the particles number 1 and 2 will simultaneously be at the same point with the coordinate 3. In the second sample case there will be no explosion because there are no particles which will simultaneously be at the same point.

```python #include <cstdlib> #include <cstdio> #include <cstring> #include <cmath> #include <list> #include <iostream> #include <string> #include <vector> #include <deque> #include <queue> #include <ctime> #include <stack> #include <map> #include <set> #include <algorithm> using namespace std; #define REP(i,n) for(int i=0; i<n; i++) #define FORR(i,a,b) for (int i=a; i<=b; i++) #define FORD(i,a,b) for (int i=a; i>=b; i--) #define mset(a,b) memset(a,b,sizeof(a)) #define sz(a) int( a.size() ) #define all(A) A.begin(),A.end() #define mp(a,b) make_pair(a,b) #define pb(a) push_back(a) #define X first #define Y second typedef long long i64; typedef vector<int> VI; typedef vector< VI > VVI; typedef pair<int,int> PII; typedef vector<string> VS; int main(){ #ifdef LocalHost freopen("input.txt","r", stdin); #endif int n; char s[2020000]; scanf("%d\n", &n); gets(s); int ans = -1; int pr, cur; scanf("%d", &pr); REP(i, n-1) { scanf("%d", &cur); if (s[i]=='R' && s[i+1]=='L') { int d = (cur - pr) /2; if (ans == -1) { ans = d; } if (ans > d) { ans = d; } } pr = cur; } printf("%d\n", ans); return 0; } ```

-1

431

A

Black Square

PROGRAMMING

800

[ "implementation" ]

null

Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone. In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip. You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares?

The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=≤<=*a*1,<=*a*2,<=*a*3,<=*a*4<=≤<=104). The second line contains string *s* (1<=≤<=|*s*|<=≤<=105), where the *і*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip.

Print a single integer — the total number of calories that Jury wastes.

[ "1 2 3 4\n123214\n", "1 5 3 2\n11221\n" ]

[ "13\n", "13\n" ]

none

500

[ { "input": "1 2 3 4\n123214", "output": "13" }, { "input": "1 5 3 2\n11221", "output": "13" }, { "input": "5 5 5 1\n3422", "output": "16" }, { "input": "4 3 2 1\n2", "output": "3" }, { "input": "5651 6882 6954 4733\n2442313421", "output": "60055" }, { "input": "0 0 0 0\n4132", "output": "0" }, { "input": "3163 5778 83 7640\n11141442444", "output": "64270" }, { "input": "1809 1302 7164 6122\n3144121413113111223311232232114144321414421243443243422322144324121433444342231344234443332241322442", "output": "420780" }, { "input": "0 0 0 0\n1", "output": "0" }, { "input": "1 2 3 4\n4", "output": "4" }, { "input": "2343 7653 1242 5432\n1", "output": "2343" }, { "input": "2343 7653 1242 5432\n2", "output": "7653" }, { "input": "2343 7653 1242 5432\n3", "output": "1242" }, { "input": "2343 7653 1242 5432\n4", "output": "5432" }, { "input": "1 2 3 4\n123412", "output": "13" }, { "input": "50 50 50 50\n11111111111111111111111111111111111111111111111111111", "output": "2650" }, { "input": "1 2 3 4\n11111111111111111111111111111111111111111111111111", "output": "50" }, { "input": "1 2 3 4\n23123231321231231231231231221232123121312321", "output": "87" }, { "input": "1 2 3 4\n1111111111111222222222233333333333444444444444444", "output": "126" }, { "input": "2 3 1 4\n121321232412342112312313213123123412131231231232", "output": "105" } ]

1,682,273,454

2,147,483,647

PyPy 3-64

WRONG_ANSWER

TESTS

0

46

0

a, b, c, d = map(int, input().split()) l = list(input()) ans = 0 print(l) for elem in l: if elem == '1': ans += a if elem == '2': ans += b if elem == '3': ans += c if elem == '4': ans += d print(ans)

Title: Black Square Time Limit: None seconds Memory Limit: None megabytes Problem Description: Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone. In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip. You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares? Input Specification: The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=≤<=*a*1,<=*a*2,<=*a*3,<=*a*4<=≤<=104). The second line contains string *s* (1<=≤<=|*s*|<=≤<=105), where the *і*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip. Output Specification: Print a single integer — the total number of calories that Jury wastes. Demo Input: ['1 2 3 4\n123214\n', '1 5 3 2\n11221\n'] Demo Output: ['13\n', '13\n'] Note: none

```python a, b, c, d = map(int, input().split()) l = list(input()) ans = 0 print(l) for elem in l: if elem == '1': ans += a if elem == '2': ans += b if elem == '3': ans += c if elem == '4': ans += d print(ans) ```

0

994

A

Fingerprints

PROGRAMMING

800

[ "implementation" ]

null

You are locked in a room with a door that has a keypad with 10 keys corresponding to digits from 0 to 9. To escape from the room, you need to enter a correct code. You also have a sequence of digits. Some keys on the keypad have fingerprints. You believe the correct code is the longest not necessarily contiguous subsequence of the sequence you have that only contains digits with fingerprints on the corresponding keys. Find such code.

The first line contains two integers $n$ and $m$ ($1 \le n, m \le 10$) representing the number of digits in the sequence you have and the number of keys on the keypad that have fingerprints. The next line contains $n$ distinct space-separated integers $x_1, x_2, \ldots, x_n$ ($0 \le x_i \le 9$) representing the sequence. The next line contains $m$ distinct space-separated integers $y_1, y_2, \ldots, y_m$ ($0 \le y_i \le 9$) — the keys with fingerprints.

In a single line print a space-separated sequence of integers representing the code. If the resulting sequence is empty, both printing nothing and printing a single line break is acceptable.

[ "7 3\n3 5 7 1 6 2 8\n1 2 7\n", "4 4\n3 4 1 0\n0 1 7 9\n" ]

[ "7 1 2\n", "1 0\n" ]

In the first example, the only digits with fingerprints are $1$, $2$ and $7$. All three of them appear in the sequence you know, $7$ first, then $1$ and then $2$. Therefore the output is 7 1 2. Note that the order is important, and shall be the same as the order in the original sequence. In the second example digits $0$, $1$, $7$ and $9$ have fingerprints, however only $0$ and $1$ appear in the original sequence. $1$ appears earlier, so the output is 1 0. Again, the order is important.

500

[ { "input": "7 3\n3 5 7 1 6 2 8\n1 2 7", "output": "7 1 2" }, { "input": "4 4\n3 4 1 0\n0 1 7 9", "output": "1 0" }, { "input": "9 4\n9 8 7 6 5 4 3 2 1\n2 4 6 8", "output": "8 6 4 2" }, { "input": "10 5\n3 7 1 2 4 6 9 0 5 8\n4 3 0 7 9", "output": "3 7 4 9 0" }, { "input": "10 10\n1 2 3 4 5 6 7 8 9 0\n4 5 6 7 1 2 3 0 9 8", "output": "1 2 3 4 5 6 7 8 9 0" }, { "input": "1 1\n4\n4", "output": "4" }, { "input": "3 7\n6 3 4\n4 9 0 1 7 8 6", "output": "6 4" }, { "input": "10 1\n9 0 8 1 7 4 6 5 2 3\n0", "output": "0" }, { "input": "5 10\n6 0 3 8 1\n3 1 0 5 4 7 2 8 9 6", "output": "6 0 3 8 1" }, { "input": "8 2\n7 2 9 6 1 0 3 4\n6 3", "output": "6 3" }, { "input": "5 4\n7 0 1 4 9\n0 9 5 3", "output": "0 9" }, { "input": "10 1\n9 6 2 0 1 8 3 4 7 5\n6", "output": "6" }, { "input": "10 2\n7 1 0 2 4 6 5 9 3 8\n3 2", "output": "2 3" }, { "input": "5 9\n3 7 9 2 4\n3 8 4 5 9 6 1 0 2", "output": "3 9 2 4" }, { "input": "10 6\n7 1 2 3 8 0 6 4 5 9\n1 5 8 2 3 6", "output": "1 2 3 8 6 5" }, { "input": "8 2\n7 4 8 9 2 5 6 1\n6 4", "output": "4 6" }, { "input": "10 2\n1 0 3 5 8 9 4 7 6 2\n0 3", "output": "0 3" }, { "input": "7 6\n9 2 8 6 1 3 7\n4 2 0 3 1 8", "output": "2 8 1 3" }, { "input": "1 6\n3\n6 8 2 4 5 3", "output": "3" }, { "input": "1 8\n0\n9 2 4 8 1 5 0 7", "output": "0" }, { "input": "6 9\n7 3 9 4 1 0\n9 1 5 8 0 6 2 7 4", "output": "7 9 4 1 0" }, { "input": "10 2\n4 9 6 8 3 0 1 5 7 2\n0 1", "output": "0 1" }, { "input": "10 5\n5 2 8 0 9 7 6 1 4 3\n9 6 4 1 2", "output": "2 9 6 1 4" }, { "input": "6 3\n8 3 9 2 7 6\n5 4 3", "output": "3" }, { "input": "4 10\n8 3 9 6\n4 9 6 2 7 0 8 1 3 5", "output": "8 3 9 6" }, { "input": "1 2\n1\n1 0", "output": "1" }, { "input": "3 6\n1 2 3\n4 5 6 1 2 3", "output": "1 2 3" }, { "input": "1 2\n2\n1 2", "output": "2" }, { "input": "1 10\n9\n0 1 2 3 4 5 6 7 8 9", "output": "9" } ]

1,575,229,790

2,147,483,647

Python 3

OK

TESTS

31

124

0

def solution994a(): _ = input() sequence = map(int, input().split()) codes = list(map(int, input().split())) for s in sequence: if s in codes: print(s, end=" ") if __name__ == '__main__': solution994a()

Title: Fingerprints Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are locked in a room with a door that has a keypad with 10 keys corresponding to digits from 0 to 9. To escape from the room, you need to enter a correct code. You also have a sequence of digits. Some keys on the keypad have fingerprints. You believe the correct code is the longest not necessarily contiguous subsequence of the sequence you have that only contains digits with fingerprints on the corresponding keys. Find such code. Input Specification: The first line contains two integers $n$ and $m$ ($1 \le n, m \le 10$) representing the number of digits in the sequence you have and the number of keys on the keypad that have fingerprints. The next line contains $n$ distinct space-separated integers $x_1, x_2, \ldots, x_n$ ($0 \le x_i \le 9$) representing the sequence. The next line contains $m$ distinct space-separated integers $y_1, y_2, \ldots, y_m$ ($0 \le y_i \le 9$) — the keys with fingerprints. Output Specification: In a single line print a space-separated sequence of integers representing the code. If the resulting sequence is empty, both printing nothing and printing a single line break is acceptable. Demo Input: ['7 3\n3 5 7 1 6 2 8\n1 2 7\n', '4 4\n3 4 1 0\n0 1 7 9\n'] Demo Output: ['7 1 2\n', '1 0\n'] Note: In the first example, the only digits with fingerprints are $1$, $2$ and $7$. All three of them appear in the sequence you know, $7$ first, then $1$ and then $2$. Therefore the output is 7 1 2. Note that the order is important, and shall be the same as the order in the original sequence. In the second example digits $0$, $1$, $7$ and $9$ have fingerprints, however only $0$ and $1$ appear in the original sequence. $1$ appears earlier, so the output is 1 0. Again, the order is important.

```python def solution994a(): _ = input() sequence = map(int, input().split()) codes = list(map(int, input().split())) for s in sequence: if s in codes: print(s, end=" ") if __name__ == '__main__': solution994a() ```

3

863

A

Quasi-palindrome

PROGRAMMING

900

[ "brute force", "implementation" ]

null

Let quasi-palindromic number be such number that adding some leading zeros (possible none) to it produces a palindromic string. String *t* is called a palindrome, if it reads the same from left to right and from right to left. For example, numbers 131 and 2010200 are quasi-palindromic, they can be transformed to strings "131" and "002010200", respectively, which are palindromes. You are given some integer number *x*. Check if it's a quasi-palindromic number.

The first line contains one integer number *x* (1<=≤<=*x*<=≤<=109). This number is given without any leading zeroes.

Print "YES" if number *x* is quasi-palindromic. Otherwise, print "NO" (without quotes).

[ "131\n", "320\n", "2010200\n" ]

[ "YES\n", "NO\n", "YES\n" ]

none

0

[ { "input": "131", "output": "YES" }, { "input": "320", "output": "NO" }, { "input": "2010200", "output": "YES" }, { "input": "1", "output": "YES" }, { "input": "1000000000", "output": "YES" }, { "input": "999999999", "output": "YES" }, { "input": "999999998", "output": "NO" }, { "input": "102000", "output": "NO" }, { "input": "210000000", "output": "NO" }, { "input": "213443120", "output": "YES" }, { "input": "99", "output": "YES" }, { "input": "22002", "output": "NO" }, { "input": "1010", "output": "YES" }, { "input": "1201", "output": "NO" }, { "input": "6460046", "output": "NO" }, { "input": "503435", "output": "NO" }, { "input": "21002", "output": "NO" }, { "input": "101001", "output": "NO" }, { "input": "200102", "output": "NO" }, { "input": "20010002", "output": "NO" }, { "input": "33003", "output": "NO" }, { "input": "100101", "output": "NO" }, { "input": "1021", "output": "NO" }, { "input": "1101", "output": "NO" }, { "input": "10101100", "output": "NO" }, { "input": "101", "output": "YES" }, { "input": "1011", "output": "NO" }, { "input": "11010", "output": "NO" }, { "input": "10110", "output": "NO" }, { "input": "110000", "output": "YES" }, { "input": "2011", "output": "NO" }, { "input": "10020001", "output": "NO" }, { "input": "12505021", "output": "NO" }, { "input": "12310", "output": "NO" }, { "input": "100501", "output": "NO" }, { "input": "11001", "output": "NO" }, { "input": "20020002", "output": "NO" }, { "input": "202002", "output": "NO" }, { "input": "1001", "output": "YES" }, { "input": "1020021", "output": "NO" }, { "input": "60660", "output": "NO" }, { "input": "98809", "output": "NO" }, { "input": "11000000", "output": "YES" }, { "input": "807008", "output": "NO" } ]

1,565,494,993

2,147,483,647

Python 3

OK

TESTS

44

124

0

n = input().strip('0') if len(n)%2: print(['NO','YES'][n[:(len(n)//2)+1]==n[(len(n)//2):][::-1]]) else: print(['NO','YES'][n[:(len(n)//2)]==n[(len(n)//2):][::-1]])

Title: Quasi-palindrome Time Limit: None seconds Memory Limit: None megabytes Problem Description: Let quasi-palindromic number be such number that adding some leading zeros (possible none) to it produces a palindromic string. String *t* is called a palindrome, if it reads the same from left to right and from right to left. For example, numbers 131 and 2010200 are quasi-palindromic, they can be transformed to strings "131" and "002010200", respectively, which are palindromes. You are given some integer number *x*. Check if it's a quasi-palindromic number. Input Specification: The first line contains one integer number *x* (1<=≤<=*x*<=≤<=109). This number is given without any leading zeroes. Output Specification: Print "YES" if number *x* is quasi-palindromic. Otherwise, print "NO" (without quotes). Demo Input: ['131\n', '320\n', '2010200\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n'] Note: none

```python n = input().strip('0') if len(n)%2: print(['NO','YES'][n[:(len(n)//2)+1]==n[(len(n)//2):][::-1]]) else: print(['NO','YES'][n[:(len(n)//2)]==n[(len(n)//2):][::-1]]) ```

3

758

A

Holiday Of Equality

PROGRAMMING

800

[ "implementation", "math" ]

null

In Berland it is the holiday of equality. In honor of the holiday the king decided to equalize the welfare of all citizens in Berland by the expense of the state treasury. Totally in Berland there are *n* citizens, the welfare of each of them is estimated as the integer in *a**i* burles (burle is the currency in Berland). You are the royal treasurer, which needs to count the minimum charges of the kingdom on the king's present. The king can only give money, he hasn't a power to take away them.

The first line contains the integer *n* (1<=≤<=*n*<=≤<=100) — the number of citizens in the kingdom. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (0<=≤<=*a**i*<=≤<=106) — the welfare of the *i*-th citizen.

In the only line print the integer *S* — the minimum number of burles which are had to spend.

[ "5\n0 1 2 3 4\n", "5\n1 1 0 1 1\n", "3\n1 3 1\n", "1\n12\n" ]

[ "10", "1", "4", "0" ]

In the first example if we add to the first citizen 4 burles, to the second 3, to the third 2 and to the fourth 1, then the welfare of all citizens will equal 4. In the second example it is enough to give one burle to the third citizen. In the third example it is necessary to give two burles to the first and the third citizens to make the welfare of citizens equal 3. In the fourth example it is possible to give nothing to everyone because all citizens have 12 burles.

500

[ { "input": "5\n0 1 2 3 4", "output": "10" }, { "input": "5\n1 1 0 1 1", "output": "1" }, { "input": "3\n1 3 1", "output": "4" }, { "input": "1\n12", "output": "0" }, { "input": "3\n1 2 3", "output": "3" }, { "input": "14\n52518 718438 358883 462189 853171 592966 225788 46977 814826 295697 676256 561479 56545 764281", "output": "5464380" }, { "input": "21\n842556 216391 427181 626688 775504 168309 851038 448402 880826 73697 593338 519033 135115 20128 424606 939484 846242 756907 377058 241543 29353", "output": "9535765" }, { "input": "3\n1 3 2", "output": "3" }, { "input": "3\n2 1 3", "output": "3" }, { "input": "3\n2 3 1", "output": "3" }, { "input": "3\n3 1 2", "output": "3" }, { "input": "3\n3 2 1", "output": "3" }, { "input": "1\n228503", "output": "0" }, { "input": "2\n32576 550340", "output": "517764" }, { "input": "3\n910648 542843 537125", "output": "741328" }, { "input": "4\n751720 572344 569387 893618", "output": "787403" }, { "input": "6\n433864 631347 597596 794426 713555 231193", "output": "1364575" }, { "input": "9\n31078 645168 695751 126111 375934 150495 838412 434477 993107", "output": "4647430" }, { "input": "30\n315421 772664 560686 654312 151528 356749 351486 707462 820089 226682 546700 136028 824236 842130 578079 337807 665903 764100 617900 822937 992759 591749 651310 742085 767695 695442 17967 515106 81059 186025", "output": "13488674" }, { "input": "45\n908719 394261 815134 419990 926993 383792 772842 277695 527137 655356 684956 695716 273062 550324 106247 399133 442382 33076 462920 294674 846052 817752 421365 474141 290471 358990 109812 74492 543281 169434 919692 786809 24028 197184 310029 801476 699355 429672 51343 374128 776726 850380 293868 981569 550763", "output": "21993384" }, { "input": "56\n100728 972537 13846 385421 756708 184642 259487 319707 376662 221694 675284 972837 499419 13846 38267 289898 901299 831197 954715 197515 514102 910423 127555 883934 362472 870788 538802 741008 973434 448124 391526 363321 947321 544618 68006 782313 955075 741981 815027 723297 585059 718114 700739 413489 454091 736144 308999 98065 3716 347323 9635 289003 986510 607065 60236 273351", "output": "26984185" }, { "input": "70\n644488 5444 150441 714420 602059 335330 510670 196555 546346 740011 509449 850947 692874 524857 750434 952985 223744 374727 896124 753037 367352 679050 560202 172728 569291 778616 332116 286927 843598 372698 244906 498046 900681 709791 420904 724593 864493 813094 791377 39998 296710 625656 403891 579231 706693 984045 16901 574259 562265 761104 930361 256045 124461 538980 573508 372148 988722 108592 784354 55302 232524 277205 782251 299943 436488 743389 324618 742543 266915 99642", "output": "32816391" }, { "input": "1\n0", "output": "0" }, { "input": "1\n1000000", "output": "0" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "100\n1000000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "99000000" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1000000", "output": "99000000" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1000000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "99000000" }, { "input": "3\n0 0 0", "output": "0" }, { "input": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "3\n5 0 0", "output": "10" }, { "input": "5\n2 10 0 0 0", "output": "38" } ]

1,693,637,457

2,147,483,647

Python 3

OK

TESTS

41

46

0

n=int(input()) s=list(map(int,input().split())) sum=0 for i in range(n): sum+=(max(s)-s[i]) print(sum)

Title: Holiday Of Equality Time Limit: None seconds Memory Limit: None megabytes Problem Description: In Berland it is the holiday of equality. In honor of the holiday the king decided to equalize the welfare of all citizens in Berland by the expense of the state treasury. Totally in Berland there are *n* citizens, the welfare of each of them is estimated as the integer in *a**i* burles (burle is the currency in Berland). You are the royal treasurer, which needs to count the minimum charges of the kingdom on the king's present. The king can only give money, he hasn't a power to take away them. Input Specification: The first line contains the integer *n* (1<=≤<=*n*<=≤<=100) — the number of citizens in the kingdom. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (0<=≤<=*a**i*<=≤<=106) — the welfare of the *i*-th citizen. Output Specification: In the only line print the integer *S* — the minimum number of burles which are had to spend. Demo Input: ['5\n0 1 2 3 4\n', '5\n1 1 0 1 1\n', '3\n1 3 1\n', '1\n12\n'] Demo Output: ['10', '1', '4', '0'] Note: In the first example if we add to the first citizen 4 burles, to the second 3, to the third 2 and to the fourth 1, then the welfare of all citizens will equal 4. In the second example it is enough to give one burle to the third citizen. In the third example it is necessary to give two burles to the first and the third citizens to make the welfare of citizens equal 3. In the fourth example it is possible to give nothing to everyone because all citizens have 12 burles.

```python n=int(input()) s=list(map(int,input().split())) sum=0 for i in range(n): sum+=(max(s)-s[i]) print(sum) ```

3

546

A

Soldier and Bananas

PROGRAMMING

800

[ "brute force", "implementation", "math" ]

null

A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*·*k* dollars for the *i*-th banana). He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas?

The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=≤<=<=*k*,<=*w*<=<=≤<=<=1000, 0<=≤<=*n*<=≤<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants.

Output one integer — the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0.

[ "3 17 4\n" ]

[ "13" ]

none

500

[ { "input": "3 17 4", "output": "13" }, { "input": "1 2 1", "output": "0" }, { "input": "1 1 1", "output": "0" }, { "input": "1 5 6", "output": "16" }, { "input": "1 1000000000 1", "output": "0" }, { "input": "1000 0 1000", "output": "500500000" }, { "input": "859 453892 543", "output": "126416972" }, { "input": "1000 1000000000 1000", "output": "0" }, { "input": "1000 500500000 1000", "output": "0" }, { "input": "1000 500500001 1000", "output": "0" }, { "input": "1000 500499999 1000", "output": "1" }, { "input": "634 87973 214", "output": "14497197" }, { "input": "432 10000 241", "output": "12587552" }, { "input": "111 111111111 111", "output": "0" }, { "input": "20 43 3", "output": "77" } ]

1,695,267,618

2,147,483,647

Python 3

RUNTIME_ERROR

TESTS

0

15

0

k,n,w = (int, input().split()) print(w * k)

Title: Soldier and Bananas Time Limit: None seconds Memory Limit: None megabytes Problem Description: A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*·*k* dollars for the *i*-th banana). He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas? Input Specification: The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=≤<=<=*k*,<=*w*<=<=≤<=<=1000, 0<=≤<=*n*<=≤<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants. Output Specification: Output one integer — the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0. Demo Input: ['3 17 4\n'] Demo Output: ['13'] Note: none

```python k,n,w = (int, input().split()) print(w * k) ```

-1

954

A

Diagonal Walking

PROGRAMMING

800

[ "implementation" ]

null

Mikhail walks on a 2D plane. He can go either up or right. You are given a sequence of Mikhail's moves. He thinks that this sequence is too long and he wants to make it as short as possible. In the given sequence moving up is described by character U and moving right is described by character R. Mikhail can replace any pair of consecutive moves RU or UR with a diagonal move (described as character D). After that, he can go on and do some other replacements, until there is no pair of consecutive moves RU or UR left. Your problem is to print the minimum possible length of the sequence of moves after the replacements.

The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=100) — the length of the sequence. The second line contains the sequence consisting of *n* characters U and R.

Print the minimum possible length of the sequence of moves after all replacements are done.

[ "5\nRUURU\n", "17\nUUURRRRRUUURURUUU\n" ]

[ "3\n", "13\n" ]

In the first test the shortened sequence of moves may be DUD (its length is 3). In the second test the shortened sequence of moves can be UUDRRRDUDDUUU (its length is 13).

0

[ { "input": "5\nRUURU", "output": "3" }, { "input": "17\nUUURRRRRUUURURUUU", "output": "13" }, { "input": "100\nUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU", "output": "100" }, { "input": "100\nRRURRUUUURURRRURRRRURRRRRRURRUURRRUUURUURURRURUURUURRUURUURRURURUUUUURUUUUUURRUUURRRURRURRRUURRUUUUR", "output": "67" }, { "input": "100\nUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUURUUUUUUUUUUUUUUUUUUUUU", "output": "99" }, { "input": "3\nRUR", "output": "2" }, { "input": "1\nR", "output": "1" }, { "input": "5\nRURUU", "output": "3" }, { "input": "1\nU", "output": "1" }, { "input": "2\nUR", "output": "1" }, { "input": "23\nUUUUUUUUUUUUUUUUUUUUUUU", "output": "23" } ]

1,637,849,081

2,147,483,647

Python 3

WRONG_ANSWER

TESTS

3

46

0

n=int(input()) t=input() n=len(t) m=t.count("UR") o=t.count("RU") u=t.count("URU") r=t.count("RUR") print((n+r+u)-(m+o))

Title: Diagonal Walking Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mikhail walks on a 2D plane. He can go either up or right. You are given a sequence of Mikhail's moves. He thinks that this sequence is too long and he wants to make it as short as possible. In the given sequence moving up is described by character U and moving right is described by character R. Mikhail can replace any pair of consecutive moves RU or UR with a diagonal move (described as character D). After that, he can go on and do some other replacements, until there is no pair of consecutive moves RU or UR left. Your problem is to print the minimum possible length of the sequence of moves after the replacements. Input Specification: The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=100) — the length of the sequence. The second line contains the sequence consisting of *n* characters U and R. Output Specification: Print the minimum possible length of the sequence of moves after all replacements are done. Demo Input: ['5\nRUURU\n', '17\nUUURRRRRUUURURUUU\n'] Demo Output: ['3\n', '13\n'] Note: In the first test the shortened sequence of moves may be DUD (its length is 3). In the second test the shortened sequence of moves can be UUDRRRDUDDUUU (its length is 13).

```python n=int(input()) t=input() n=len(t) m=t.count("UR") o=t.count("RU") u=t.count("URU") r=t.count("RUR") print((n+r+u)-(m+o)) ```

0

346

A

Alice and Bob

PROGRAMMING

1,600

[ "games", "math", "number theory" ]

null

It is so boring in the summer holiday, isn't it? So Alice and Bob have invented a new game to play. The rules are as follows. First, they get a set of *n* distinct integers. And then they take turns to make the following moves. During each move, either Alice or Bob (the player whose turn is the current) can choose two distinct integers *x* and *y* from the set, such that the set doesn't contain their absolute difference |*x*<=-<=*y*|. Then this player adds integer |*x*<=-<=*y*| to the set (so, the size of the set increases by one). If the current player has no valid move, he (or she) loses the game. The question is who will finally win the game if both players play optimally. Remember that Alice always moves first.

The first line contains an integer *n* (2<=≤<=*n*<=≤<=100) — the initial number of elements in the set. The second line contains *n* distinct space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the set.

Print a single line with the winner's name. If Alice wins print "Alice", otherwise print "Bob" (without quotes).

[ "2\n2 3\n", "2\n5 3\n", "3\n5 6 7\n" ]

[ "Alice\n", "Alice\n", "Bob\n" ]

Consider the first test sample. Alice moves first, and the only move she can do is to choose 2 and 3, then to add 1 to the set. Next Bob moves, there is no valid move anymore, so the winner is Alice.

500

[ { "input": "2\n2 3", "output": "Alice" }, { "input": "2\n5 3", "output": "Alice" }, { "input": "3\n5 6 7", "output": "Bob" }, { "input": "10\n72 96 24 66 6 18 12 30 60 48", "output": "Bob" }, { "input": "10\n78 66 6 60 18 84 36 96 72 48", "output": "Bob" }, { "input": "10\n98 63 42 56 14 77 70 35 84 21", "output": "Bob" }, { "input": "2\n1 1000000000", "output": "Bob" }, { "input": "2\n1000000000 999999999", "output": "Bob" }, { "input": "3\n2 4 6", "output": "Bob" }, { "input": "2\n4 6", "output": "Alice" }, { "input": "2\n2 6", "output": "Alice" }, { "input": "2\n6 2", "output": "Alice" }, { "input": "10\n100000000 200000000 300000000 400000000 500000000 600000000 700000000 800000000 900000000 1000000000", "output": "Bob" }, { "input": "2\n1 2", "output": "Bob" }, { "input": "10\n1 999999999 999999998 999999997 999999996 999999995 999999994 999999993 999999992 999999991", "output": "Alice" }, { "input": "3\n6 14 21", "output": "Bob" }, { "input": "3\n4 12 18", "output": "Bob" }, { "input": "4\n2 3 15 30", "output": "Bob" }, { "input": "2\n10 4", "output": "Alice" } ]

1,635,652,882

2,147,483,647

Python 3

RUNTIME_ERROR

TESTS

0

62

4,505,600

_ = input() v = list(map(int, input().split())) size_init = len(v_sorted_cp) v_set = set(v) for elem1 in v: for elem2 in v: dif = abs(elem2-elem1) if(dif!=0 and not dif in v_set): v_set.add(dif) v.append(dif) size_final = len(v_set) if((size_final-size_init)%2==0): print("Bob") else: print("Alice")

Title: Alice and Bob Time Limit: None seconds Memory Limit: None megabytes Problem Description: It is so boring in the summer holiday, isn't it? So Alice and Bob have invented a new game to play. The rules are as follows. First, they get a set of *n* distinct integers. And then they take turns to make the following moves. During each move, either Alice or Bob (the player whose turn is the current) can choose two distinct integers *x* and *y* from the set, such that the set doesn't contain their absolute difference |*x*<=-<=*y*|. Then this player adds integer |*x*<=-<=*y*| to the set (so, the size of the set increases by one). If the current player has no valid move, he (or she) loses the game. The question is who will finally win the game if both players play optimally. Remember that Alice always moves first. Input Specification: The first line contains an integer *n* (2<=≤<=*n*<=≤<=100) — the initial number of elements in the set. The second line contains *n* distinct space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the set. Output Specification: Print a single line with the winner's name. If Alice wins print "Alice", otherwise print "Bob" (without quotes). Demo Input: ['2\n2 3\n', '2\n5 3\n', '3\n5 6 7\n'] Demo Output: ['Alice\n', 'Alice\n', 'Bob\n'] Note: Consider the first test sample. Alice moves first, and the only move she can do is to choose 2 and 3, then to add 1 to the set. Next Bob moves, there is no valid move anymore, so the winner is Alice.

```python _ = input() v = list(map(int, input().split())) size_init = len(v_sorted_cp) v_set = set(v) for elem1 in v: for elem2 in v: dif = abs(elem2-elem1) if(dif!=0 and not dif in v_set): v_set.add(dif) v.append(dif) size_final = len(v_set) if((size_final-size_init)%2==0): print("Bob") else: print("Alice") ```

-1

50

A

Domino piling

PROGRAMMING

800

[ "greedy", "math" ]

A. Domino piling

2

256

You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions.

In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).

Output one number — the maximal number of dominoes, which can be placed.

[ "2 4\n", "3 3\n" ]

[ "4\n", "4\n" ]

none

500

[ { "input": "2 4", "output": "4" }, { "input": "3 3", "output": "4" }, { "input": "1 5", "output": "2" }, { "input": "1 6", "output": "3" }, { "input": "1 15", "output": "7" }, { "input": "1 16", "output": "8" }, { "input": "2 5", "output": "5" }, { "input": "2 6", "output": "6" }, { "input": "2 7", "output": "7" }, { "input": "2 14", "output": "14" }, { "input": "2 15", "output": "15" }, { "input": "1 4", "output": "2" }, { "input": "2 16", "output": "16" }, { "input": "3 5", "output": "7" }, { "input": "3 6", "output": "9" }, { "input": "3 10", "output": "15" }, { "input": "3 14", "output": "21" }, { "input": "3 15", "output": "22" }, { "input": "3 16", "output": "24" }, { "input": "5 7", "output": "17" }, { "input": "16 16", "output": "128" }, { "input": "15 16", "output": "120" }, { "input": "2 3", "output": "3" }, { "input": "15 15", "output": "112" }, { "input": "14 16", "output": "112" }, { "input": "11 13", "output": "71" }, { "input": "5 16", "output": "40" }, { "input": "8 15", "output": "60" }, { "input": "2 2", "output": "2" }, { "input": "3 4", "output": "6" }, { "input": "4 4", "output": "8" }, { "input": "1 1", "output": "0" }, { "input": "1 2", "output": "1" }, { "input": "1 3", "output": "1" }, { "input": "14 15", "output": "105" } ]

1,663,146,049

2,147,483,647

PyPy 3-64

WRONG_ANSWER

TESTS

2

92

0

m,n=map(int,input().split()) c=max(m,n) b=max(m,n) if m*n>1: print(int(m*n/2) if m*n%2==0 else int((c//2)*b+(b//2))) else: print("0")

Title: Domino piling Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions. Input Specification: In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). Output Specification: Output one number — the maximal number of dominoes, which can be placed. Demo Input: ['2 4\n', '3 3\n'] Demo Output: ['4\n', '4\n'] Note: none

```python m,n=map(int,input().split()) c=max(m,n) b=max(m,n) if m*n>1: print(int(m*n/2) if m*n%2==0 else int((c//2)*b+(b//2))) else: print("0") ```

0

546

A

Soldier and Bananas

PROGRAMMING

800

[ "brute force", "implementation", "math" ]

null

A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*·*k* dollars for the *i*-th banana). He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas?

The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=≤<=<=*k*,<=*w*<=<=≤<=<=1000, 0<=≤<=*n*<=≤<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants.

Output one integer — the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0.

[ "3 17 4\n" ]

[ "13" ]

none

500

[ { "input": "3 17 4", "output": "13" }, { "input": "1 2 1", "output": "0" }, { "input": "1 1 1", "output": "0" }, { "input": "1 5 6", "output": "16" }, { "input": "1 1000000000 1", "output": "0" }, { "input": "1000 0 1000", "output": "500500000" }, { "input": "859 453892 543", "output": "126416972" }, { "input": "1000 1000000000 1000", "output": "0" }, { "input": "1000 500500000 1000", "output": "0" }, { "input": "1000 500500001 1000", "output": "0" }, { "input": "1000 500499999 1000", "output": "1" }, { "input": "634 87973 214", "output": "14497197" }, { "input": "432 10000 241", "output": "12587552" }, { "input": "111 111111111 111", "output": "0" }, { "input": "20 43 3", "output": "77" } ]

1,698,241,288

2,147,483,647

Python 3

WRONG_ANSWER

TESTS

1

30

0

number = input() scores = [] scores.append(int(number[0])) for x in range(len(number)-1): if number[x] != " " and number[x+1] != " ": scores.append(int(number[x]+number[x+1])) elif number[x] != " " and number[x+1] == " " and number[x-1] == " ": scores.append(int(number[x])) else: continue scores.append(int(number[len(number)-1])) k = int(scores[0]) #cost of first banana n = int(scores[1]) #number of dollares w = int(scores[2]) #number of bananas he want cost = 0 for x in range(w+1): cost += x*k print(cost-n)

Title: Soldier and Bananas Time Limit: None seconds Memory Limit: None megabytes Problem Description: A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*·*k* dollars for the *i*-th banana). He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas? Input Specification: The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=≤<=<=*k*,<=*w*<=<=≤<=<=1000, 0<=≤<=*n*<=≤<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants. Output Specification: Output one integer — the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0. Demo Input: ['3 17 4\n'] Demo Output: ['13'] Note: none

```python number = input() scores = [] scores.append(int(number[0])) for x in range(len(number)-1): if number[x] != " " and number[x+1] != " ": scores.append(int(number[x]+number[x+1])) elif number[x] != " " and number[x+1] == " " and number[x-1] == " ": scores.append(int(number[x])) else: continue scores.append(int(number[len(number)-1])) k = int(scores[0]) #cost of first banana n = int(scores[1]) #number of dollares w = int(scores[2]) #number of bananas he want cost = 0 for x in range(w+1): cost += x*k print(cost-n) ```

0

676

A

Nicholas and Permutation

PROGRAMMING

800

[ "constructive algorithms", "implementation" ]

null

Nicholas has an array *a* that contains *n* distinct integers from 1 to *n*. In other words, Nicholas has a permutation of size *n*. Nicholas want the minimum element (integer 1) and the maximum element (integer *n*) to be as far as possible from each other. He wants to perform exactly one swap in order to maximize the distance between the minimum and the maximum elements. The distance between two elements is considered to be equal to the absolute difference between their positions.

The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100) — the size of the permutation. The second line of the input contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*), where *a**i* is equal to the element at the *i*-th position.

Print a single integer — the maximum possible distance between the minimum and the maximum elements Nicholas can achieve by performing exactly one swap.

[ "5\n4 5 1 3 2\n", "7\n1 6 5 3 4 7 2\n", "6\n6 5 4 3 2 1\n" ]

[ "3\n", "6\n", "5\n" ]

In the first sample, one may obtain the optimal answer by swapping elements 1 and 2. In the second sample, the minimum and the maximum elements will be located in the opposite ends of the array if we swap 7 and 2. In the third sample, the distance between the minimum and the maximum elements is already maximum possible, so we just perform some unnecessary swap, for example, one can swap 5 and 2.

500

[ { "input": "5\n4 5 1 3 2", "output": "3" }, { "input": "7\n1 6 5 3 4 7 2", "output": "6" }, { "input": "6\n6 5 4 3 2 1", "output": "5" }, { "input": "2\n1 2", "output": "1" }, { "input": "2\n2 1", "output": "1" }, { "input": "3\n2 3 1", "output": "2" }, { "input": "4\n4 1 3 2", "output": "3" }, { "input": "5\n1 4 5 2 3", "output": "4" }, { "input": "6\n4 6 3 5 2 1", "output": "5" }, { "input": "7\n1 5 3 6 2 4 7", "output": "6" }, { "input": "100\n76 70 67 54 40 1 48 63 64 36 42 90 99 27 47 17 93 7 13 84 16 57 74 5 83 61 19 56 52 92 38 91 82 79 34 66 71 28 37 98 35 94 77 53 73 10 26 80 15 32 8 81 3 95 44 46 72 6 33 11 21 85 4 30 24 51 49 96 87 55 14 31 12 60 45 9 29 22 58 18 88 2 50 59 20 86 23 41 100 39 62 68 69 97 78 43 25 89 65 75", "output": "94" }, { "input": "8\n4 5 3 8 6 7 1 2", "output": "6" }, { "input": "9\n6 8 5 3 4 7 9 2 1", "output": "8" }, { "input": "10\n8 7 10 1 2 3 4 6 5 9", "output": "7" }, { "input": "11\n5 4 6 9 10 11 7 3 1 2 8", "output": "8" }, { "input": "12\n3 6 7 8 9 10 12 5 4 2 11 1", "output": "11" }, { "input": "13\n8 4 3 7 5 11 9 1 10 2 13 12 6", "output": "10" }, { "input": "14\n6 10 13 9 7 1 12 14 3 2 5 4 11 8", "output": "8" }, { "input": "15\n3 14 13 12 7 2 4 11 15 1 8 6 5 10 9", "output": "9" }, { "input": "16\n11 6 9 8 7 14 12 13 10 15 2 5 3 1 4 16", "output": "15" }, { "input": "17\n13 12 5 3 9 16 8 14 2 4 10 1 6 11 7 15 17", "output": "16" }, { "input": "18\n8 6 14 17 9 11 15 13 5 3 18 1 2 7 12 16 4 10", "output": "11" }, { "input": "19\n12 19 3 11 15 6 18 14 5 10 2 13 9 7 4 8 17 16 1", "output": "18" }, { "input": "20\n15 17 10 20 7 2 16 9 13 6 18 5 19 8 11 14 4 12 3 1", "output": "19" }, { "input": "21\n1 9 14 18 13 12 11 20 16 2 4 19 15 7 6 17 8 5 3 10 21", "output": "20" }, { "input": "22\n8 3 17 4 16 21 14 11 10 15 6 18 13 12 22 20 5 2 9 7 19 1", "output": "21" }, { "input": "23\n1 23 11 20 9 3 12 4 7 17 5 15 2 10 18 16 8 22 14 13 19 21 6", "output": "22" }, { "input": "24\n2 10 23 22 20 19 18 16 11 12 15 17 21 8 24 13 1 5 6 7 14 3 9 4", "output": "16" }, { "input": "25\n12 13 22 17 1 18 14 5 21 2 10 4 3 23 11 6 20 8 24 16 15 19 9 7 25", "output": "24" }, { "input": "26\n6 21 20 16 26 17 11 2 24 4 1 12 14 8 25 7 15 10 22 5 13 18 9 23 19 3", "output": "21" }, { "input": "27\n20 14 18 10 5 3 9 4 24 22 21 27 17 15 26 2 23 7 12 11 6 8 19 25 16 13 1", "output": "26" }, { "input": "28\n28 13 16 6 1 12 4 27 22 7 18 3 21 26 25 11 5 10 20 24 19 15 14 8 23 17 9 2", "output": "27" }, { "input": "29\n21 11 10 25 2 5 9 16 29 8 17 4 15 13 6 22 7 24 19 12 18 20 1 3 23 28 27 14 26", "output": "22" }, { "input": "30\n6 19 14 22 26 17 27 8 25 3 24 30 4 18 23 16 9 13 29 20 15 2 5 11 28 12 1 10 21 7", "output": "26" }, { "input": "31\n29 13 26 27 9 28 2 16 30 21 12 11 3 31 23 6 22 20 1 5 14 24 19 18 8 4 10 17 15 25 7", "output": "18" }, { "input": "32\n15 32 11 3 18 23 19 14 5 8 6 21 13 24 25 4 16 9 27 20 17 31 2 22 7 12 30 1 26 10 29 28", "output": "30" }, { "input": "33\n22 13 10 33 8 25 15 14 21 28 27 19 26 24 1 12 5 11 32 20 30 31 18 4 6 23 7 29 16 2 17 9 3", "output": "29" }, { "input": "34\n34 30 7 16 6 1 10 23 29 13 15 25 32 26 18 11 28 3 14 21 19 5 31 33 4 17 8 9 24 20 27 22 2 12", "output": "33" }, { "input": "35\n24 33 20 8 34 11 31 25 2 4 18 13 9 35 16 30 23 32 17 1 14 22 19 21 28 26 3 15 5 12 27 29 10 6 7", "output": "21" }, { "input": "36\n1 32 27 35 22 7 34 15 18 36 31 28 13 2 10 21 20 17 16 4 3 24 19 29 11 12 25 5 33 26 14 6 9 23 30 8", "output": "35" }, { "input": "37\n24 1 12 23 11 6 30 15 4 21 13 20 25 17 5 8 36 19 32 26 14 9 7 18 10 29 37 35 16 2 22 34 3 27 31 33 28", "output": "35" }, { "input": "38\n9 35 37 28 36 21 10 25 19 4 26 5 22 7 27 18 6 14 15 24 1 17 11 34 20 8 2 16 3 23 32 31 13 12 38 33 30 29", "output": "34" }, { "input": "39\n16 28 4 33 26 36 25 23 22 30 27 7 12 34 17 6 3 38 10 24 13 31 29 39 14 32 9 20 35 11 18 21 8 2 15 37 5 19 1", "output": "38" }, { "input": "40\n35 39 28 11 9 31 36 8 5 32 26 19 38 33 2 22 23 25 6 37 12 7 3 10 17 24 20 16 27 4 34 15 40 14 18 13 29 21 30 1", "output": "39" }, { "input": "41\n24 18 7 23 3 15 1 17 25 5 30 10 34 36 2 14 9 21 41 40 20 28 33 35 12 22 11 8 19 16 31 27 26 32 29 4 13 38 37 39 6", "output": "34" }, { "input": "42\n42 15 24 26 4 34 19 29 38 32 31 33 14 41 21 3 11 39 25 6 5 20 23 10 16 36 18 28 27 1 7 40 22 30 9 2 37 17 8 12 13 35", "output": "41" }, { "input": "43\n43 24 20 13 22 29 28 4 30 3 32 40 31 8 7 9 35 27 18 5 42 6 17 19 23 12 41 21 16 37 33 34 2 14 36 38 25 10 15 39 26 11 1", "output": "42" }, { "input": "44\n4 38 6 40 29 3 44 2 30 35 25 36 34 10 11 31 21 7 14 23 37 19 27 18 5 22 1 16 17 9 39 13 15 32 43 8 41 26 42 12 24 33 20 28", "output": "37" }, { "input": "45\n45 29 24 2 31 5 34 41 26 44 33 43 15 3 4 11 21 37 27 12 14 39 23 42 16 6 13 19 8 38 20 9 25 22 40 17 32 35 18 10 28 7 30 36 1", "output": "44" }, { "input": "46\n29 3 12 33 45 40 19 17 25 27 28 1 16 23 24 46 31 8 44 15 5 32 22 11 4 36 34 10 35 26 21 7 14 2 18 9 20 41 6 43 42 37 38 13 39 30", "output": "34" }, { "input": "47\n7 3 8 12 24 16 29 10 28 38 1 20 37 40 21 5 15 6 45 23 36 44 25 43 41 4 11 42 18 35 32 31 39 33 27 30 22 34 14 13 17 47 19 9 46 26 2", "output": "41" }, { "input": "48\n29 26 14 18 34 33 13 39 32 1 37 20 35 19 28 48 30 23 46 27 5 22 24 38 12 15 8 36 43 45 16 47 6 9 31 40 44 17 2 41 11 42 25 4 21 3 10 7", "output": "38" }, { "input": "49\n16 7 42 32 11 35 15 8 23 41 6 20 47 24 9 45 49 2 37 48 25 28 5 18 3 19 12 4 22 33 13 14 10 36 44 17 40 38 30 26 1 43 29 46 21 34 27 39 31", "output": "40" }, { "input": "50\n31 45 3 34 13 43 32 4 42 9 7 8 24 14 35 6 19 46 44 17 18 1 25 20 27 41 2 16 12 10 11 47 38 21 28 49 30 15 50 36 29 26 22 39 48 5 23 37 33 40", "output": "38" }, { "input": "51\n47 29 2 11 43 44 27 1 39 14 25 30 33 21 38 45 34 51 16 50 42 31 41 46 15 48 13 19 6 37 35 7 22 28 20 4 17 10 5 8 24 40 9 36 18 49 12 26 23 3 32", "output": "43" }, { "input": "52\n16 45 23 7 15 19 43 20 4 32 35 36 9 50 5 26 38 46 13 33 12 2 48 37 41 31 10 28 8 42 3 21 11 1 17 27 34 30 44 40 6 51 49 47 25 22 18 24 52 29 14 39", "output": "48" }, { "input": "53\n53 30 50 22 51 31 32 38 12 7 39 43 1 23 6 8 24 52 2 21 34 13 3 35 5 15 19 11 47 18 9 20 29 4 36 45 27 41 25 48 16 46 44 17 10 14 42 26 40 28 33 37 49", "output": "52" }, { "input": "54\n6 39 17 3 45 52 16 21 23 48 42 36 13 37 46 10 43 27 49 7 38 32 31 30 15 25 2 29 8 51 54 19 41 44 24 34 22 5 20 14 12 1 33 40 4 26 9 35 18 28 47 50 11 53", "output": "41" }, { "input": "55\n26 15 31 21 32 43 34 51 7 12 5 44 17 54 18 25 48 47 20 3 41 24 45 2 11 22 29 39 37 53 35 28 36 9 50 10 30 38 19 13 4 8 27 1 42 6 49 23 55 40 33 16 46 14 52", "output": "48" }, { "input": "56\n6 20 38 46 10 11 40 19 5 1 47 33 4 18 32 36 37 45 56 49 48 52 12 26 31 14 2 9 24 3 16 51 41 43 23 17 34 7 29 50 55 25 39 44 22 27 54 8 28 35 30 42 13 53 21 15", "output": "46" }, { "input": "57\n39 28 53 36 3 6 12 56 55 20 50 19 43 42 18 40 24 52 38 17 33 23 22 41 14 7 26 44 45 16 35 1 8 47 31 5 30 51 32 4 37 25 13 34 54 21 46 10 15 11 2 27 29 48 49 9 57", "output": "56" }, { "input": "58\n1 26 28 14 22 33 57 40 9 42 44 37 24 19 58 12 48 3 34 31 49 4 16 47 55 52 27 23 46 18 20 32 56 6 39 36 41 38 13 43 45 21 53 54 29 17 5 10 25 30 2 35 11 7 15 51 8 50", "output": "57" }, { "input": "59\n1 27 10 37 53 9 14 49 46 26 50 42 59 11 47 15 24 56 43 45 44 38 5 8 58 30 52 12 23 32 22 3 31 41 2 25 29 6 54 16 35 33 18 55 4 51 57 28 40 19 13 21 7 39 36 48 34 17 20", "output": "58" }, { "input": "60\n60 27 34 32 54 55 33 12 40 3 47 44 50 39 38 59 11 25 17 15 16 30 21 31 10 52 5 23 4 48 6 26 36 57 14 22 8 56 58 9 24 7 37 53 42 43 20 49 51 19 2 46 28 18 35 13 29 45 41 1", "output": "59" }, { "input": "61\n61 11 26 29 31 40 32 30 35 3 18 52 9 53 42 4 50 54 20 58 28 49 22 12 2 19 16 15 57 34 51 43 7 17 25 41 56 47 55 60 46 14 44 45 24 27 33 1 48 13 59 23 38 39 6 5 36 10 8 37 21", "output": "60" }, { "input": "62\n21 23 34 38 11 61 55 30 37 48 54 51 46 47 6 56 36 49 1 35 12 28 29 20 43 42 5 8 22 57 44 4 53 10 58 33 27 25 16 45 50 40 18 15 3 41 39 2 7 60 59 13 32 24 52 31 14 9 19 26 17 62", "output": "61" }, { "input": "63\n2 5 29 48 31 26 21 16 47 24 43 22 61 28 6 39 60 27 14 52 37 7 53 8 62 56 63 10 50 18 44 13 4 9 25 11 23 42 45 41 59 12 32 36 40 51 1 35 49 54 57 20 19 34 38 46 33 3 55 15 30 58 17", "output": "46" }, { "input": "64\n23 5 51 40 12 46 44 8 64 31 58 55 45 24 54 39 21 19 52 61 30 42 16 18 15 32 53 22 28 26 11 25 48 56 27 9 29 41 35 49 59 38 62 7 34 1 20 33 60 17 2 3 43 37 57 14 6 36 13 10 50 4 63 47", "output": "55" }, { "input": "65\n10 11 55 43 53 25 35 26 16 37 41 38 59 21 48 2 65 49 17 23 18 30 62 36 3 4 47 15 28 63 57 54 31 46 44 12 51 7 29 13 56 52 14 22 39 19 8 27 45 5 6 34 32 61 20 50 9 24 33 58 60 40 1 42 64", "output": "62" }, { "input": "66\n66 39 3 2 55 53 60 54 12 49 10 30 59 26 32 46 50 56 7 13 43 36 24 28 11 8 6 21 35 25 42 57 23 45 64 5 34 61 27 51 52 9 15 1 38 17 63 48 37 20 58 14 47 19 22 41 31 44 33 65 4 62 40 18 16 29", "output": "65" }, { "input": "67\n66 16 2 53 35 38 49 28 18 6 36 58 21 47 27 5 50 62 44 12 52 37 11 56 15 31 25 65 17 29 59 41 7 42 4 43 39 10 1 40 24 13 20 54 19 67 46 60 51 45 64 30 8 33 26 9 3 22 34 23 57 48 55 14 63 61 32", "output": "45" }, { "input": "68\n13 6 27 21 65 23 59 14 62 43 33 31 38 41 67 20 16 25 42 4 28 40 29 9 64 17 2 26 32 58 60 53 46 48 47 54 44 50 39 19 30 57 61 1 11 18 37 24 55 15 63 34 8 52 56 7 10 12 35 66 5 36 45 49 68 22 51 3", "output": "64" }, { "input": "69\n29 49 25 51 21 35 11 61 39 54 40 37 60 42 27 33 59 53 34 10 46 2 23 69 8 47 58 36 1 38 19 12 7 48 13 3 6 22 18 5 65 24 50 41 66 44 67 57 4 56 62 43 9 30 14 15 28 31 64 26 16 55 68 17 32 20 45 52 63", "output": "45" }, { "input": "70\n19 12 15 18 36 16 61 69 24 7 11 13 3 48 55 21 37 17 43 31 41 22 28 32 27 63 38 49 59 56 30 25 67 51 52 45 50 44 66 57 26 60 5 46 33 6 23 34 8 40 2 68 14 39 65 64 62 42 47 54 10 53 9 1 70 58 20 4 29 35", "output": "64" }, { "input": "71\n40 6 62 3 41 52 31 66 27 16 35 5 17 60 2 15 51 22 67 61 71 53 1 64 8 45 28 18 50 30 12 69 20 26 10 37 36 49 70 32 33 11 57 14 9 55 4 58 29 25 44 65 39 48 24 47 19 46 56 38 34 42 59 63 54 23 7 68 43 13 21", "output": "50" }, { "input": "72\n52 64 71 40 32 10 62 21 11 37 38 13 22 70 1 66 41 50 27 20 42 47 25 68 49 12 15 72 44 60 53 5 23 14 43 29 65 36 51 54 35 67 7 19 55 48 58 46 39 24 33 30 61 45 57 2 31 3 18 59 6 9 4 63 8 16 26 34 28 69 17 56", "output": "57" }, { "input": "73\n58 38 47 34 39 64 69 66 72 57 9 4 67 22 35 13 61 14 28 52 56 20 31 70 27 24 36 1 62 17 10 5 12 33 16 73 18 49 63 71 44 65 23 30 40 8 50 46 60 25 11 26 37 55 29 68 42 2 3 32 59 7 15 43 41 48 51 53 6 45 54 19 21", "output": "45" }, { "input": "74\n19 51 59 34 8 40 42 55 65 16 74 26 49 63 64 70 35 72 7 12 43 18 61 27 47 31 13 32 71 22 25 67 9 1 48 50 33 10 21 46 11 45 17 37 28 60 69 66 38 2 30 3 39 15 53 68 57 41 6 36 24 73 4 23 5 62 44 14 20 29 52 54 56 58", "output": "63" }, { "input": "75\n75 28 60 19 59 17 65 26 32 23 18 64 8 62 4 11 42 16 47 5 72 46 9 1 25 21 2 50 33 6 36 68 30 12 20 40 53 45 34 7 37 39 38 44 63 61 67 3 66 51 29 73 24 57 70 27 10 56 22 55 13 49 35 15 54 41 14 74 69 48 52 31 71 43 58", "output": "74" }, { "input": "76\n1 47 54 17 38 37 12 32 14 48 43 71 60 56 4 13 64 41 52 57 62 24 23 49 20 10 63 3 25 66 59 40 58 33 53 46 70 7 35 61 72 74 73 19 30 5 29 6 15 28 21 27 51 55 50 9 65 8 67 39 76 42 31 34 16 2 36 11 26 44 22 45 75 18 69 68", "output": "75" }, { "input": "77\n10 20 57 65 53 69 59 45 58 32 28 72 4 14 1 33 40 47 7 5 51 76 37 16 41 61 42 2 21 26 38 74 35 64 43 77 71 50 39 48 27 63 73 44 52 66 9 18 23 54 25 6 8 56 13 67 36 22 15 46 62 75 55 11 31 17 24 29 60 68 12 30 3 70 49 19 34", "output": "62" }, { "input": "78\n7 61 69 47 68 42 65 78 70 3 32 59 49 51 23 71 11 63 22 18 43 34 24 13 27 16 19 40 21 46 48 77 28 66 54 67 60 15 75 62 9 26 52 58 4 25 8 37 41 76 1 6 30 50 44 36 5 14 29 53 17 12 2 57 73 35 64 39 56 10 33 20 45 74 31 55 38 72", "output": "70" }, { "input": "79\n75 79 43 66 72 52 29 65 74 38 24 1 5 51 13 7 71 33 4 61 2 36 63 47 64 44 34 27 3 21 17 37 54 53 49 20 28 60 39 10 16 76 6 77 73 22 50 48 78 30 67 56 31 26 40 59 41 11 18 45 69 62 15 23 32 70 19 55 68 57 35 25 12 46 14 42 9 8 58", "output": "77" }, { "input": "80\n51 20 37 12 68 11 28 52 76 21 7 5 3 16 64 34 25 2 6 40 60 62 75 13 45 17 56 29 32 47 79 73 49 72 15 46 30 54 80 27 43 24 74 18 42 71 14 4 44 63 65 33 1 77 55 57 41 59 58 70 69 35 19 67 10 36 26 23 48 50 39 61 9 66 38 8 31 22 53 78", "output": "52" }, { "input": "81\n63 22 4 41 43 74 64 39 10 35 20 81 11 28 70 67 53 79 16 61 68 52 27 37 58 9 50 49 18 30 72 47 7 60 78 51 23 48 73 66 44 13 15 57 56 38 1 76 25 45 36 34 42 8 75 26 59 14 71 21 6 77 5 17 2 32 40 54 46 24 29 3 31 19 65 62 33 69 12 80 55", "output": "69" }, { "input": "82\n50 24 17 41 49 18 80 11 79 72 57 31 21 35 2 51 36 66 20 65 38 3 45 32 59 81 28 30 70 55 29 76 73 6 33 39 8 7 19 48 63 1 77 43 4 13 78 54 69 9 40 46 74 82 60 71 16 64 12 14 47 26 44 5 10 75 53 25 27 15 56 42 58 34 23 61 67 62 68 22 37 52", "output": "53" }, { "input": "83\n64 8 58 17 67 46 3 82 23 70 72 16 53 45 13 20 12 48 40 4 6 47 76 60 19 44 30 78 28 22 75 15 25 29 63 74 55 32 14 51 35 31 62 77 27 42 65 71 56 61 66 41 68 49 7 34 2 83 36 5 33 26 37 80 59 50 1 9 54 21 18 24 38 73 81 52 10 39 43 79 57 11 69", "output": "66" }, { "input": "84\n75 8 66 21 61 63 72 51 52 13 59 25 28 58 64 53 79 41 34 7 67 11 39 56 44 24 50 9 49 55 1 80 26 6 73 74 27 69 65 37 18 43 36 17 30 3 47 29 76 78 32 22 12 68 46 5 42 81 57 31 33 83 54 48 14 62 10 16 4 20 71 70 35 15 45 19 60 77 2 23 84 40 82 38", "output": "80" }, { "input": "85\n1 18 58 8 22 76 3 61 12 33 54 41 6 24 82 15 10 17 38 64 26 4 62 28 47 14 66 9 84 75 2 71 67 43 37 32 85 21 69 52 55 63 81 51 74 59 65 34 29 36 30 45 27 53 13 79 39 57 5 70 19 40 7 42 68 48 16 80 83 23 46 35 72 31 11 44 73 77 50 56 49 25 60 20 78", "output": "84" }, { "input": "86\n64 56 41 10 31 69 47 39 37 36 27 19 9 42 15 6 78 59 52 17 71 45 72 14 2 54 38 79 4 18 16 8 46 75 50 82 44 24 20 55 58 86 61 43 35 32 33 40 63 30 28 60 13 53 12 57 77 81 76 66 73 84 85 62 68 22 51 5 49 7 1 70 80 65 34 48 23 21 83 11 74 26 29 67 25 3", "output": "70" }, { "input": "87\n14 20 82 47 39 75 71 45 3 37 63 19 32 68 7 41 48 76 27 46 84 49 4 44 26 69 17 64 1 18 58 33 11 23 21 86 67 52 70 16 77 78 6 74 15 87 10 59 13 34 22 2 65 38 66 61 51 57 35 60 81 40 36 80 31 43 83 56 79 55 29 5 12 8 50 30 53 72 54 9 24 25 42 62 73 28 85", "output": "58" }, { "input": "88\n1 83 73 46 61 31 39 86 57 43 16 29 26 80 82 7 36 42 13 20 6 64 19 40 24 12 47 87 8 34 75 9 69 3 11 52 14 25 84 59 27 10 54 51 81 74 65 77 70 17 60 35 23 44 49 2 4 88 5 21 41 32 68 66 15 55 48 58 78 53 22 38 45 33 30 50 85 76 37 79 63 18 28 62 72 56 71 67", "output": "87" }, { "input": "89\n68 40 14 58 56 25 8 44 49 55 9 76 66 54 33 81 42 15 59 17 21 30 75 60 4 48 64 6 52 63 61 27 12 57 72 67 23 86 77 80 22 13 43 73 26 78 50 51 18 62 1 29 82 16 74 2 87 24 3 41 11 46 47 69 10 84 65 39 35 79 70 32 34 31 20 19 53 71 36 28 83 88 38 85 7 5 37 45 89", "output": "88" }, { "input": "90\n2 67 26 58 9 49 76 22 60 30 77 20 13 7 37 81 47 16 19 12 14 45 41 68 85 54 28 24 46 1 27 43 32 89 53 35 59 75 18 51 17 64 66 80 31 88 87 90 38 72 55 71 42 11 73 69 62 78 23 74 65 79 84 4 86 52 10 6 3 82 56 5 48 33 21 57 40 29 61 63 34 36 83 8 15 44 50 70 39 25", "output": "60" }, { "input": "91\n91 69 56 16 73 55 14 82 80 46 57 81 22 71 63 76 43 37 77 75 70 3 26 2 28 17 51 38 30 67 41 47 54 62 34 25 84 11 87 39 32 52 31 36 50 19 21 53 29 24 79 8 74 64 44 7 6 18 10 42 13 9 83 58 4 88 65 60 20 90 66 49 86 89 78 48 5 27 23 59 61 15 72 45 40 33 68 85 35 12 1", "output": "90" }, { "input": "92\n67 57 76 78 25 89 6 82 11 16 26 17 59 48 73 10 21 31 27 80 4 5 22 13 92 55 45 85 63 28 75 60 54 88 91 47 29 35 7 87 1 39 43 51 71 84 83 81 46 9 38 56 90 24 37 41 19 86 50 61 79 20 18 14 69 23 62 65 49 52 58 53 36 2 68 64 15 42 30 34 66 32 44 40 8 33 3 77 74 12 70 72", "output": "67" }, { "input": "93\n76 35 5 87 7 21 59 71 24 37 2 73 31 74 4 52 28 20 56 27 65 86 16 45 85 67 68 70 47 72 91 88 14 32 62 69 78 41 15 22 57 18 50 13 39 58 17 83 64 51 25 11 38 77 82 90 8 26 29 61 10 43 79 53 48 6 23 55 63 49 81 92 80 44 89 60 66 30 1 9 36 33 19 46 75 93 3 12 42 84 40 54 34", "output": "85" }, { "input": "94\n29 85 82 78 61 83 80 63 11 38 50 43 9 24 4 87 79 45 3 17 90 7 34 27 1 76 26 39 84 47 22 41 81 19 44 23 56 92 35 31 72 62 70 53 40 88 13 14 73 2 59 86 46 94 15 12 77 57 89 42 75 48 18 51 32 55 71 30 49 91 20 60 5 93 33 64 21 36 10 28 8 65 66 69 74 58 6 52 25 67 16 37 54 68", "output": "69" }, { "input": "95\n36 73 18 77 15 71 50 57 79 65 94 88 9 69 52 70 26 66 78 89 55 20 72 83 75 68 32 28 45 74 19 22 54 23 84 90 86 12 42 58 11 81 39 31 85 47 60 44 59 43 21 7 30 41 64 76 93 46 87 48 10 40 3 14 38 49 29 35 2 67 5 34 13 37 27 56 91 17 62 80 8 61 53 95 24 92 6 82 63 33 51 25 4 16 1", "output": "94" }, { "input": "96\n64 3 47 83 19 10 72 61 73 95 16 40 54 84 8 86 28 4 37 42 92 48 63 76 67 1 59 66 20 35 93 2 43 7 45 70 34 33 26 91 85 89 13 29 58 68 44 25 87 75 49 71 41 17 55 36 32 31 74 22 52 79 30 88 50 78 38 39 65 27 69 77 81 94 82 53 21 80 57 60 24 46 51 9 18 15 96 62 6 23 11 12 90 5 14 56", "output": "86" }, { "input": "97\n40 63 44 64 84 92 38 41 28 91 3 70 76 67 94 96 35 79 29 22 78 88 85 8 21 1 93 54 71 80 37 17 13 26 62 59 75 87 69 33 89 49 77 61 12 39 6 36 58 18 73 50 82 45 74 52 11 34 95 7 23 30 15 32 31 16 55 19 20 83 60 72 10 53 51 14 27 9 68 47 5 2 81 46 57 86 56 43 48 66 24 25 4 42 65 97 90", "output": "95" }, { "input": "98\n85 94 69 86 22 52 27 79 53 91 35 55 33 88 8 75 76 95 64 54 67 30 70 49 6 16 2 48 80 32 25 90 98 46 9 96 36 81 10 92 28 11 37 97 15 41 38 40 83 44 29 47 23 3 31 61 87 39 78 20 68 12 17 73 59 18 77 72 43 51 84 24 89 65 26 7 74 93 21 19 5 14 50 42 82 71 60 56 34 62 58 57 45 66 13 63 4 1", "output": "97" }, { "input": "99\n33 48 19 41 59 64 16 12 17 13 7 1 9 6 4 92 61 49 60 25 74 65 22 97 30 32 10 62 14 55 80 66 82 78 31 23 87 93 27 98 20 29 88 84 77 34 83 96 79 90 56 89 58 72 52 47 21 76 24 70 44 94 5 39 8 18 57 36 40 68 43 75 3 2 35 99 63 26 67 73 15 11 53 28 42 46 69 50 51 95 38 37 54 85 81 91 45 86 71", "output": "87" }, { "input": "100\n28 30 77 4 81 67 31 25 66 56 88 73 83 51 57 34 21 90 38 76 22 99 53 70 91 3 64 54 6 94 8 5 97 80 50 45 61 40 16 95 36 98 9 2 17 44 72 55 18 58 47 12 87 24 7 32 14 23 65 41 63 48 62 39 92 27 43 19 46 13 42 52 96 84 26 69 100 79 93 49 35 60 71 59 68 15 10 29 20 1 78 33 75 86 11 85 74 82 89 37", "output": "89" }, { "input": "100\n100 97 35 55 45 3 46 98 77 64 94 85 73 43 49 79 72 9 70 62 80 88 29 58 61 20 89 83 66 86 82 15 6 87 42 96 90 75 63 38 81 40 5 23 4 18 41 19 99 60 8 12 76 51 39 93 53 26 21 50 47 28 13 30 68 59 34 54 24 56 31 27 65 16 32 10 36 52 44 91 22 14 33 25 7 78 67 17 57 37 92 11 2 69 84 95 74 71 48 1", "output": "99" }, { "input": "100\n83 96 73 70 30 25 7 77 58 89 76 85 49 82 45 51 14 62 50 9 31 32 16 15 97 64 4 37 20 93 24 10 80 71 100 39 75 72 78 74 8 29 53 86 79 48 3 68 90 99 56 87 63 94 36 1 40 65 6 44 43 84 17 52 34 95 38 47 60 57 98 59 33 41 46 81 23 27 19 2 54 91 55 35 26 12 92 18 28 66 69 21 5 67 13 11 22 88 61 42", "output": "65" }, { "input": "100\n96 80 47 60 56 9 78 20 37 72 68 15 100 94 51 26 65 38 50 19 4 70 25 63 22 30 13 58 43 69 18 33 5 66 39 73 12 55 95 92 97 1 14 83 10 28 64 31 46 91 32 86 74 54 29 52 89 53 90 44 62 40 16 24 67 81 36 34 7 23 79 87 75 98 84 3 41 77 76 42 71 35 49 61 2 27 59 82 99 85 21 11 45 6 88 48 17 57 8 93", "output": "87" }, { "input": "100\n5 6 88 37 97 51 25 81 54 17 57 98 99 44 67 24 30 93 100 36 8 38 84 42 21 4 75 31 85 48 70 77 43 50 65 94 29 32 68 86 56 39 69 47 20 60 52 53 10 34 79 2 95 40 89 64 71 26 22 46 1 62 91 76 83 41 9 78 16 63 13 3 28 92 27 49 7 12 96 72 80 23 14 19 18 66 59 87 90 45 73 82 33 74 35 61 55 15 58 11", "output": "81" }, { "input": "100\n100 97 92 12 62 17 19 58 37 26 30 95 31 35 87 10 13 43 98 61 28 89 76 1 23 21 11 22 50 56 91 74 3 24 96 55 64 67 14 4 71 16 18 9 77 68 51 81 32 82 46 88 86 60 29 66 72 85 70 7 53 63 33 45 83 2 25 94 52 93 5 69 20 47 49 54 57 39 34 27 90 80 78 59 40 42 79 6 38 8 48 15 65 73 99 44 41 84 36 75", "output": "99" }, { "input": "100\n22 47 34 65 69 5 68 78 53 54 41 23 80 51 11 8 2 85 81 75 25 58 29 73 30 49 10 71 17 96 76 89 79 20 12 15 55 7 46 32 19 3 82 35 74 44 38 40 92 14 6 50 97 63 45 93 37 18 62 77 87 36 83 9 90 61 57 28 39 43 52 42 24 56 21 84 26 99 88 59 33 70 4 60 98 95 94 100 13 48 66 72 16 31 64 91 1 86 27 67", "output": "96" }, { "input": "100\n41 67 94 18 14 83 59 12 19 54 13 68 75 26 15 65 80 40 23 30 34 78 47 21 63 79 4 70 3 31 86 69 92 10 61 74 97 100 9 99 32 27 91 55 85 52 16 17 28 1 64 29 58 76 98 25 84 7 2 96 20 72 36 46 49 82 93 44 45 6 38 87 57 50 53 35 60 33 8 89 39 42 37 48 62 81 73 43 95 11 66 88 90 22 24 77 71 51 5 56", "output": "62" }, { "input": "100\n1 88 38 56 62 99 39 80 12 33 57 24 28 84 37 42 10 95 83 58 8 40 20 2 30 78 60 79 36 71 51 31 27 65 22 47 6 19 61 94 75 4 74 35 15 23 92 9 70 13 11 59 90 18 66 81 64 72 16 32 34 67 46 91 21 87 77 97 82 41 7 86 26 43 45 3 93 17 52 96 50 63 48 5 53 44 29 25 98 54 49 14 73 69 89 55 76 85 68 100", "output": "99" }, { "input": "100\n22 59 25 77 68 79 32 45 20 28 61 60 38 86 33 10 100 15 53 75 78 39 67 13 66 34 96 4 63 23 73 29 31 35 71 55 16 14 72 56 94 97 17 93 47 84 57 8 21 51 54 85 26 76 49 81 2 92 62 44 91 87 11 24 95 69 5 7 99 6 65 48 70 12 41 18 74 27 42 3 80 30 50 98 58 37 82 89 83 36 40 52 19 9 88 46 43 1 90 64", "output": "97" }, { "input": "100\n12 1 76 78 97 82 59 80 48 8 91 51 54 74 16 10 89 99 83 63 93 90 55 25 30 33 29 6 9 65 92 79 44 39 15 58 37 46 32 19 27 3 75 49 62 71 98 42 69 50 26 81 96 5 7 61 60 21 20 36 18 34 40 4 47 85 64 38 22 84 2 68 11 56 31 66 17 14 95 43 53 35 23 52 70 13 72 45 41 77 73 87 88 94 28 86 24 67 100 57", "output": "98" }, { "input": "100\n66 100 53 88 7 73 54 41 31 42 8 46 65 90 78 14 94 30 79 39 89 5 83 50 38 61 37 86 22 95 60 98 34 57 91 10 75 25 15 43 23 17 96 35 93 48 87 47 56 13 19 9 82 62 67 80 11 55 99 70 18 26 58 85 12 44 16 45 4 49 20 71 92 24 81 2 76 32 6 21 84 36 52 97 59 63 40 51 27 64 68 3 77 72 28 33 29 1 74 69", "output": "98" }, { "input": "100\n56 64 1 95 72 39 9 49 87 29 94 7 32 6 30 48 50 25 31 78 90 45 60 44 80 68 17 20 73 15 75 98 83 13 71 22 36 26 96 88 35 3 85 54 16 41 92 99 69 86 93 33 43 62 77 46 47 37 12 10 18 40 27 4 63 55 28 59 23 34 61 53 76 42 51 91 21 70 8 58 38 19 5 66 84 11 52 24 81 82 79 67 97 65 57 74 2 89 100 14", "output": "98" }, { "input": "3\n1 2 3", "output": "2" }, { "input": "3\n1 3 2", "output": "2" }, { "input": "3\n2 1 3", "output": "2" }, { "input": "3\n2 3 1", "output": "2" }, { "input": "3\n3 1 2", "output": "2" }, { "input": "3\n3 2 1", "output": "2" }, { "input": "4\n1 2 3 4", "output": "3" }, { "input": "4\n1 2 4 3", "output": "3" }, { "input": "4\n1 3 2 4", "output": "3" }, { "input": "4\n1 3 4 2", "output": "3" }, { "input": "4\n1 4 2 3", "output": "3" }, { "input": "4\n1 4 3 2", "output": "3" }, { "input": "4\n2 1 3 4", "output": "3" }, { "input": "4\n2 1 4 3", "output": "2" }, { "input": "4\n2 4 1 3", "output": "2" }, { "input": "4\n2 4 3 1", "output": "3" }, { "input": "4\n3 1 2 4", "output": "3" }, { "input": "4\n3 1 4 2", "output": "2" }, { "input": "4\n3 2 1 4", "output": "3" }, { "input": "4\n3 2 4 1", "output": "3" }, { "input": "4\n3 4 1 2", "output": "2" }, { "input": "4\n3 4 2 1", "output": "3" }, { "input": "4\n4 1 2 3", "output": "3" }, { "input": "4\n4 1 3 2", "output": "3" }, { "input": "4\n4 2 1 3", "output": "3" }, { "input": "4\n4 2 3 1", "output": "3" }, { "input": "4\n4 3 1 2", "output": "3" }, { "input": "4\n4 3 2 1", "output": "3" }, { "input": "8\n2 5 6 4 8 3 1 7", "output": "6" }, { "input": "5\n2 3 1 5 4", "output": "3" }, { "input": "6\n2 5 3 6 4 1", "output": "5" }, { "input": "6\n5 4 2 6 1 3", "output": "4" }, { "input": "6\n4 2 3 1 6 5", "output": "4" }, { "input": "6\n5 4 2 1 6 3", "output": "4" }, { "input": "9\n7 2 3 4 5 6 1 9 8", "output": "7" }, { "input": "6\n3 2 1 4 6 5", "output": "4" }, { "input": "6\n2 3 4 1 6 5", "output": "4" }, { "input": "10\n5 2 3 4 1 6 7 8 10 9", "output": "8" }, { "input": "6\n5 2 3 1 6 4", "output": "4" }, { "input": "10\n2 9 3 4 1 10 5 6 7 8", "output": "5" }, { "input": "10\n2 3 4 5 6 7 1 8 10 9", "output": "8" }, { "input": "8\n2 3 4 5 1 6 8 7", "output": "6" }, { "input": "6\n2 1 3 4 5 6", "output": "5" } ]

1,646,210,665

2,147,483,647

Python 3

OK

TESTS

159

62

0

n = int(input()) a = list(map(int, input().split())) Min = a.index(1) Max = a.index(n) print(max( Min, n - Min - 1, Max, n - Max - 1 ))

Title: Nicholas and Permutation Time Limit: None seconds Memory Limit: None megabytes Problem Description: Nicholas has an array *a* that contains *n* distinct integers from 1 to *n*. In other words, Nicholas has a permutation of size *n*. Nicholas want the minimum element (integer 1) and the maximum element (integer *n*) to be as far as possible from each other. He wants to perform exactly one swap in order to maximize the distance between the minimum and the maximum elements. The distance between two elements is considered to be equal to the absolute difference between their positions. Input Specification: The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100) — the size of the permutation. The second line of the input contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*), where *a**i* is equal to the element at the *i*-th position. Output Specification: Print a single integer — the maximum possible distance between the minimum and the maximum elements Nicholas can achieve by performing exactly one swap. Demo Input: ['5\n4 5 1 3 2\n', '7\n1 6 5 3 4 7 2\n', '6\n6 5 4 3 2 1\n'] Demo Output: ['3\n', '6\n', '5\n'] Note: In the first sample, one may obtain the optimal answer by swapping elements 1 and 2. In the second sample, the minimum and the maximum elements will be located in the opposite ends of the array if we swap 7 and 2. In the third sample, the distance between the minimum and the maximum elements is already maximum possible, so we just perform some unnecessary swap, for example, one can swap 5 and 2.

```python n = int(input()) a = list(map(int, input().split())) Min = a.index(1) Max = a.index(n) print(max( Min, n - Min - 1, Max, n - Max - 1 )) ```

3

151

A

Soft Drinking

PROGRAMMING

800

[ "implementation", "math" ]

null

This winter is so cold in Nvodsk! A group of *n* friends decided to buy *k* bottles of a soft drink called "Take-It-Light" to warm up a bit. Each bottle has *l* milliliters of the drink. Also they bought *c* limes and cut each of them into *d* slices. After that they found *p* grams of salt. To make a toast, each friend needs *nl* milliliters of the drink, a slice of lime and *np* grams of salt. The friends want to make as many toasts as they can, provided they all drink the same amount. How many toasts can each friend make?

The first and only line contains positive integers *n*, *k*, *l*, *c*, *d*, *p*, *nl*, *np*, not exceeding 1000 and no less than 1. The numbers are separated by exactly one space.

Print a single integer — the number of toasts each friend can make.

[ "3 4 5 10 8 100 3 1\n", "5 100 10 1 19 90 4 3\n", "10 1000 1000 25 23 1 50 1\n" ]

[ "2\n", "3\n", "0\n" ]

A comment to the first sample: Overall the friends have 4 * 5 = 20 milliliters of the drink, it is enough to make 20 / 3 = 6 toasts. The limes are enough for 10 * 8 = 80 toasts and the salt is enough for 100 / 1 = 100 toasts. However, there are 3 friends in the group, so the answer is *min*(6, 80, 100) / 3 = 2.

500

[ { "input": "3 4 5 10 8 100 3 1", "output": "2" }, { "input": "5 100 10 1 19 90 4 3", "output": "3" }, { "input": "10 1000 1000 25 23 1 50 1", "output": "0" }, { "input": "1 7 4 5 5 8 3 2", "output": "4" }, { "input": "2 3 3 5 5 10 1 3", "output": "1" }, { "input": "2 6 4 5 6 5 1 3", "output": "0" }, { "input": "1 7 3 5 3 6 2 1", "output": "6" }, { "input": "2 4 5 4 5 7 3 2", "output": "1" }, { "input": "2 3 6 5 7 8 2 1", "output": "4" }, { "input": "1 4 5 5 3 10 3 1", "output": "6" }, { "input": "1 4 6 7 3 5 1 3", "output": "1" }, { "input": "1 6 5 5 5 8 3 1", "output": "8" }, { "input": "1 7 5 3 3 9 2 1", "output": "9" }, { "input": "3 5 3 7 6 10 3 1", "output": "1" }, { "input": "3 6 3 5 3 6 3 1", "output": "2" }, { "input": "1 7 5 5 5 5 2 2", "output": "2" }, { "input": "2 5 3 5 6 9 2 1", "output": "3" }, { "input": "3 4 3 5 3 6 2 1", "output": "2" }, { "input": "1 5 5 4 7 6 3 1", "output": "6" }, { "input": "2 3 7 6 5 9 3 1", "output": "3" }, { "input": "2 6 5 3 3 8 1 1", "output": "4" }, { "input": "2 4 7 3 4 10 2 1", "output": "5" }, { "input": "1 1000 1000 1000 1000 1000 1 1", "output": "1000" }, { "input": "17 1000 1000 1000 1000 1000 3 7", "output": "8" }, { "input": "115 1000 1000 1000 1000 1000 17 15", "output": "0" }, { "input": "1 587 981 1 2 1 1 1", "output": "1" }, { "input": "1 1 2 1 2 2 1 1", "output": "2" } ]

1,672,234,256

2,147,483,647

Python 3

WRONG_ANSWER

TESTS

9

92

0

n,k,l,c,d,p,nl,np=map(int,input().split()) t=min((k*l)/n,c*d,p/np) d=int(t/n) print(d)

Title: Soft Drinking Time Limit: None seconds Memory Limit: None megabytes Problem Description: This winter is so cold in Nvodsk! A group of *n* friends decided to buy *k* bottles of a soft drink called "Take-It-Light" to warm up a bit. Each bottle has *l* milliliters of the drink. Also they bought *c* limes and cut each of them into *d* slices. After that they found *p* grams of salt. To make a toast, each friend needs *nl* milliliters of the drink, a slice of lime and *np* grams of salt. The friends want to make as many toasts as they can, provided they all drink the same amount. How many toasts can each friend make? Input Specification: The first and only line contains positive integers *n*, *k*, *l*, *c*, *d*, *p*, *nl*, *np*, not exceeding 1000 and no less than 1. The numbers are separated by exactly one space. Output Specification: Print a single integer — the number of toasts each friend can make. Demo Input: ['3 4 5 10 8 100 3 1\n', '5 100 10 1 19 90 4 3\n', '10 1000 1000 25 23 1 50 1\n'] Demo Output: ['2\n', '3\n', '0\n'] Note: A comment to the first sample: Overall the friends have 4 * 5 = 20 milliliters of the drink, it is enough to make 20 / 3 = 6 toasts. The limes are enough for 10 * 8 = 80 toasts and the salt is enough for 100 / 1 = 100 toasts. However, there are 3 friends in the group, so the answer is *min*(6, 80, 100) / 3 = 2.

```python n,k,l,c,d,p,nl,np=map(int,input().split()) t=min((k*l)/n,c*d,p/np) d=int(t/n) print(d) ```

0

440

A

Forgotten Episode

PROGRAMMING

800

[ "implementation" ]

null

Polycarpus adores TV series. Right now he is ready to finish watching a season of a popular sitcom "Graph Theory". In total, the season has *n* episodes, numbered with integers from 1 to *n*. Polycarpus watches episodes not one by one but in a random order. He has already watched all the episodes except for one. Which episode has Polycaprus forgotten to watch?

The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=100000) — the number of episodes in a season. Assume that the episodes are numbered by integers from 1 to *n*. The second line contains *n*<=-<=1 integer *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the numbers of episodes that Polycarpus has watched. All values of *a**i* are distinct.

Print the number of the episode that Polycarpus hasn't watched.

[ "10\n3 8 10 1 7 9 6 5 2\n" ]

[ "4\n" ]

none

500

[ { "input": "10\n3 8 10 1 7 9 6 5 2", "output": "4" }, { "input": "5\n4 3 2 1", "output": "5" }, { "input": "2\n1", "output": "2" }, { "input": "2\n2", "output": "1" }, { "input": "3\n1 2", "output": "3" }, { "input": "3\n1 3", "output": "2" }, { "input": "3\n2 3", "output": "1" }, { "input": "3\n2 1", "output": "3" }, { "input": "3\n3 1", "output": "2" }, { "input": "3\n3 2", "output": "1" }, { "input": "5\n2 3 4 5", "output": "1" }, { "input": "5\n5 4 3 2", "output": "1" }, { "input": "5\n5 2 4 3", "output": "1" }, { "input": "5\n1 2 3 4", "output": "5" }, { "input": "5\n2 1 3 4", "output": "5" }, { "input": "5\n1 5 3 4", "output": "2" }, { "input": "5\n1 4 5 2", "output": "3" }, { "input": "5\n2 1 5 3", "output": "4" }, { "input": "5\n2 3 4 5", "output": "1" } ]

1,641,139,494

2,147,483,647

Python 3

TIME_LIMIT_EXCEEDED

TESTS

20

1,000

6,963,200

a = int(input()) b = list(map(int,input().split())) d =0 for i in range(1,a+1): if(i not in b): d = i break print(d)

Title: Forgotten Episode Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarpus adores TV series. Right now he is ready to finish watching a season of a popular sitcom "Graph Theory". In total, the season has *n* episodes, numbered with integers from 1 to *n*. Polycarpus watches episodes not one by one but in a random order. He has already watched all the episodes except for one. Which episode has Polycaprus forgotten to watch? Input Specification: The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=100000) — the number of episodes in a season. Assume that the episodes are numbered by integers from 1 to *n*. The second line contains *n*<=-<=1 integer *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the numbers of episodes that Polycarpus has watched. All values of *a**i* are distinct. Output Specification: Print the number of the episode that Polycarpus hasn't watched. Demo Input: ['10\n3 8 10 1 7 9 6 5 2\n'] Demo Output: ['4\n'] Note: none

```python a = int(input()) b = list(map(int,input().split())) d =0 for i in range(1,a+1): if(i not in b): d = i break print(d) ```

0

343

D

Water Tree

PROGRAMMING

2,100

[ "data structures", "dfs and similar", "graphs", "trees" ]

null

Mad scientist Mike has constructed a rooted tree, which consists of *n* vertices. Each vertex is a reservoir which can be either empty or filled with water. The vertices of the tree are numbered from 1 to *n* with the root at vertex 1. For each vertex, the reservoirs of its children are located below the reservoir of this vertex, and the vertex is connected with each of the children by a pipe through which water can flow downwards. Mike wants to do the following operations with the tree: 1. Fill vertex *v* with water. Then *v* and all its children are filled with water. 1. Empty vertex *v*. Then *v* and all its ancestors are emptied. 1. Determine whether vertex *v* is filled with water at the moment. Mike has already compiled a full list of operations that he wants to perform in order. Before experimenting with the tree Mike decided to run the list through a simulation. Help Mike determine what results will he get after performing all the operations.

The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=500000) — the number of vertices in the tree. Each of the following *n*<=-<=1 lines contains two space-separated numbers *a**i*, *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*) — the edges of the tree. The next line contains a number *q* (1<=≤<=*q*<=≤<=500000) — the number of operations to perform. Each of the following *q* lines contains two space-separated numbers *c**i* (1<=≤<=*c**i*<=≤<=3), *v**i* (1<=≤<=*v**i*<=≤<=*n*), where *c**i* is the operation type (according to the numbering given in the statement), and *v**i* is the vertex on which the operation is performed. It is guaranteed that the given graph is a tree.

For each type 3 operation print 1 on a separate line if the vertex is full, and 0 if the vertex is empty. Print the answers to queries in the order in which the queries are given in the input.

[ "5\n1 2\n5 1\n2 3\n4 2\n12\n1 1\n2 3\n3 1\n3 2\n3 3\n3 4\n1 2\n2 4\n3 1\n3 3\n3 4\n3 5\n" ]

[ "0\n0\n0\n1\n0\n1\n0\n1\n" ]

none

2,000

[ { "input": "5\n1 2\n5 1\n2 3\n4 2\n12\n1 1\n2 3\n3 1\n3 2\n3 3\n3 4\n1 2\n2 4\n3 1\n3 3\n3 4\n3 5", "output": "0\n0\n0\n1\n0\n1\n0\n1" }, { "input": "1\n1\n3 1", "output": "0" }, { "input": "2\n1 2\n13\n1 1\n3 1\n3 2\n2 1\n3 1\n3 2\n2 2\n3 1\n3 2\n1 1\n2 2\n3 1\n3 2", "output": "1\n1\n0\n1\n0\n0\n0\n0" }, { "input": "3\n1 2\n1 3\n4\n1 1\n2 2\n3 1\n3 3", "output": "0\n1" }, { "input": "6\n2 1\n3 2\n3 4\n2 5\n5 6\n6\n1 5\n2 6\n2 3\n1 5\n3 5\n2 1", "output": "1" }, { "input": "10\n1 2\n2 3\n2 4\n1 5\n4 6\n3 7\n6 8\n6 9\n2 10\n10\n3 8\n3 6\n3 4\n1 2\n1 5\n3 10\n3 3\n2 8\n2 4\n3 9", "output": "0\n0\n0\n1\n1\n1" }, { "input": "10\n2 1\n3 2\n4 3\n5 4\n4 6\n3 7\n4 8\n9 4\n10 2\n10\n1 3\n1 1\n3 10\n1 3\n2 6\n2 10\n3 4\n2 10\n1 2\n3 1", "output": "1\n0\n0" }, { "input": "10\n1 2\n1 3\n4 2\n5 2\n6 5\n7 6\n8 6\n2 9\n10 8\n10\n3 4\n1 2\n2 7\n1 7\n1 8\n2 2\n2 5\n3 6\n2 1\n3 4", "output": "0\n0\n1" }, { "input": "6\n2 1\n3 1\n4 1\n4 5\n2 6\n4\n1 1\n2 4\n1 4\n3 1", "output": "0" }, { "input": "7\n3 7\n3 6\n2 4\n2 5\n1 2\n2 3\n28\n1 1\n2 4\n3 2\n3 4\n2 5\n3 2\n3 5\n2 6\n3 3\n3 6\n2 7\n3 3\n3 7\n2 1\n3 1\n3 2\n3 3\n1 7\n1 6\n1 5\n1 4\n3 1\n3 2\n3 3\n3 4\n3 5\n3 6\n3 7", "output": "0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1\n1\n1\n1" }, { "input": "6\n4 6\n5 1\n2 6\n5 3\n1 2\n29\n1 1\n2 4\n3 1\n3 2\n3 3\n3 4\n3 5\n3 6\n1 6\n3 1\n3 2\n3 3\n3 4\n3 5\n3 6\n2 6\n3 1\n3 2\n3 3\n3 4\n3 5\n3 6\n1 1\n3 1\n3 2\n3 3\n3 4\n3 5\n3 6", "output": "0\n0\n1\n0\n1\n0\n0\n0\n1\n1\n1\n1\n0\n0\n1\n1\n1\n0\n1\n1\n1\n1\n1\n1" }, { "input": "5\n1 2\n1 3\n1 4\n1 5\n16\n1 1\n2 2\n1 2\n3 1\n3 2\n3 3\n3 4\n3 5\n2 2\n1 1\n2 4\n3 1\n3 2\n3 3\n3 4\n3 5", "output": "0\n1\n1\n1\n1\n0\n1\n1\n0\n1" } ]

1,593,757,657

2,147,483,647

PyPy 3

COMPILATION_ERROR

TESTS

0

#include <bits/stdc++.h> #include <ext/pb_ds/assoc_container.hpp> #include <ext/pb_ds/tree_policy.hpp> #define ordered_set tree<ll, null_type,less<ll>, rb_tree_tag,tree_order_statistics_node_update> using namespace std; using namespace __gnu_pbds; typedef long long ll; #define int long long typedef unsigned long long lu; typedef vector<ll> v; typedef vector<vector<ll> > vv; typedef vector<string> vs; typedef vector<pair<ll,ll>> vpr; typedef vector<bool>vb; typedef vector<double>vd; typedef long double ld; #define f(i,n) for(ll i = 0; i < n; i++) #define ff(i,n) for(ll i=1;i<=n;i++) #define pb push_back #define mp make_pair #define endl "\n" #define fi first #define se second #define all(x) x.begin(),x.end() #define rall(x) x.rbegin(),x.rend() #define amax(x,y) if(y>x) x=y; #define amin(x,y) if(y<x)x=y; #define bg(x) x.begin() #define sz(x) (ll)x.size() #define in(x,n) for(ll i=0;i<n;i++)cin>>x[i] #define out(x,n) for(ll i=0;i<n;i++)cout<<x[i]<<" " #define mxt(a) *(max_element(a.begin(),a.end())) #define mnt(a) *(min_element(a.begin(),a.end()) #define tc ll t;cin>>t;while(t--) typedef pair<ll,ll> pi; #define yes cout<<"YES\n"; #define no cout<<"NO\n"; #define yesno(f) if(f) yes else no const v dx = {1, -1, 0, 0}; const v dy = {0, 0, 1, -1}; const ld PI = 2 * acos(0.0); ll cel(ll x1,ll y1){if((x1%y1)==0)return x1/y1;else return x1/y1+1;} ll power(ll a,ll b,ll m) { if(b==0) return 1; ll d=power(a,b/2,m); d=(d*d)%m; if(b&1) d=(d*a)%m; return d; } const ll mod=1e9+7; int MOD(int a) { if(a<0) a+=mod; if(a>=mod) a%=mod; return a; } // set_name.find_by_order(k) It returns to an iterator to the kth element (counting from zero) in the set in O(logn) time // set_name.order_of_key(k) It returns to the number of items that are strictly smaller than our item k in O(logn) time. /*string operations : str.substr (x,y) : returns a substring str[x],str[x+1],...str[x+y-1] str.substr (x) : returns a substring str[x],... end of string str.find(qtr) : returns the first occurenece of qtr in str */ const int N1=500001; int st[N1],szz[N1],parent[N1]; int Time=0; void dfs(int u,int pa,vv &gr) { st[u]=Time++; szz[u]=1; for(auto it:gr[u]) { if(it!=pa) { parent[it]=u; dfs(it,u,gr); szz[u]+=szz[it]; } } } const int N=2e6+1; int seg[N],lazy[N]; void update(int pos,int ss,int se,int l,int f,int val) { if(lazy[pos]!=-1) { seg[pos]=(se-ss+1)*lazy[pos]; if(ss!=se){ lazy[2*pos+1]=lazy[pos]; lazy[2*pos+2]=lazy[pos]; } lazy[pos]=-1; } if(ss > f || se < l || l > f) return ; if(ss >=l && se <=f) { seg[pos]=(se-ss+1)*val; if(ss!=se) { lazy[2*pos+1]=val; lazy[2*pos+2]=val; } return ; } int mid=(ss+se)/2; update(2*pos+1,ss,mid,l,f,val); update(2*pos+2,mid+1,se,l,f,val); seg[pos]=seg[2*pos+1]+seg[2*pos+2]; return ; } int query(int pos,int ss,int se,int l,int f) { if(lazy[pos]!=-1) { seg[pos]=(se-ss+1)*lazy[pos]; if(ss!=se){ lazy[2*pos+1]=lazy[pos]; lazy[2*pos+2]=lazy[pos]; } lazy[pos]=-1; } //normal if(ss > f || se < l) return 0; if(ss >=l && se <=f) return seg[pos]; int mid=(ss+se)/2; return query(2*pos+1,ss,mid,l,f)+query(2*pos+2,mid+1,se,l,f); } bool isempty(int u,int n) { int sum=query(0,0,n-1,st[u],st[u]+szz[u]-1); return (sum!=szz[u]); } void Empty(int u,int n) { update(0,0,n-1,st[u],st[u],0); } int32_t main() { ios::sync_with_stdio(false); cin.tie(nullptr); cout.tie(nullptr); // freopen("input.txt", "r", stdin); // freopen("output.txt", "w", stdout); int n;cin>>n; vv gr(n); for(int i=0;i<n-1;i++) { int a,b;cin>>a>>b; a--; b--; gr[a].pb(b); gr[b].pb(a); } parent[0]=-1; dfs(0,-1,gr); for(int i=0;i<N;i++) { lazy[i]=-1; } int q;cin>>q; while(q--) { int c,u;cin>>c>>u; u--; if(c==1) { if(isempty(u,n)) { if(parent[u]!=-1) { Empty(parent[u],n); } update(0,0,n-1,st[u],st[u]+szz[u]-1,1); } } else if(c==2) { Empty(u,n); } else { cout<<(isempty(u,n)?0:1)<<endl; } } return 0; }

Title: Water Tree Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mad scientist Mike has constructed a rooted tree, which consists of *n* vertices. Each vertex is a reservoir which can be either empty or filled with water. The vertices of the tree are numbered from 1 to *n* with the root at vertex 1. For each vertex, the reservoirs of its children are located below the reservoir of this vertex, and the vertex is connected with each of the children by a pipe through which water can flow downwards. Mike wants to do the following operations with the tree: 1. Fill vertex *v* with water. Then *v* and all its children are filled with water. 1. Empty vertex *v*. Then *v* and all its ancestors are emptied. 1. Determine whether vertex *v* is filled with water at the moment. Mike has already compiled a full list of operations that he wants to perform in order. Before experimenting with the tree Mike decided to run the list through a simulation. Help Mike determine what results will he get after performing all the operations. Input Specification: The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=500000) — the number of vertices in the tree. Each of the following *n*<=-<=1 lines contains two space-separated numbers *a**i*, *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*) — the edges of the tree. The next line contains a number *q* (1<=≤<=*q*<=≤<=500000) — the number of operations to perform. Each of the following *q* lines contains two space-separated numbers *c**i* (1<=≤<=*c**i*<=≤<=3), *v**i* (1<=≤<=*v**i*<=≤<=*n*), where *c**i* is the operation type (according to the numbering given in the statement), and *v**i* is the vertex on which the operation is performed. It is guaranteed that the given graph is a tree. Output Specification: For each type 3 operation print 1 on a separate line if the vertex is full, and 0 if the vertex is empty. Print the answers to queries in the order in which the queries are given in the input. Demo Input: ['5\n1 2\n5 1\n2 3\n4 2\n12\n1 1\n2 3\n3 1\n3 2\n3 3\n3 4\n1 2\n2 4\n3 1\n3 3\n3 4\n3 5\n'] Demo Output: ['0\n0\n0\n1\n0\n1\n0\n1\n'] Note: none

```python #include <bits/stdc++.h> #include <ext/pb_ds/assoc_container.hpp> #include <ext/pb_ds/tree_policy.hpp> #define ordered_set tree<ll, null_type,less<ll>, rb_tree_tag,tree_order_statistics_node_update> using namespace std; using namespace __gnu_pbds; typedef long long ll; #define int long long typedef unsigned long long lu; typedef vector<ll> v; typedef vector<vector<ll> > vv; typedef vector<string> vs; typedef vector<pair<ll,ll>> vpr; typedef vector<bool>vb; typedef vector<double>vd; typedef long double ld; #define f(i,n) for(ll i = 0; i < n; i++) #define ff(i,n) for(ll i=1;i<=n;i++) #define pb push_back #define mp make_pair #define endl "\n" #define fi first #define se second #define all(x) x.begin(),x.end() #define rall(x) x.rbegin(),x.rend() #define amax(x,y) if(y>x) x=y; #define amin(x,y) if(y<x)x=y; #define bg(x) x.begin() #define sz(x) (ll)x.size() #define in(x,n) for(ll i=0;i<n;i++)cin>>x[i] #define out(x,n) for(ll i=0;i<n;i++)cout<<x[i]<<" " #define mxt(a) *(max_element(a.begin(),a.end())) #define mnt(a) *(min_element(a.begin(),a.end()) #define tc ll t;cin>>t;while(t--) typedef pair<ll,ll> pi; #define yes cout<<"YES\n"; #define no cout<<"NO\n"; #define yesno(f) if(f) yes else no const v dx = {1, -1, 0, 0}; const v dy = {0, 0, 1, -1}; const ld PI = 2 * acos(0.0); ll cel(ll x1,ll y1){if((x1%y1)==0)return x1/y1;else return x1/y1+1;} ll power(ll a,ll b,ll m) { if(b==0) return 1; ll d=power(a,b/2,m); d=(d*d)%m; if(b&1) d=(d*a)%m; return d; } const ll mod=1e9+7; int MOD(int a) { if(a<0) a+=mod; if(a>=mod) a%=mod; return a; } // set_name.find_by_order(k) It returns to an iterator to the kth element (counting from zero) in the set in O(logn) time // set_name.order_of_key(k) It returns to the number of items that are strictly smaller than our item k in O(logn) time. /*string operations : str.substr (x,y) : returns a substring str[x],str[x+1],...str[x+y-1] str.substr (x) : returns a substring str[x],... end of string str.find(qtr) : returns the first occurenece of qtr in str */ const int N1=500001; int st[N1],szz[N1],parent[N1]; int Time=0; void dfs(int u,int pa,vv &gr) { st[u]=Time++; szz[u]=1; for(auto it:gr[u]) { if(it!=pa) { parent[it]=u; dfs(it,u,gr); szz[u]+=szz[it]; } } } const int N=2e6+1; int seg[N],lazy[N]; void update(int pos,int ss,int se,int l,int f,int val) { if(lazy[pos]!=-1) { seg[pos]=(se-ss+1)*lazy[pos]; if(ss!=se){ lazy[2*pos+1]=lazy[pos]; lazy[2*pos+2]=lazy[pos]; } lazy[pos]=-1; } if(ss > f || se < l || l > f) return ; if(ss >=l && se <=f) { seg[pos]=(se-ss+1)*val; if(ss!=se) { lazy[2*pos+1]=val; lazy[2*pos+2]=val; } return ; } int mid=(ss+se)/2; update(2*pos+1,ss,mid,l,f,val); update(2*pos+2,mid+1,se,l,f,val); seg[pos]=seg[2*pos+1]+seg[2*pos+2]; return ; } int query(int pos,int ss,int se,int l,int f) { if(lazy[pos]!=-1) { seg[pos]=(se-ss+1)*lazy[pos]; if(ss!=se){ lazy[2*pos+1]=lazy[pos]; lazy[2*pos+2]=lazy[pos]; } lazy[pos]=-1; } //normal if(ss > f || se < l) return 0; if(ss >=l && se <=f) return seg[pos]; int mid=(ss+se)/2; return query(2*pos+1,ss,mid,l,f)+query(2*pos+2,mid+1,se,l,f); } bool isempty(int u,int n) { int sum=query(0,0,n-1,st[u],st[u]+szz[u]-1); return (sum!=szz[u]); } void Empty(int u,int n) { update(0,0,n-1,st[u],st[u],0); } int32_t main() { ios::sync_with_stdio(false); cin.tie(nullptr); cout.tie(nullptr); // freopen("input.txt", "r", stdin); // freopen("output.txt", "w", stdout); int n;cin>>n; vv gr(n); for(int i=0;i<n-1;i++) { int a,b;cin>>a>>b; a--; b--; gr[a].pb(b); gr[b].pb(a); } parent[0]=-1; dfs(0,-1,gr); for(int i=0;i<N;i++) { lazy[i]=-1; } int q;cin>>q; while(q--) { int c,u;cin>>c>>u; u--; if(c==1) { if(isempty(u,n)) { if(parent[u]!=-1) { Empty(parent[u],n); } update(0,0,n-1,st[u],st[u]+szz[u]-1,1); } } else if(c==2) { Empty(u,n); } else { cout<<(isempty(u,n)?0:1)<<endl; } } return 0; } ```

-1

489

B

BerSU Ball

PROGRAMMING

1,200

[ "dfs and similar", "dp", "graph matchings", "greedy", "sortings", "two pointers" ]

null

The Berland State University is hosting a ballroom dance in celebration of its 100500-th anniversary! *n* boys and *m* girls are already busy rehearsing waltz, minuet, polonaise and quadrille moves. We know that several boy&girl pairs are going to be invited to the ball. However, the partners' dancing skill in each pair must differ by at most one. For each boy, we know his dancing skills. Similarly, for each girl we know her dancing skills. Write a code that can determine the largest possible number of pairs that can be formed from *n* boys and *m* girls.

The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of boys. The second line contains sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100), where *a**i* is the *i*-th boy's dancing skill. Similarly, the third line contains an integer *m* (1<=≤<=*m*<=≤<=100) — the number of girls. The fourth line contains sequence *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**j*<=≤<=100), where *b**j* is the *j*-th girl's dancing skill.

Print a single number — the required maximum possible number of pairs.

[ "4\n1 4 6 2\n5\n5 1 5 7 9\n", "4\n1 2 3 4\n4\n10 11 12 13\n", "5\n1 1 1 1 1\n3\n1 2 3\n" ]

[ "3\n", "0\n", "2\n" ]

none

1,000

[ { "input": "4\n1 4 6 2\n5\n5 1 5 7 9", "output": "3" }, { "input": "4\n1 2 3 4\n4\n10 11 12 13", "output": "0" }, { "input": "5\n1 1 1 1 1\n3\n1 2 3", "output": "2" }, { "input": "1\n1\n1\n1", "output": "1" }, { "input": "2\n1 10\n1\n9", "output": "1" }, { "input": "4\n4 5 4 4\n5\n5 3 4 2 4", "output": "4" }, { "input": "1\n2\n1\n1", "output": "1" }, { "input": "1\n3\n2\n3 2", "output": "1" }, { "input": "1\n4\n3\n4 4 4", "output": "1" }, { "input": "1\n2\n4\n3 1 4 2", "output": "1" }, { "input": "1\n4\n5\n2 5 5 3 1", "output": "1" }, { "input": "2\n2 2\n1\n2", "output": "1" }, { "input": "2\n4 2\n2\n4 4", "output": "1" }, { "input": "2\n4 1\n3\n2 3 2", "output": "2" }, { "input": "2\n4 3\n4\n5 5 5 6", "output": "1" }, { "input": "2\n5 7\n5\n4 6 7 2 5", "output": "2" }, { "input": "3\n1 2 3\n1\n1", "output": "1" }, { "input": "3\n5 4 5\n2\n2 1", "output": "0" }, { "input": "3\n6 3 4\n3\n4 5 2", "output": "3" }, { "input": "3\n7 7 7\n4\n2 7 2 4", "output": "1" }, { "input": "3\n1 3 3\n5\n1 3 4 1 2", "output": "3" }, { "input": "4\n1 2 1 3\n1\n4", "output": "1" }, { "input": "4\n4 4 6 6\n2\n2 1", "output": "0" }, { "input": "4\n3 1 1 1\n3\n1 6 7", "output": "1" }, { "input": "4\n2 5 1 2\n4\n2 3 3 1", "output": "3" }, { "input": "4\n9 1 7 1\n5\n9 9 9 8 4", "output": "2" }, { "input": "5\n1 6 5 5 6\n1\n2", "output": "1" }, { "input": "5\n5 2 4 5 6\n2\n7 4", "output": "2" }, { "input": "5\n4 1 3 1 4\n3\n6 3 6", "output": "1" }, { "input": "5\n5 2 3 1 4\n4\n1 3 1 7", "output": "3" }, { "input": "5\n9 8 10 9 10\n5\n2 1 5 4 6", "output": "0" }, { "input": "1\n48\n100\n76 90 78 44 29 30 35 85 98 38 27 71 51 100 15 98 78 45 85 26 48 66 98 71 45 85 83 77 92 17 23 95 98 43 11 15 39 53 71 25 74 53 77 41 39 35 66 4 92 44 44 55 35 87 91 6 44 46 57 24 46 82 15 44 81 40 65 17 64 24 42 52 13 12 64 82 26 7 66 85 93 89 58 92 92 77 37 91 47 73 35 69 31 22 60 60 97 21 52 6", "output": "1" }, { "input": "100\n9 90 66 62 60 9 10 97 47 73 26 81 97 60 80 84 19 4 25 77 19 17 91 12 1 27 15 54 18 45 71 79 96 90 51 62 9 13 92 34 7 52 55 8 16 61 96 12 52 38 50 9 60 3 30 3 48 46 77 64 90 35 16 16 21 42 67 70 23 19 90 14 50 96 98 92 82 62 7 51 93 38 84 82 37 78 99 3 20 69 44 96 94 71 3 55 27 86 92 82\n1\n58", "output": "0" }, { "input": "10\n20 87 3 39 20 20 8 40 70 51\n100\n69 84 81 84 35 97 69 68 63 97 85 80 95 58 70 91 100 65 72 80 41 87 87 87 22 49 96 96 78 96 97 56 90 31 62 98 89 74 100 86 95 88 66 54 93 62 41 60 95 79 29 69 63 70 52 63 87 58 54 52 48 57 26 75 39 61 98 78 52 73 99 49 74 50 59 90 31 97 16 85 63 72 81 68 75 59 70 67 73 92 10 88 57 95 3 71 80 95 84 96", "output": "6" }, { "input": "100\n10 10 9 18 56 64 92 66 54 42 66 65 58 5 74 68 80 57 58 30 58 69 70 13 38 19 34 63 38 17 26 24 66 83 48 77 44 37 78 97 13 90 51 56 60 23 49 32 14 86 90 100 13 14 52 69 85 95 81 53 5 3 91 66 2 64 45 59 7 30 80 42 61 82 70 10 62 82 5 34 50 28 24 47 85 68 27 50 24 61 76 17 63 24 3 67 83 76 42 60\n10\n66 74 40 67 28 82 99 57 93 64", "output": "9" }, { "input": "100\n4 1 1 1 3 3 2 5 1 2 1 2 1 1 1 6 1 3 1 1 1 1 2 4 1 1 4 2 2 8 2 2 1 8 2 4 3 3 8 1 3 2 3 2 1 3 8 2 2 3 1 1 2 2 5 1 4 3 1 1 3 1 3 1 7 1 1 1 3 2 1 2 2 3 7 2 1 4 3 2 1 1 3 4 1 1 3 5 1 8 4 1 1 1 3 10 2 2 1 2\n100\n1 1 5 2 13 2 2 3 6 12 1 13 8 1 1 16 1 1 5 6 2 4 6 4 2 7 4 1 7 3 3 9 5 3 1 7 4 1 6 6 8 2 2 5 2 3 16 3 6 3 8 6 1 8 1 2 6 5 3 4 11 3 4 8 2 13 2 5 2 7 3 3 1 8 1 4 4 2 4 7 7 1 5 7 6 3 6 9 1 1 1 3 1 11 5 2 5 11 13 1", "output": "76" }, { "input": "4\n1 6 9 15\n2\n5 8", "output": "2" }, { "input": "2\n2 4\n2\n3 1", "output": "2" }, { "input": "3\n2 3 5\n3\n3 4 6", "output": "3" }, { "input": "3\n1 3 4\n3\n2 1 5", "output": "3" }, { "input": "2\n5 5\n4\n1 1 1 5", "output": "1" }, { "input": "2\n3 2\n2\n3 4", "output": "2" }, { "input": "2\n3 1\n2\n2 4", "output": "2" }, { "input": "2\n2 3\n2\n2 1", "output": "2" }, { "input": "2\n10 12\n2\n11 9", "output": "2" }, { "input": "3\n1 2 3\n3\n3 2 1", "output": "3" }, { "input": "2\n1 3\n2\n2 1", "output": "2" }, { "input": "2\n4 5\n2\n5 3", "output": "2" }, { "input": "2\n7 5\n2\n6 8", "output": "2" }, { "input": "4\n4 3 2 1\n4\n1 2 3 4", "output": "4" }, { "input": "2\n2 3\n2\n3 1", "output": "2" }, { "input": "2\n2 4\n3\n3 1 8", "output": "2" }, { "input": "3\n3 1 1\n3\n2 4 4", "output": "2" }, { "input": "2\n5 3\n2\n4 6", "output": "2" }, { "input": "4\n1 1 3 3\n4\n2 2 1 1", "output": "4" }, { "input": "3\n3 2 1\n3\n2 4 3", "output": "3" }, { "input": "5\n1 2 3 4 5\n5\n2 3 4 5 1", "output": "5" }, { "input": "3\n3 2 1\n3\n1 2 3", "output": "3" }, { "input": "2\n5 4\n2\n4 6", "output": "2" }, { "input": "4\n3 3 5 5\n4\n4 4 2 2", "output": "4" }, { "input": "3\n2 7 5\n3\n2 4 8", "output": "3" }, { "input": "100\n2 3 3 4 2 1 4 4 5 5 2 1 5 2 3 3 5 4 3 2 4 2 3 3 2 2 3 4 2 2 2 3 1 2 3 2 2 3 5 3 3 3 3 4 5 2 2 1 1 1 3 1 2 2 3 5 5 2 5 1 3 4 5 3 5 4 1 1 2 3 4 4 5 3 2 4 5 5 5 2 1 4 2 4 5 4 4 5 5 3 2 5 1 4 4 2 2 2 5 3\n100\n4 5 3 3 2 2 4 3 1 5 4 3 3 2 2 4 5 2 5 2 1 4 3 4 2 3 5 3 4 4 1 2 3 5 2 2 1 5 4 2 4 3 4 3 4 2 3 1 3 3 4 1 1 1 4 4 5 3 1 4 2 3 2 1 3 3 2 3 2 1 1 2 3 2 1 3 3 4 3 3 1 1 3 3 3 1 1 3 5 3 3 3 3 4 4 5 2 5 4 5", "output": "100" }, { "input": "1\n3\n2\n2 3", "output": "1" }, { "input": "2\n5 6\n3\n1 5 100", "output": "1" }, { "input": "2\n2 7\n2\n6 8", "output": "1" }, { "input": "4\n4 10 15 17\n4\n3 12 16 16", "output": "3" }, { "input": "2\n2 3\n2\n1 2", "output": "2" } ]

1,691,258,968

2,147,483,647

Python 3

RUNTIME_ERROR

TESTS

12

31

0

gentelman = int(input()) gentelman_skills = [int(x) for x in input().split()] lady = int(input()) lady_skills = [int(x) for x in input().split()] gentelman_skills.sort() lady_skills.sort() current_lady = 0 total_pairs = 0 for i in range(0,gentelman): if abs(gentelman_skills[i] - lady_skills[current_lady]) <= 1 : total_pairs+=1 current_lady+=1 elif gentelman_skills[i] - lady_skills[current_lady] > 1: while gentelman_skills[i] - lady_skills[current_lady] > 1: current_lady+=1 if abs(gentelman_skills[i] - lady_skills[current_lady]) <= 1: total_pairs+=1 print(total_pairs)

Title: BerSU Ball Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Berland State University is hosting a ballroom dance in celebration of its 100500-th anniversary! *n* boys and *m* girls are already busy rehearsing waltz, minuet, polonaise and quadrille moves. We know that several boy&girl pairs are going to be invited to the ball. However, the partners' dancing skill in each pair must differ by at most one. For each boy, we know his dancing skills. Similarly, for each girl we know her dancing skills. Write a code that can determine the largest possible number of pairs that can be formed from *n* boys and *m* girls. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of boys. The second line contains sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100), where *a**i* is the *i*-th boy's dancing skill. Similarly, the third line contains an integer *m* (1<=≤<=*m*<=≤<=100) — the number of girls. The fourth line contains sequence *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**j*<=≤<=100), where *b**j* is the *j*-th girl's dancing skill. Output Specification: Print a single number — the required maximum possible number of pairs. Demo Input: ['4\n1 4 6 2\n5\n5 1 5 7 9\n', '4\n1 2 3 4\n4\n10 11 12 13\n', '5\n1 1 1 1 1\n3\n1 2 3\n'] Demo Output: ['3\n', '0\n', '2\n'] Note: none

```python gentelman = int(input()) gentelman_skills = [int(x) for x in input().split()] lady = int(input()) lady_skills = [int(x) for x in input().split()] gentelman_skills.sort() lady_skills.sort() current_lady = 0 total_pairs = 0 for i in range(0,gentelman): if abs(gentelman_skills[i] - lady_skills[current_lady]) <= 1 : total_pairs+=1 current_lady+=1 elif gentelman_skills[i] - lady_skills[current_lady] > 1: while gentelman_skills[i] - lady_skills[current_lady] > 1: current_lady+=1 if abs(gentelman_skills[i] - lady_skills[current_lady]) <= 1: total_pairs+=1 print(total_pairs) ```

-1

258

A

Little Elephant and Bits

PROGRAMMING

1,100

[ "greedy", "math" ]

null

The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper. To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes). The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation.

The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits.

In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem.

[ "101\n", "110010\n" ]

[ "11\n", "11010\n" ]

In the first sample the best strategy is to delete the second digit. That results in number 112 = 310. In the second sample the best strategy is to delete the third or fourth digits — that results in number 110102 = 2610.

500

[ { "input": "101", "output": "11" }, { "input": "110010", "output": "11010" }, { "input": "10000", "output": "1000" }, { "input": "1111111110", "output": "111111111" }, { "input": "10100101011110101", "output": "1100101011110101" }, { "input": "111010010111", "output": "11110010111" }, { "input": "11110111011100000000", "output": "1111111011100000000" }, { "input": "11110010010100001110110101110011110110100111101", "output": "1111010010100001110110101110011110110100111101" }, { "input": "1001011111010010100111111", "output": "101011111010010100111111" }, { "input": "1111111111", "output": "111111111" }, { "input": "1111111111111111111100111101001110110111111000001111110101001101001110011000001011001111111000110101", "output": "111111111111111111110111101001110110111111000001111110101001101001110011000001011001111111000110101" }, { "input": "11010110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100", "output": "1110110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100" }, { "input": "11111111111111111111111110110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011", "output": "1111111111111111111111111110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011" }, { "input": "11100010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011", "output": "1110010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011" }, { "input": "11", "output": "1" }, { "input": "111", "output": "11" }, { "input": "111111", "output": "11111" }, { "input": "11111", "output": "1111" }, { "input": "1111", "output": "111" } ]

1,576,425,198

2,147,483,647

PyPy 3

TIME_LIMIT_EXCEEDED

TESTS

16

2,000

5,529,600

i = input().strip() m = int(i[1:],2) ind = 0 for j in range(1,len(i)): a = int(i[:j]+i[j+1:],2) # print(i[:j]+i[j+1:],a) if a>m: m = a ind = j print(i[:ind]+i[ind+1:])

Title: Little Elephant and Bits Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper. To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes). The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation. Input Specification: The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits. Output Specification: In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem. Demo Input: ['101\n', '110010\n'] Demo Output: ['11\n', '11010\n'] Note: In the first sample the best strategy is to delete the second digit. That results in number 112 = 310. In the second sample the best strategy is to delete the third or fourth digits — that results in number 110102 = 2610.

```python i = input().strip() m = int(i[1:],2) ind = 0 for j in range(1,len(i)): a = int(i[:j]+i[j+1:],2) # print(i[:j]+i[j+1:],a) if a>m: m = a ind = j print(i[:ind]+i[ind+1:]) ```

0

899

A

Splitting in Teams

PROGRAMMING

800

[ "constructive algorithms", "greedy", "math" ]

null

There were *n* groups of students which came to write a training contest. A group is either one person who can write the contest with anyone else, or two people who want to write the contest in the same team. The coach decided to form teams of exactly three people for this training. Determine the maximum number of teams of three people he can form. It is possible that he can't use all groups to form teams. For groups of two, either both students should write the contest, or both should not. If two students from a group of two will write the contest, they should be in the same team.

The first line contains single integer *n* (2<=≤<=*n*<=≤<=2·105) — the number of groups. The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2), where *a**i* is the number of people in group *i*.

Print the maximum number of teams of three people the coach can form.

[ "4\n1 1 2 1\n", "2\n2 2\n", "7\n2 2 2 1 1 1 1\n", "3\n1 1 1\n" ]

[ "1\n", "0\n", "3\n", "1\n" ]

In the first example the coach can form one team. For example, he can take students from the first, second and fourth groups. In the second example he can't make a single team. In the third example the coach can form three teams. For example, he can do this in the following way: - The first group (of two people) and the seventh group (of one person), - The second group (of two people) and the sixth group (of one person), - The third group (of two people) and the fourth group (of one person).

500

[ { "input": "4\n1 1 2 1", "output": "1" }, { "input": "2\n2 2", "output": "0" }, { "input": "7\n2 2 2 1 1 1 1", "output": "3" }, { "input": "3\n1 1 1", "output": "1" }, { "input": "3\n2 2 2", "output": "0" }, { "input": "3\n1 2 1", "output": "1" }, { "input": "5\n2 2 1 1 1", "output": "2" }, { "input": "7\n1 1 2 2 1 2 1", "output": "3" }, { "input": "10\n1 2 2 1 2 2 1 2 1 1", "output": "5" }, { "input": "5\n2 2 2 1 2", "output": "1" }, { "input": "43\n1 2 2 2 1 1 2 2 1 1 2 2 2 2 1 2 2 2 2 2 1 2 1 2 1 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2", "output": "10" }, { "input": "72\n1 2 1 2 2 1 2 1 1 1 1 2 2 1 2 1 2 1 2 2 2 2 1 2 2 2 2 1 2 1 1 2 2 1 1 2 2 2 2 2 1 1 1 1 2 2 1 1 2 1 1 1 1 2 2 1 2 2 1 2 1 1 2 1 2 2 1 1 1 2 2 2", "output": "34" }, { "input": "64\n2 2 1 1 1 2 1 1 1 2 2 1 2 2 2 1 2 2 2 1 1 1 1 2 1 2 1 2 1 1 2 2 1 1 2 2 1 1 1 1 2 2 1 1 1 2 1 2 2 2 2 2 2 2 1 1 2 1 1 1 2 2 1 2", "output": "32" }, { "input": "20\n1 1 1 1 2 1 2 2 2 1 2 1 2 1 2 1 1 2 1 2", "output": "9" }, { "input": "23\n1 1 1 1 2 1 2 1 1 1 2 2 2 2 2 2 1 2 1 2 2 1 1", "output": "11" }, { "input": "201\n1 1 2 2 2 2 1 1 1 2 2 1 2 1 2 1 2 2 2 1 1 2 1 1 1 2 1 2 1 1 1 2 1 1 2 1 2 2 1 1 1 1 2 1 1 2 1 1 1 2 2 2 2 1 2 1 2 2 2 2 2 2 1 1 1 2 2 1 1 1 1 2 2 1 2 1 1 2 2 1 1 2 2 2 1 1 1 2 1 1 2 1 2 2 1 2 2 2 2 1 1 1 2 1 2 2 2 2 2 1 2 1 1 1 2 2 2 2 2 1 2 1 1 2 2 2 1 1 2 2 1 2 2 2 1 1 1 2 1 1 1 2 1 1 2 2 2 1 2 1 1 1 2 2 1 1 2 2 2 2 2 2 1 2 2 1 2 2 2 1 1 2 2 1 1 2 1 1 1 1 2 1 1 1 2 2 1 2 1 1 2 2 1 1 2 1 2 1 1 1 2", "output": "100" }, { "input": "247\n2 2 1 2 1 2 2 2 2 2 2 1 1 2 2 1 2 1 1 1 2 1 1 1 1 2 1 1 2 2 1 2 1 1 1 2 2 2 1 1 2 1 1 2 1 1 1 2 1 2 1 2 2 1 1 2 1 2 2 1 2 1 2 1 1 2 1 1 1 2 2 1 1 2 2 1 1 2 1 1 1 2 2 2 2 1 2 2 2 2 2 2 1 2 2 2 2 1 1 1 1 1 1 1 1 1 2 1 2 2 1 2 1 2 2 2 1 2 2 2 1 1 2 2 1 1 1 2 1 1 1 1 2 2 1 2 2 1 1 1 2 1 2 2 1 2 1 1 1 2 2 2 2 2 1 2 2 2 1 1 1 2 1 2 1 1 2 2 2 2 1 1 2 2 2 1 2 2 2 1 2 1 1 2 2 2 2 1 2 2 1 1 1 2 1 2 1 1 1 2 2 1 1 2 1 1 2 1 2 1 1 2 1 1 1 1 2 1 1 1 1 2 2 1 2 1 1 2 1 2 2 1 2 2 2 1 2 2 1 2 2 1 1 1 2 2 2", "output": "123" }, { "input": "4\n2 2 2 2", "output": "0" }, { "input": "4\n1 1 1 1", "output": "1" }, { "input": "2\n1 1", "output": "0" }, { "input": "2\n2 1", "output": "1" }, { "input": "2\n1 2", "output": "1" }, { "input": "3\n1 1 2", "output": "1" }, { "input": "3\n1 2 2", "output": "1" }, { "input": "3\n2 1 1", "output": "1" }, { "input": "3\n2 1 2", "output": "1" }, { "input": "3\n2 2 1", "output": "1" }, { "input": "4\n1 1 1 2", "output": "1" }, { "input": "4\n1 1 2 2", "output": "2" }, { "input": "4\n1 2 2 2", "output": "1" }, { "input": "4\n2 1 1 1", "output": "1" }, { "input": "5\n1 1 1 1 2", "output": "2" }, { "input": "14\n1 2 2 2 2 2 2 2 2 2 2 2 2 2", "output": "1" }, { "input": "38\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1", "output": "1" }, { "input": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1", "output": "1" }, { "input": "20\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1", "output": "1" }, { "input": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2", "output": "1" }, { "input": "6\n1 1 1 2 2 2", "output": "3" }, { "input": "5\n2 1 1 1 1", "output": "2" }, { "input": "9\n1 1 1 1 1 1 2 2 2", "output": "4" }, { "input": "10\n2 2 1 1 1 1 1 1 1 1", "output": "4" }, { "input": "6\n1 1 1 1 1 1", "output": "2" } ]

1,592,749,674

2,147,483,647

PyPy 3

OK

TESTS

67

202

12,288,000

n = int(input()) l = list(map(int, input().split())) ans = 0 o, t = l.count(1), l.count(2) if o == 0: print(ans) elif t == 0: print(o//3) else: ans = min(o, t) o -= ans print(ans + o //3)

Title: Splitting in Teams Time Limit: None seconds Memory Limit: None megabytes Problem Description: There were *n* groups of students which came to write a training contest. A group is either one person who can write the contest with anyone else, or two people who want to write the contest in the same team. The coach decided to form teams of exactly three people for this training. Determine the maximum number of teams of three people he can form. It is possible that he can't use all groups to form teams. For groups of two, either both students should write the contest, or both should not. If two students from a group of two will write the contest, they should be in the same team. Input Specification: The first line contains single integer *n* (2<=≤<=*n*<=≤<=2·105) — the number of groups. The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2), where *a**i* is the number of people in group *i*. Output Specification: Print the maximum number of teams of three people the coach can form. Demo Input: ['4\n1 1 2 1\n', '2\n2 2\n', '7\n2 2 2 1 1 1 1\n', '3\n1 1 1\n'] Demo Output: ['1\n', '0\n', '3\n', '1\n'] Note: In the first example the coach can form one team. For example, he can take students from the first, second and fourth groups. In the second example he can't make a single team. In the third example the coach can form three teams. For example, he can do this in the following way: - The first group (of two people) and the seventh group (of one person), - The second group (of two people) and the sixth group (of one person), - The third group (of two people) and the fourth group (of one person).

```python n = int(input()) l = list(map(int, input().split())) ans = 0 o, t = l.count(1), l.count(2) if o == 0: print(ans) elif t == 0: print(o//3) else: ans = min(o, t) o -= ans print(ans + o //3) ```

3

620

B

Grandfather Dovlet’s calculator

PROGRAMMING

1,000

[ "implementation" ]

null

Once Max found an electronic calculator from his grandfather Dovlet's chest. He noticed that the numbers were written with seven-segment indicators ([https://en.wikipedia.org/wiki/Seven-segment_display](https://en.wikipedia.org/wiki/Seven-segment_display)). Max starts to type all the values from *a* to *b*. After typing each number Max resets the calculator. Find the total number of segments printed on the calculator. For example if *a*<==<=1 and *b*<==<=3 then at first the calculator will print 2 segments, then — 5 segments and at last it will print 5 segments. So the total number of printed segments is 12.

The only line contains two integers *a*,<=*b* (1<=≤<=*a*<=≤<=*b*<=≤<=106) — the first and the last number typed by Max.

Print the only integer *a* — the total number of printed segments.

[ "1 3\n", "10 15\n" ]

[ "12\n", "39\n" ]

none

0

[ { "input": "1 3", "output": "12" }, { "input": "10 15", "output": "39" }, { "input": "1 100", "output": "928" }, { "input": "100 10000", "output": "188446" }, { "input": "213 221442", "output": "5645356" }, { "input": "1 1000000", "output": "28733372" }, { "input": "1000000 1000000", "output": "38" }, { "input": "222145 353252", "output": "3860750" }, { "input": "2 1000000", "output": "28733370" }, { "input": "1 999999", "output": "28733334" }, { "input": "192 200", "output": "122" } ]

1,453,392,647

4,247

Python 3

TIME_LIMIT_EXCEEDED

TESTS

5

1,000

9,523,200

(A,B)=tuple(input().split()) (a,b)=(int(A),int(B)) s='' for i in range(b-a+1): s=s+str(a+i) cal={'0':0,'1':0,'2':0,'3':0,'4':0,'5':0,'6':0,'7':0,'8':0,'9':0} for j in range(len(s)): cal[s[j]]+=1 dct={'0':6,'1':2,'2':5,'3':5,'4':4,'5':5,'6':6,'7':3,'8':7,'9':6} res=0 for k in range(10): g=str(k) res+=cal[g]*dct[g] print(res) #res=0 #for j in range(b-a+1): # for k in range(len(lst[j])): # res+=dct[lst[j][k]] #print(res)

Title: Grandfather Dovlet’s calculator Time Limit: None seconds Memory Limit: None megabytes Problem Description: Once Max found an electronic calculator from his grandfather Dovlet's chest. He noticed that the numbers were written with seven-segment indicators ([https://en.wikipedia.org/wiki/Seven-segment_display](https://en.wikipedia.org/wiki/Seven-segment_display)). Max starts to type all the values from *a* to *b*. After typing each number Max resets the calculator. Find the total number of segments printed on the calculator. For example if *a*<==<=1 and *b*<==<=3 then at first the calculator will print 2 segments, then — 5 segments and at last it will print 5 segments. So the total number of printed segments is 12. Input Specification: The only line contains two integers *a*,<=*b* (1<=≤<=*a*<=≤<=*b*<=≤<=106) — the first and the last number typed by Max. Output Specification: Print the only integer *a* — the total number of printed segments. Demo Input: ['1 3\n', '10 15\n'] Demo Output: ['12\n', '39\n'] Note: none

```python (A,B)=tuple(input().split()) (a,b)=(int(A),int(B)) s='' for i in range(b-a+1): s=s+str(a+i) cal={'0':0,'1':0,'2':0,'3':0,'4':0,'5':0,'6':0,'7':0,'8':0,'9':0} for j in range(len(s)): cal[s[j]]+=1 dct={'0':6,'1':2,'2':5,'3':5,'4':4,'5':5,'6':6,'7':3,'8':7,'9':6} res=0 for k in range(10): g=str(k) res+=cal[g]*dct[g] print(res) #res=0 #for j in range(b-a+1): # for k in range(len(lst[j])): # res+=dct[lst[j][k]] #print(res) ```

0

79

B

Colorful Field

PROGRAMMING

1,400

[ "implementation", "sortings" ]

B. Colorful Field

2

256

Fox Ciel saw a large field while she was on a bus. The field was a *n*<=×<=*m* rectangle divided into 1<=×<=1 cells. Some cells were wasteland, and other each cell contained crop plants: either carrots or kiwis or grapes. After seeing the field carefully, Ciel found that the crop plants of each cell were planted in following procedure: - Assume that the rows are numbered 1 to *n* from top to bottom and the columns are numbered 1 to *m* from left to right, and a cell in row *i* and column *j* is represented as (*i*,<=*j*). - First, each field is either cultivated or waste. Crop plants will be planted in the cultivated cells in the order of (1,<=1)<=→<=...<=→<=(1,<=*m*)<=→<=(2,<=1)<=→<=...<=→<=(2,<=*m*)<=→<=...<=→<=(*n*,<=1)<=→<=...<=→<=(*n*,<=*m*). Waste cells will be ignored. - Crop plants (either carrots or kiwis or grapes) will be planted in each cell one after another cyclically. Carrots will be planted in the first cell, then kiwis in the second one, grapes in the third one, carrots in the forth one, kiwis in the fifth one, and so on. The following figure will show you the example of this procedure. Here, a white square represents a cultivated cell, and a black square represents a waste cell. Now she is wondering how to determine the crop plants in some certain cells.

In the first line there are four positive integers *n*,<=*m*,<=*k*,<=*t* (1<=≤<=*n*<=≤<=4·104,<=1<=≤<=*m*<=≤<=4·104,<=1<=≤<=*k*<=≤<=103,<=1<=≤<=*t*<=≤<=103), each of which represents the height of the field, the width of the field, the number of waste cells and the number of queries that ask the kind of crop plants in a certain cell. Following each *k* lines contains two integers *a*,<=*b* (1<=≤<=*a*<=≤<=*n*,<=1<=≤<=*b*<=≤<=*m*), which denotes a cell (*a*,<=*b*) is waste. It is guaranteed that the same cell will not appear twice in this section. Following each *t* lines contains two integers *i*,<=*j* (1<=≤<=*i*<=≤<=*n*,<=1<=≤<=*j*<=≤<=*m*), which is a query that asks you the kind of crop plants of a cell (*i*,<=*j*).

For each query, if the cell is waste, print Waste. Otherwise, print the name of crop plants in the cell: either Carrots or Kiwis or Grapes.

[ "4 5 5 6\n4 3\n1 3\n3 3\n2 5\n3 2\n1 3\n1 4\n2 3\n2 4\n1 1\n1 1\n" ]

[ "Waste\nGrapes\nCarrots\nKiwis\nCarrots\nCarrots\n" ]

The sample corresponds to the figure in the statement.

1,000

[ { "input": "4 5 5 6\n4 3\n1 3\n3 3\n2 5\n3 2\n1 3\n1 4\n2 3\n2 4\n1 1\n1 1", "output": "Waste\nGrapes\nCarrots\nKiwis\nCarrots\nCarrots" }, { "input": "2 3 2 2\n1 1\n2 2\n2 1\n2 2", "output": "Grapes\nWaste" }, { "input": "31 31 31 4\n4 9\n16 27\n11 29\n8 28\n11 2\n10 7\n22 6\n1 25\n14 8\n9 7\n9 1\n2 3\n5 2\n21 16\n20 19\n23 14\n27 6\n25 21\n14 1\n18 14\n7 2\n19 12\n30 27\n4 27\n24 12\n25 20\n26 22\n21 17\n11 6\n5 28\n28 24\n17 30\n2 5\n30 10\n4 21", "output": "Kiwis\nCarrots\nGrapes\nGrapes" }, { "input": "39898 39898 3 1\n4567 8901\n12345 23456\n24680 35679\n29292 12121", "output": "Grapes" }, { "input": "1 1 1 1\n1 1\n1 1", "output": "Waste" }, { "input": "1 2 1 2\n1 1\n1 2\n1 1", "output": "Carrots\nWaste" }, { "input": "1 6 3 12\n1 2\n1 4\n1 6\n1 1\n1 2\n1 6\n1 2\n1 5\n1 3\n1 4\n1 5\n1 5\n1 4\n1 6\n1 3", "output": "Carrots\nWaste\nWaste\nWaste\nGrapes\nKiwis\nWaste\nGrapes\nGrapes\nWaste\nWaste\nKiwis" }, { "input": "1 10 1 3\n1 5\n1 5\n1 5\n1 5", "output": "Waste\nWaste\nWaste" }, { "input": "5 5 1 3\n2 2\n2 2\n2 2\n2 2", "output": "Waste\nWaste\nWaste" }, { "input": "3 3 3 5\n1 1\n2 2\n3 3\n1 1\n2 2\n2 2\n2 2\n3 3", "output": "Waste\nWaste\nWaste\nWaste\nWaste" }, { "input": "1 10 2 4\n1 9\n1 5\n1 5\n1 6\n1 9\n1 10", "output": "Waste\nKiwis\nWaste\nKiwis" }, { "input": "5 2 2 1\n3 2\n4 2\n5 2", "output": "Kiwis" } ]

1,692,288,837

2,147,483,647

PyPy 3

OK

TESTS

29

372

4,403,200

n , m , k , t = [int(x) for x in input().split()] waste = [] for i in range(k): cords = [int(x) - 1 for x in input().split()] waste.append(cords[1] + m * cords[0]) waste.sort() crops = ["Carrots" , "Kiwis" , "Grapes"] for i in range(t): cords = [int(x) - 1 for x in input().split()] index = cords[1] + m * cords[0] isWaste = False c = 0 for j in waste: if index < j: break elif index == j: isWaste = True break c += 1 if isWaste: print("Waste") else: print(crops[(index - c) % 3])

Title: Colorful Field Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Fox Ciel saw a large field while she was on a bus. The field was a *n*<=×<=*m* rectangle divided into 1<=×<=1 cells. Some cells were wasteland, and other each cell contained crop plants: either carrots or kiwis or grapes. After seeing the field carefully, Ciel found that the crop plants of each cell were planted in following procedure: - Assume that the rows are numbered 1 to *n* from top to bottom and the columns are numbered 1 to *m* from left to right, and a cell in row *i* and column *j* is represented as (*i*,<=*j*). - First, each field is either cultivated or waste. Crop plants will be planted in the cultivated cells in the order of (1,<=1)<=→<=...<=→<=(1,<=*m*)<=→<=(2,<=1)<=→<=...<=→<=(2,<=*m*)<=→<=...<=→<=(*n*,<=1)<=→<=...<=→<=(*n*,<=*m*). Waste cells will be ignored. - Crop plants (either carrots or kiwis or grapes) will be planted in each cell one after another cyclically. Carrots will be planted in the first cell, then kiwis in the second one, grapes in the third one, carrots in the forth one, kiwis in the fifth one, and so on. The following figure will show you the example of this procedure. Here, a white square represents a cultivated cell, and a black square represents a waste cell. Now she is wondering how to determine the crop plants in some certain cells. Input Specification: In the first line there are four positive integers *n*,<=*m*,<=*k*,<=*t* (1<=≤<=*n*<=≤<=4·104,<=1<=≤<=*m*<=≤<=4·104,<=1<=≤<=*k*<=≤<=103,<=1<=≤<=*t*<=≤<=103), each of which represents the height of the field, the width of the field, the number of waste cells and the number of queries that ask the kind of crop plants in a certain cell. Following each *k* lines contains two integers *a*,<=*b* (1<=≤<=*a*<=≤<=*n*,<=1<=≤<=*b*<=≤<=*m*), which denotes a cell (*a*,<=*b*) is waste. It is guaranteed that the same cell will not appear twice in this section. Following each *t* lines contains two integers *i*,<=*j* (1<=≤<=*i*<=≤<=*n*,<=1<=≤<=*j*<=≤<=*m*), which is a query that asks you the kind of crop plants of a cell (*i*,<=*j*). Output Specification: For each query, if the cell is waste, print Waste. Otherwise, print the name of crop plants in the cell: either Carrots or Kiwis or Grapes. Demo Input: ['4 5 5 6\n4 3\n1 3\n3 3\n2 5\n3 2\n1 3\n1 4\n2 3\n2 4\n1 1\n1 1\n'] Demo Output: ['Waste\nGrapes\nCarrots\nKiwis\nCarrots\nCarrots\n'] Note: The sample corresponds to the figure in the statement.

```python n , m , k , t = [int(x) for x in input().split()] waste = [] for i in range(k): cords = [int(x) - 1 for x in input().split()] waste.append(cords[1] + m * cords[0]) waste.sort() crops = ["Carrots" , "Kiwis" , "Grapes"] for i in range(t): cords = [int(x) - 1 for x in input().split()] index = cords[1] + m * cords[0] isWaste = False c = 0 for j in waste: if index < j: break elif index == j: isWaste = True break c += 1 if isWaste: print("Waste") else: print(crops[(index - c) % 3]) ```

3.898798

584

A

Olesya and Rodion

PROGRAMMING

1,000

[ "math" ]

null

Olesya loves numbers consisting of *n* digits, and Rodion only likes numbers that are divisible by *t*. Find some number that satisfies both of them. Your task is: given the *n* and *t* print an integer strictly larger than zero consisting of *n* digits that is divisible by *t*. If such number doesn't exist, print <=-<=1.

The single line contains two numbers, *n* and *t* (1<=≤<=*n*<=≤<=100, 2<=≤<=*t*<=≤<=10) — the length of the number and the number it should be divisible by.

Print one such positive number without leading zeroes, — the answer to the problem, or <=-<=1, if such number doesn't exist. If there are multiple possible answers, you are allowed to print any of them.

[ "3 2\n" ]

[ "712" ]

none

500

[ { "input": "3 2", "output": "222" }, { "input": "2 2", "output": "22" }, { "input": "4 3", "output": "3333" }, { "input": "5 3", "output": "33333" }, { "input": "10 7", "output": "7777777777" }, { "input": "2 9", "output": "99" }, { "input": "18 8", "output": "888888888888888888" }, { "input": "1 5", "output": "5" }, { "input": "1 10", "output": "-1" }, { "input": "100 5", "output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "10 2", "output": "2222222222" }, { "input": "18 10", "output": "111111111111111110" }, { "input": "1 9", "output": "9" }, { "input": "7 6", "output": "6666666" }, { "input": "4 4", "output": "4444" }, { "input": "14 7", "output": "77777777777777" }, { "input": "3 8", "output": "888" }, { "input": "1 3", "output": "3" }, { "input": "2 8", "output": "88" }, { "input": "3 8", "output": "888" }, { "input": "4 3", "output": "3333" }, { "input": "5 9", "output": "99999" }, { "input": "4 8", "output": "8888" }, { "input": "3 4", "output": "444" }, { "input": "9 4", "output": "444444444" }, { "input": "8 10", "output": "11111110" }, { "input": "1 6", "output": "6" }, { "input": "20 3", "output": "33333333333333333333" }, { "input": "15 10", "output": "111111111111110" }, { "input": "31 4", "output": "4444444444444444444444444444444" }, { "input": "18 9", "output": "999999999999999999" }, { "input": "72 4", "output": "444444444444444444444444444444444444444444444444444444444444444444444444" }, { "input": "76 8", "output": "8888888888888888888888888888888888888888888888888888888888888888888888888888" }, { "input": "12 5", "output": "555555555555" }, { "input": "54 5", "output": "555555555555555555555555555555555555555555555555555555" }, { "input": "96 10", "output": "111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "15 9", "output": "999999999999999" }, { "input": "100 2", "output": "2222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222" }, { "input": "99 3", "output": "333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333" }, { "input": "98 4", "output": "44444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444" }, { "input": "97 5", "output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "100 6", "output": "6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666" }, { "input": "99 7", "output": "777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" }, { "input": "98 8", "output": "88888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888" }, { "input": "97 9", "output": "9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999" }, { "input": "100 10", "output": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "3 10", "output": "110" }, { "input": "2 4", "output": "44" }, { "input": "2 10", "output": "10" }, { "input": "10 10", "output": "1111111110" }, { "input": "4 10", "output": "1110" }, { "input": "25 10", "output": "1111111111111111111111110" }, { "input": "50 10", "output": "11111111111111111111111111111111111111111111111110" }, { "input": "5 10", "output": "11110" }, { "input": "99 10", "output": "111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "100 10", "output": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "1 2", "output": "2" }, { "input": "20 10", "output": "11111111111111111110" }, { "input": "99 7", "output": "777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" }, { "input": "89 5", "output": "55555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "6 10", "output": "111110" }, { "input": "3 8", "output": "888" }, { "input": "1 9", "output": "9" }, { "input": "1 4", "output": "4" }, { "input": "100 7", "output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" } ]

1,688,031,580

2,147,483,647

Python 3

WRONG_ANSWER

TESTS

2

31

0

n, t = [int(i) for i in input().split()] num =int('1' + '0' * (n - 1)) flag = True if num % t == 0: print(num) flag = False else: num += num % t while len(str(num)) == n: if num % t == 0: print(num) flag = False else: num += t if flag: print(-1)

Title: Olesya and Rodion Time Limit: None seconds Memory Limit: None megabytes Problem Description: Olesya loves numbers consisting of *n* digits, and Rodion only likes numbers that are divisible by *t*. Find some number that satisfies both of them. Your task is: given the *n* and *t* print an integer strictly larger than zero consisting of *n* digits that is divisible by *t*. If such number doesn't exist, print <=-<=1. Input Specification: The single line contains two numbers, *n* and *t* (1<=≤<=*n*<=≤<=100, 2<=≤<=*t*<=≤<=10) — the length of the number and the number it should be divisible by. Output Specification: Print one such positive number without leading zeroes, — the answer to the problem, or <=-<=1, if such number doesn't exist. If there are multiple possible answers, you are allowed to print any of them. Demo Input: ['3 2\n'] Demo Output: ['712'] Note: none

```python n, t = [int(i) for i in input().split()] num =int('1' + '0' * (n - 1)) flag = True if num % t == 0: print(num) flag = False else: num += num % t while len(str(num)) == n: if num % t == 0: print(num) flag = False else: num += t if flag: print(-1) ```

0

25

A

IQ test

PROGRAMMING

1,300

[ "brute force" ]

A. IQ test

2

256

Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.

The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.

Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.

[ "5\n2 4 7 8 10\n", "4\n1 2 1 1\n" ]

[ "3\n", "2\n" ]

none

0

[ { "input": "5\n2 4 7 8 10", "output": "3" }, { "input": "4\n1 2 1 1", "output": "2" }, { "input": "3\n1 2 2", "output": "1" }, { "input": "3\n100 99 100", "output": "2" }, { "input": "3\n5 3 2", "output": "3" }, { "input": "4\n43 28 1 91", "output": "2" }, { "input": "4\n75 13 94 77", "output": "3" }, { "input": "4\n97 8 27 3", "output": "2" }, { "input": "10\n95 51 12 91 85 3 1 31 25 7", "output": "3" }, { "input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46", "output": "4" }, { "input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36", "output": "26" }, { "input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83", "output": "48" }, { "input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25", "output": "1" }, { "input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46", "output": "25" }, { "input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73", "output": "13" }, { "input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76", "output": "99" }, { "input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14", "output": "1" }, { "input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22", "output": "93" }, { "input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23", "output": "1" }, { "input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98", "output": "1" }, { "input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94", "output": "93" }, { "input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29", "output": "32" }, { "input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47", "output": "26" }, { "input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72", "output": "56" }, { "input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86", "output": "97" }, { "input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42", "output": "79" }, { "input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52", "output": "25" }, { "input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86", "output": "78" }, { "input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68", "output": "70" }, { "input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81", "output": "39" }, { "input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83", "output": "88" }, { "input": "3\n100 100 1", "output": "3" } ]

1,546,752,312

2,147,483,647

Python 3

RUNTIME_ERROR

TESTS

0

186

0

even = 0 odd = 0 i = 0 j = 0 k = 0 n = (int)(input()) listnotarray = [] while len(listnotarray) < n: a = (int)(input()) listnotarray.append(a) for x in listnotarray: i += 1 if(x %2 == 0): even += 1 j = i else: odd += 1 k = i if(odd<even): print(k) else: print(j)

Title: IQ test Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness. Input Specification: The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness. Output Specification: Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order. Demo Input: ['5\n2 4 7 8 10\n', '4\n1 2 1 1\n'] Demo Output: ['3\n', '2\n'] Note: none

```python even = 0 odd = 0 i = 0 j = 0 k = 0 n = (int)(input()) listnotarray = [] while len(listnotarray) < n: a = (int)(input()) listnotarray.append(a) for x in listnotarray: i += 1 if(x %2 == 0): even += 1 j = i else: odd += 1 k = i if(odd<even): print(k) else: print(j) ```

-1

519

B

A and B and Compilation Errors

PROGRAMMING

1,100

[ "data structures", "implementation", "sortings" ]

null

A and B are preparing themselves for programming contests. B loves to debug his code. But before he runs the solution and starts debugging, he has to first compile the code. Initially, the compiler displayed *n* compilation errors, each of them is represented as a positive integer. After some effort, B managed to fix some mistake and then another one mistake. However, despite the fact that B is sure that he corrected the two errors, he can not understand exactly what compilation errors disappeared — the compiler of the language which B uses shows errors in the new order every time! B is sure that unlike many other programming languages, compilation errors for his programming language do not depend on each other, that is, if you correct one error, the set of other error does not change. Can you help B find out exactly what two errors he corrected?

The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=105) — the initial number of compilation errors. The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the errors the compiler displayed for the first time. The third line contains *n*<=-<=1 space-separated integers *b*1,<=*b*2,<=...,<=*b**n*<=-<=1 — the errors displayed at the second compilation. It is guaranteed that the sequence in the third line contains all numbers of the second string except for exactly one. The fourth line contains *n*<=-<=2 space-separated integers *с*1,<=*с*2,<=...,<=*с**n*<=-<=2 — the errors displayed at the third compilation. It is guaranteed that the sequence in the fourth line contains all numbers of the third line except for exactly one.

Print two numbers on a single line: the numbers of the compilation errors that disappeared after B made the first and the second correction, respectively.

[ "5\n1 5 8 123 7\n123 7 5 1\n5 1 7\n", "6\n1 4 3 3 5 7\n3 7 5 4 3\n4 3 7 5\n" ]

[ "8\n123\n", "1\n3\n" ]

In the first test sample B first corrects the error number 8, then the error number 123. In the second test sample B first corrects the error number 1, then the error number 3. Note that if there are multiple errors with the same number, B can correct only one of them in one step.

1,000

[ { "input": "5\n1 5 8 123 7\n123 7 5 1\n5 1 7", "output": "8\n123" }, { "input": "6\n1 4 3 3 5 7\n3 7 5 4 3\n4 3 7 5", "output": "1\n3" }, { "input": "3\n1 2 3\n3 2\n2", "output": "1\n3" }, { "input": "10\n460626451 802090732 277246428 661369649 388684428 784303821 376287098 656422756 9301599 25720377\n277246428 388684428 661369649 460626451 656422756 802090732 9301599 784303821 376287098\n376287098 802090732 388684428 9301599 656422756 784303821 460626451 277246428", "output": "25720377\n661369649" }, { "input": "3\n796067435 964699482 819602309\n964699482 796067435\n964699482", "output": "819602309\n796067435" }, { "input": "3\n374054998 726316780 902899520\n902899520 726316780\n726316780", "output": "374054998\n902899520" }, { "input": "3\n168638990 939116221 323703261\n168638990 323703261\n168638990", "output": "939116221\n323703261" }, { "input": "3\n77 77 77\n77 77\n77", "output": "77\n77" }, { "input": "3\n84 30 9\n9 84\n9", "output": "30\n84" }, { "input": "6\n5 4 3 3 5 5\n3 5 5 4 3\n3 5 4 3", "output": "5\n5" }, { "input": "4\n1 5 7 8\n1 5 7\n1 5", "output": "8\n7" } ]

1,660,642,310

2,147,483,647

Python 3

OK

TESTS

33

295

14,950,400

n = int(input()) a = sorted([int(i) for i in input().split()]) b = sorted([int(i) for i in input().split()]) c = sorted([int(i) for i in input().split()]) x = a[-1] y = b[-1] for i in range(len(b)): if a[i] != b[i]: x = a[i] break for i in range(len(c)): if b[i] != c[i]: y = b[i] break print(x) print(y)

Title: A and B and Compilation Errors Time Limit: None seconds Memory Limit: None megabytes Problem Description: A and B are preparing themselves for programming contests. B loves to debug his code. But before he runs the solution and starts debugging, he has to first compile the code. Initially, the compiler displayed *n* compilation errors, each of them is represented as a positive integer. After some effort, B managed to fix some mistake and then another one mistake. However, despite the fact that B is sure that he corrected the two errors, he can not understand exactly what compilation errors disappeared — the compiler of the language which B uses shows errors in the new order every time! B is sure that unlike many other programming languages, compilation errors for his programming language do not depend on each other, that is, if you correct one error, the set of other error does not change. Can you help B find out exactly what two errors he corrected? Input Specification: The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=105) — the initial number of compilation errors. The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the errors the compiler displayed for the first time. The third line contains *n*<=-<=1 space-separated integers *b*1,<=*b*2,<=...,<=*b**n*<=-<=1 — the errors displayed at the second compilation. It is guaranteed that the sequence in the third line contains all numbers of the second string except for exactly one. The fourth line contains *n*<=-<=2 space-separated integers *с*1,<=*с*2,<=...,<=*с**n*<=-<=2 — the errors displayed at the third compilation. It is guaranteed that the sequence in the fourth line contains all numbers of the third line except for exactly one. Output Specification: Print two numbers on a single line: the numbers of the compilation errors that disappeared after B made the first and the second correction, respectively. Demo Input: ['5\n1 5 8 123 7\n123 7 5 1\n5 1 7\n', '6\n1 4 3 3 5 7\n3 7 5 4 3\n4 3 7 5\n'] Demo Output: ['8\n123\n', '1\n3\n'] Note: In the first test sample B first corrects the error number 8, then the error number 123. In the second test sample B first corrects the error number 1, then the error number 3. Note that if there are multiple errors with the same number, B can correct only one of them in one step.

```python n = int(input()) a = sorted([int(i) for i in input().split()]) b = sorted([int(i) for i in input().split()]) c = sorted([int(i) for i in input().split()]) x = a[-1] y = b[-1] for i in range(len(b)): if a[i] != b[i]: x = a[i] break for i in range(len(c)): if b[i] != c[i]: y = b[i] break print(x) print(y) ```

3

43

A

Football

PROGRAMMING

1,000

[ "strings" ]

A. Football

2

256

One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.

The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.

Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.

[ "1\nABC\n", "5\nA\nABA\nABA\nA\nA\n" ]

[ "ABC\n", "A\n" ]

none

500

[ { "input": "1\nABC", "output": "ABC" }, { "input": "5\nA\nABA\nABA\nA\nA", "output": "A" }, { "input": "2\nXTSJEP\nXTSJEP", "output": "XTSJEP" }, { "input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ", "output": "XZYDJAEDZ" }, { "input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD", "output": "QCCYXL" }, { "input": "3\nAZID\nEERWBC\nEERWBC", "output": "EERWBC" }, { "input": "3\nHNCGYL\nHNCGYL\nHNCGYL", "output": "HNCGYL" }, { "input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG", "output": "ZZWZTG" }, { "input": "4\nA\nA\nKUDLJMXCSE\nA", "output": "A" }, { "input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW", "output": "PHBTW" }, { "input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN", "output": "PKUZYTFYWN" }, { "input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH", "output": "HH" }, { "input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW", "output": "W" }, { "input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP", "output": "XBCP" }, { "input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS", "output": "PYPAS" }, { "input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC", "output": "NC" }, { "input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI", "output": "VOCI" }, { "input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA", "output": "HA" }, { "input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS", "output": "G" }, { "input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL", "output": "WL" } ]

1,617,314,323

2,147,483,647

PyPy 3

OK

TESTS

34

248

307,200

from collections import Counter def solve(): n = int(input()) a = [] for _ in range(n): a.append(input()) c = Counter(a) print(c.most_common()[0][0]) # t = int(input()) # while t: # t -= 1 solve()

Title: Football Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams. Output Specification: Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner. Demo Input: ['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n'] Demo Output: ['ABC\n', 'A\n'] Note: none

```python from collections import Counter def solve(): n = int(input()) a = [] for _ in range(n): a.append(input()) c = Counter(a) print(c.most_common()[0][0]) # t = int(input()) # while t: # t -= 1 solve() ```

3.937428

405

A

Gravity Flip

PROGRAMMING

900

[ "greedy", "implementation", "sortings" ]

null

Little Chris is bored during his physics lessons (too easy), so he has built a toy box to keep himself occupied. The box is special, since it has the ability to change gravity. There are *n* columns of toy cubes in the box arranged in a line. The *i*-th column contains *a**i* cubes. At first, the gravity in the box is pulling the cubes downwards. When Chris switches the gravity, it begins to pull all the cubes to the right side of the box. The figure shows the initial and final configurations of the cubes in the box: the cubes that have changed their position are highlighted with orange. Given the initial configuration of the toy cubes in the box, find the amounts of cubes in each of the *n* columns after the gravity switch!

The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=100), the number of the columns in the box. The next line contains *n* space-separated integer numbers. The *i*-th number *a**i* (1<=≤<=*a**i*<=≤<=100) denotes the number of cubes in the *i*-th column.

Output *n* integer numbers separated by spaces, where the *i*-th number is the amount of cubes in the *i*-th column after the gravity switch.

[ "4\n3 2 1 2\n", "3\n2 3 8\n" ]

[ "1 2 2 3 \n", "2 3 8 \n" ]

The first example case is shown on the figure. The top cube of the first column falls to the top of the last column; the top cube of the second column falls to the top of the third column; the middle cube of the first column falls to the top of the second column. In the second example case the gravity switch does not change the heights of the columns.

500

[ { "input": "4\n3 2 1 2", "output": "1 2 2 3 " }, { "input": "3\n2 3 8", "output": "2 3 8 " }, { "input": "5\n2 1 2 1 2", "output": "1 1 2 2 2 " }, { "input": "1\n1", "output": "1 " }, { "input": "2\n4 3", "output": "3 4 " }, { "input": "6\n100 40 60 20 1 80", "output": "1 20 40 60 80 100 " }, { "input": "10\n10 8 6 7 5 3 4 2 9 1", "output": "1 2 3 4 5 6 7 8 9 10 " }, { "input": "10\n1 2 3 4 5 6 7 8 9 10", "output": "1 2 3 4 5 6 7 8 9 10 " }, { "input": "100\n82 51 81 14 37 17 78 92 64 15 8 86 89 8 87 77 66 10 15 12 100 25 92 47 21 78 20 63 13 49 41 36 41 79 16 87 87 69 3 76 80 60 100 49 70 59 72 8 38 71 45 97 71 14 76 54 81 4 59 46 39 29 92 3 49 22 53 99 59 52 74 31 92 43 42 23 44 9 82 47 7 40 12 9 3 55 37 85 46 22 84 52 98 41 21 77 63 17 62 91", "output": "3 3 3 4 7 8 8 8 9 9 10 12 12 13 14 14 15 15 16 17 17 20 21 21 22 22 23 25 29 31 36 37 37 38 39 40 41 41 41 42 43 44 45 46 46 47 47 49 49 49 51 52 52 53 54 55 59 59 59 60 62 63 63 64 66 69 70 71 71 72 74 76 76 77 77 78 78 79 80 81 81 82 82 84 85 86 87 87 87 89 91 92 92 92 92 97 98 99 100 100 " }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 " }, { "input": "10\n1 9 7 6 2 4 7 8 1 3", "output": "1 1 2 3 4 6 7 7 8 9 " }, { "input": "20\n53 32 64 20 41 97 50 20 66 68 22 60 74 61 97 54 80 30 72 59", "output": "20 20 22 30 32 41 50 53 54 59 60 61 64 66 68 72 74 80 97 97 " }, { "input": "30\n7 17 4 18 16 12 14 10 1 13 2 16 13 17 8 16 13 14 9 17 17 5 13 5 1 7 6 20 18 12", "output": "1 1 2 4 5 5 6 7 7 8 9 10 12 12 13 13 13 13 14 14 16 16 16 17 17 17 17 18 18 20 " }, { "input": "40\n22 58 68 58 48 53 52 1 16 78 75 17 63 15 36 32 78 75 49 14 42 46 66 54 49 82 40 43 46 55 12 73 5 45 61 60 1 11 31 84", "output": "1 1 5 11 12 14 15 16 17 22 31 32 36 40 42 43 45 46 46 48 49 49 52 53 54 55 58 58 60 61 63 66 68 73 75 75 78 78 82 84 " }, { "input": "70\n1 3 3 1 3 3 1 1 1 3 3 2 3 3 1 1 1 2 3 1 3 2 3 3 3 2 2 3 1 3 3 2 1 1 2 1 2 1 2 2 1 1 1 3 3 2 3 2 3 2 3 3 2 2 2 3 2 3 3 3 1 1 3 3 1 1 1 1 3 1", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 " }, { "input": "90\n17 75 51 30 100 5 50 95 51 73 66 5 7 76 43 49 23 55 3 24 95 79 10 11 44 93 17 99 53 66 82 66 63 76 19 4 51 71 75 43 27 5 24 19 48 7 91 15 55 21 7 6 27 10 2 91 64 58 18 21 16 71 90 88 21 20 6 6 95 85 11 7 40 65 52 49 92 98 46 88 17 48 85 96 77 46 100 34 67 52", "output": "2 3 4 5 5 5 6 6 6 7 7 7 7 10 10 11 11 15 16 17 17 17 18 19 19 20 21 21 21 23 24 24 27 27 30 34 40 43 43 44 46 46 48 48 49 49 50 51 51 51 52 52 53 55 55 58 63 64 65 66 66 66 67 71 71 73 75 75 76 76 77 79 82 85 85 88 88 90 91 91 92 93 95 95 95 96 98 99 100 100 " }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 " }, { "input": "100\n1 1 1 1 2 1 1 1 1 1 2 2 1 1 2 1 2 1 1 1 2 1 1 2 1 2 1 1 2 2 2 1 1 2 1 1 1 2 2 2 1 1 1 2 1 2 2 1 2 1 1 2 2 1 2 1 2 1 2 2 1 1 1 2 1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 1 1 1 1 2 2 2 2 2 2 2 1 1 1 2 1 2 1", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 " }, { "input": "100\n2 1 1 1 3 2 3 3 2 3 3 1 3 3 1 3 3 1 1 1 2 3 1 2 3 1 2 3 3 1 3 1 1 2 3 2 3 3 2 3 3 1 2 2 1 2 3 2 3 2 2 1 1 3 1 3 2 1 3 1 3 1 3 1 1 3 3 3 2 3 2 2 2 2 1 3 3 3 1 2 1 2 3 2 1 3 1 3 2 1 3 1 2 1 2 3 1 3 2 3", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 " }, { "input": "100\n7 4 5 5 10 10 5 8 5 7 4 5 4 6 8 8 2 6 3 3 10 7 10 8 6 2 7 3 9 7 7 2 4 5 2 4 9 5 10 1 10 5 10 4 1 3 4 2 6 9 9 9 10 6 2 5 6 1 8 10 4 10 3 4 10 5 5 4 10 4 5 3 7 10 2 7 3 6 9 6 1 6 5 5 4 6 6 4 4 1 5 1 6 6 6 8 8 6 2 6", "output": "1 1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7 7 7 7 7 7 8 8 8 8 8 8 8 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 10 10 10 10 " }, { "input": "100\n12 10 5 11 13 12 14 13 7 15 15 12 13 19 12 18 14 10 10 3 1 10 16 11 19 8 10 15 5 10 12 16 11 13 11 15 14 12 16 8 11 8 15 2 18 2 14 13 15 20 8 8 4 12 14 7 10 3 9 1 7 19 6 7 2 14 8 20 7 17 18 20 3 18 18 9 6 10 4 1 4 19 9 13 3 3 12 11 11 20 8 2 13 6 7 12 1 4 17 3", "output": "1 1 1 1 2 2 2 2 3 3 3 3 3 3 4 4 4 4 5 5 6 6 6 7 7 7 7 7 7 8 8 8 8 8 8 8 9 9 9 10 10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 12 12 12 13 13 13 13 13 13 13 14 14 14 14 14 14 15 15 15 15 15 15 16 16 16 17 17 18 18 18 18 18 19 19 19 19 20 20 20 20 " }, { "input": "100\n5 13 1 40 30 10 23 32 33 12 6 4 15 29 31 17 23 5 36 31 32 38 24 11 34 39 19 21 6 19 31 35 1 15 6 29 22 15 17 15 1 17 2 34 20 8 27 2 29 26 13 9 22 27 27 3 20 40 4 40 33 29 36 30 35 16 19 28 26 11 36 24 29 5 40 10 38 34 33 23 34 39 31 7 10 31 22 6 36 24 14 31 34 23 2 4 26 16 2 32", "output": "1 1 1 2 2 2 2 3 4 4 4 5 5 5 6 6 6 6 7 8 9 10 10 10 11 11 12 13 13 14 15 15 15 15 16 16 17 17 17 19 19 19 20 20 21 22 22 22 23 23 23 23 24 24 24 26 26 26 27 27 27 28 29 29 29 29 29 30 30 31 31 31 31 31 31 32 32 32 33 33 33 34 34 34 34 34 35 35 36 36 36 36 38 38 39 39 40 40 40 40 " }, { "input": "100\n72 44 34 74 9 60 26 37 55 77 74 69 28 66 54 55 8 36 57 31 31 48 32 66 40 70 77 43 64 28 37 10 21 58 51 32 60 28 51 52 28 35 7 33 1 68 38 70 57 71 8 20 42 57 59 4 58 10 17 47 22 48 16 3 76 67 32 37 64 47 33 41 75 69 2 76 39 9 27 75 20 21 52 25 71 21 11 29 38 10 3 1 45 55 63 36 27 7 59 41", "output": "1 1 2 3 3 4 7 7 8 8 9 9 10 10 10 11 16 17 20 20 21 21 21 22 25 26 27 27 28 28 28 28 29 31 31 32 32 32 33 33 34 35 36 36 37 37 37 38 38 39 40 41 41 42 43 44 45 47 47 48 48 51 51 52 52 54 55 55 55 57 57 57 58 58 59 59 60 60 63 64 64 66 66 67 68 69 69 70 70 71 71 72 74 74 75 75 76 76 77 77 " }, { "input": "100\n75 18 61 10 56 53 42 57 79 80 31 2 50 45 54 99 84 52 71 21 86 3 19 98 14 37 40 62 63 68 5 10 87 8 81 85 52 52 57 94 2 7 56 96 19 76 1 13 81 6 80 47 22 59 99 32 9 5 36 88 98 91 70 70 12 93 12 22 85 1 97 48 94 16 84 84 51 34 62 7 68 51 30 2 37 82 4 7 27 1 80 9 61 16 59 55 12 96 94 82", "output": "1 1 1 2 2 2 3 4 5 5 6 7 7 7 8 9 9 10 10 12 12 12 13 14 16 16 18 19 19 21 22 22 27 30 31 32 34 36 37 37 40 42 45 47 48 50 51 51 52 52 52 53 54 55 56 56 57 57 59 59 61 61 62 62 63 68 68 70 70 71 75 76 79 80 80 80 81 81 82 82 84 84 84 85 85 86 87 88 91 93 94 94 94 96 96 97 98 98 99 99 " }, { "input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 " }, { "input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 " }, { "input": "100\n50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50", "output": "50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 " }, { "input": "49\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97", "output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 " }, { "input": "30\n1 4 7 10 13 16 19 22 25 28 31 34 37 40 43 46 49 52 55 58 61 64 67 70 73 76 79 82 85 88", "output": "1 4 7 10 13 16 19 22 25 28 31 34 37 40 43 46 49 52 55 58 61 64 67 70 73 76 79 82 85 88 " }, { "input": "100\n100 51 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 51 100 " }, { "input": "10\n100 90 80 70 60 50 40 30 20 10", "output": "10 20 30 40 50 60 70 80 90 100 " }, { "input": "1\n10", "output": "10 " } ]

1,696,861,845

2,147,483,647

Python 3

OK

TESTS

32

46

0

n = int(input()) if n >= 1 and n <= 100: ls = list(map(int,input().split()))[:n] ls.sort() print(*ls) #Gravity

Title: Gravity Flip Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Chris is bored during his physics lessons (too easy), so he has built a toy box to keep himself occupied. The box is special, since it has the ability to change gravity. There are *n* columns of toy cubes in the box arranged in a line. The *i*-th column contains *a**i* cubes. At first, the gravity in the box is pulling the cubes downwards. When Chris switches the gravity, it begins to pull all the cubes to the right side of the box. The figure shows the initial and final configurations of the cubes in the box: the cubes that have changed their position are highlighted with orange. Given the initial configuration of the toy cubes in the box, find the amounts of cubes in each of the *n* columns after the gravity switch! Input Specification: The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=100), the number of the columns in the box. The next line contains *n* space-separated integer numbers. The *i*-th number *a**i* (1<=≤<=*a**i*<=≤<=100) denotes the number of cubes in the *i*-th column. Output Specification: Output *n* integer numbers separated by spaces, where the *i*-th number is the amount of cubes in the *i*-th column after the gravity switch. Demo Input: ['4\n3 2 1 2\n', '3\n2 3 8\n'] Demo Output: ['1 2 2 3 \n', '2 3 8 \n'] Note: The first example case is shown on the figure. The top cube of the first column falls to the top of the last column; the top cube of the second column falls to the top of the third column; the middle cube of the first column falls to the top of the second column. In the second example case the gravity switch does not change the heights of the columns.

```python n = int(input()) if n >= 1 and n <= 100: ls = list(map(int,input().split()))[:n] ls.sort() print(*ls) #Gravity ```

3

939

A

Love Triangle

PROGRAMMING

800

[ "graphs" ]

null

As you could know there are no male planes nor female planes. However, each plane on Earth likes some other plane. There are *n* planes on Earth, numbered from 1 to *n*, and the plane with number *i* likes the plane with number *f**i*, where 1<=≤<=*f**i*<=≤<=*n* and *f**i*<=≠<=*i*. We call a love triangle a situation in which plane *A* likes plane *B*, plane *B* likes plane *C* and plane *C* likes plane *A*. Find out if there is any love triangle on Earth.

The first line contains a single integer *n* (2<=≤<=*n*<=≤<=5000) — the number of planes. The second line contains *n* integers *f*1,<=*f*2,<=...,<=*f**n* (1<=≤<=*f**i*<=≤<=*n*, *f**i*<=≠<=*i*), meaning that the *i*-th plane likes the *f**i*-th.

Output «YES» if there is a love triangle consisting of planes on Earth. Otherwise, output «NO». You can output any letter in lower case or in upper case.

[ "5\n2 4 5 1 3\n", "5\n5 5 5 5 1\n" ]

[ "YES\n", "NO\n" ]

In first example plane 2 likes plane 4, plane 4 likes plane 1, plane 1 likes plane 2 and that is a love triangle. In second example there are no love triangles.

500

[ { "input": "5\n2 4 5 1 3", "output": "YES" }, { "input": "5\n5 5 5 5 1", "output": "NO" }, { "input": "3\n3 1 2", "output": "YES" }, { "input": "10\n4 10 9 5 3 1 5 10 6 4", "output": "NO" }, { "input": "10\n5 5 4 9 10 9 9 5 3 1", "output": "YES" }, { "input": "100\n50 40 60 87 39 58 44 84 46 68 16 57 77 87 92 95 42 31 74 15 36 84 30 3 47 15 87 90 76 66 6 63 74 19 40 49 6 84 41 9 77 34 7 12 11 73 58 24 81 14 81 29 65 100 1 85 64 32 38 4 54 67 32 81 80 7 100 71 29 80 4 52 47 7 78 56 52 75 81 37 16 41 27 28 58 60 62 47 29 40 37 14 59 91 12 54 25 58 12 43", "output": "NO" }, { "input": "100\n25 6 46 37 87 99 70 31 46 12 94 40 87 56 28 8 94 39 13 12 67 13 71 39 83 48 40 14 62 41 16 71 20 41 83 41 68 98 23 82 62 83 62 35 49 22 31 21 66 98 54 39 34 52 11 28 47 89 25 44 68 36 91 46 82 86 88 48 27 93 7 9 53 36 16 100 84 84 44 25 58 66 16 46 72 21 91 78 4 17 44 17 47 67 93 89 75 44 56 50", "output": "YES" }, { "input": "2\n2 1", "output": "NO" }, { "input": "3\n2 3 1", "output": "YES" }, { "input": "5\n2 1 4 5 3", "output": "YES" }, { "input": "5\n5 4 5 5 2", "output": "YES" } ]

1,689,512,189

2,147,483,647

PyPy 3

OK

TESTS

16

92

1,740,800

n=int(input()) arr=list(map(int,input().split(' ')[:n])) if n<3: print("NO") else: for i in range(n): if arr[arr[arr[i-1]-1]-1]==i: print("YES") exit() print("NO")

Title: Love Triangle Time Limit: None seconds Memory Limit: None megabytes Problem Description: As you could know there are no male planes nor female planes. However, each plane on Earth likes some other plane. There are *n* planes on Earth, numbered from 1 to *n*, and the plane with number *i* likes the plane with number *f**i*, where 1<=≤<=*f**i*<=≤<=*n* and *f**i*<=≠<=*i*. We call a love triangle a situation in which plane *A* likes plane *B*, plane *B* likes plane *C* and plane *C* likes plane *A*. Find out if there is any love triangle on Earth. Input Specification: The first line contains a single integer *n* (2<=≤<=*n*<=≤<=5000) — the number of planes. The second line contains *n* integers *f*1,<=*f*2,<=...,<=*f**n* (1<=≤<=*f**i*<=≤<=*n*, *f**i*<=≠<=*i*), meaning that the *i*-th plane likes the *f**i*-th. Output Specification: Output «YES» if there is a love triangle consisting of planes on Earth. Otherwise, output «NO». You can output any letter in lower case or in upper case. Demo Input: ['5\n2 4 5 1 3\n', '5\n5 5 5 5 1\n'] Demo Output: ['YES\n', 'NO\n'] Note: In first example plane 2 likes plane 4, plane 4 likes plane 1, plane 1 likes plane 2 and that is a love triangle. In second example there are no love triangles.

```python n=int(input()) arr=list(map(int,input().split(' ')[:n])) if n<3: print("NO") else: for i in range(n): if arr[arr[arr[i-1]-1]-1]==i: print("YES") exit() print("NO") ```

3

702

A

Maximum Increase

PROGRAMMING

800

[ "dp", "greedy", "implementation" ]

null

You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array. A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous.

The first line contains single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers. The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).

Print the maximum length of an increasing subarray of the given array.

[ "5\n1 7 2 11 15\n", "6\n100 100 100 100 100 100\n", "3\n1 2 3\n" ]

[ "3\n", "1\n", "3\n" ]

none

0

[ { "input": "5\n1 7 2 11 15", "output": "3" }, { "input": "6\n100 100 100 100 100 100", "output": "1" }, { "input": "3\n1 2 3", "output": "3" }, { "input": "1\n1000000000", "output": "1" }, { "input": "10\n802030518 598196518 640274071 983359971 71550121 96204862 799843967 446173607 796619138 402690754", "output": "3" }, { "input": "2\n2 1", "output": "1" }, { "input": "5\n1 2 3 3 4", "output": "3" }, { "input": "4\n1 2 2 3", "output": "2" }, { "input": "3\n2 1 1", "output": "1" }, { "input": "3\n1 2 1", "output": "2" }, { "input": "1\n1", "output": "1" }, { "input": "2\n1 2", "output": "2" }, { "input": "3\n1 1 2", "output": "2" }, { "input": "11\n1 2 3 1 2 3 2 1 2 3 4", "output": "4" }, { "input": "9\n1 2 3 4 5 6 7 8 9", "output": "9" }, { "input": "9\n1 1 1 1 1 1 1 1 1", "output": "1" }, { "input": "3\n3 2 1", "output": "1" }, { "input": "7\n1 2 3 4 5 6 7", "output": "7" }, { "input": "1\n1234394", "output": "1" } ]

1,662,220,460

2,147,483,647

PyPy 3-64

WRONG_ANSWER

TESTS

4

61

0

# https://codeforces.com/problemset/problem/702/A n = int(input()) #length of array nums = [int(num) for num in input().split()] sub_array = [] while True: if n != 0 and nums.count(nums[0]) == len(nums): print(1) break for num in nums: if len(sub_array) == 0: sub_array.append(num) if num > sub_array[-1]: sub_array.append(num) else: sub_array = [] sub_array.append(num) print(len(sub_array)) break

Title: Maximum Increase Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array. A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous. Input Specification: The first line contains single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers. The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109). Output Specification: Print the maximum length of an increasing subarray of the given array. Demo Input: ['5\n1 7 2 11 15\n', '6\n100 100 100 100 100 100\n', '3\n1 2 3\n'] Demo Output: ['3\n', '1\n', '3\n'] Note: none

```python # https://codeforces.com/problemset/problem/702/A n = int(input()) #length of array nums = [int(num) for num in input().split()] sub_array = [] while True: if n != 0 and nums.count(nums[0]) == len(nums): print(1) break for num in nums: if len(sub_array) == 0: sub_array.append(num) if num > sub_array[-1]: sub_array.append(num) else: sub_array = [] sub_array.append(num) print(len(sub_array)) break ```

0

910

A

The Way to Home

PROGRAMMING

800

[ "dfs and similar", "dp", "greedy", "implementation" ]

null

A frog lives on the axis *Ox* and needs to reach home which is in the point *n*. She starts from the point 1. The frog can jump to the right at a distance not more than *d*. So, after she jumped from the point *x* she can reach the point *x*<=+<=*a*, where *a* is an integer from 1 to *d*. For each point from 1 to *n* is known if there is a lily flower in it. The frog can jump only in points with a lilies. Guaranteed that there are lilies in the points 1 and *n*. Determine the minimal number of jumps that the frog needs to reach home which is in the point *n* from the point 1. Consider that initially the frog is in the point 1. If the frog can not reach home, print -1.

The first line contains two integers *n* and *d* (2<=≤<=*n*<=≤<=100, 1<=≤<=*d*<=≤<=*n*<=-<=1) — the point, which the frog wants to reach, and the maximal length of the frog jump. The second line contains a string *s* of length *n*, consisting of zeros and ones. If a character of the string *s* equals to zero, then in the corresponding point there is no lily flower. In the other case, in the corresponding point there is a lily flower. Guaranteed that the first and the last characters of the string *s* equal to one.

If the frog can not reach the home, print -1. In the other case, print the minimal number of jumps that the frog needs to reach the home which is in the point *n* from the point 1.

[ "8 4\n10010101\n", "4 2\n1001\n", "8 4\n11100101\n", "12 3\n101111100101\n" ]

[ "2\n", "-1\n", "3\n", "4\n" ]

In the first example the from can reach home in two jumps: the first jump from the point 1 to the point 4 (the length of the jump is three), and the second jump from the point 4 to the point 8 (the length of the jump is four). In the second example the frog can not reach home, because to make it she need to jump on a distance three, but the maximum length of her jump equals to two.

500

[ { "input": "8 4\n10010101", "output": "2" }, { "input": "4 2\n1001", "output": "-1" }, { "input": "8 4\n11100101", "output": "3" }, { "input": "12 3\n101111100101", "output": "4" }, { "input": "5 4\n11011", "output": "1" }, { "input": "5 4\n10001", "output": "1" }, { "input": "10 7\n1101111011", "output": "2" }, { "input": "10 9\n1110000101", "output": "1" }, { "input": "10 9\n1100000001", "output": "1" }, { "input": "20 5\n11111111110111101001", "output": "4" }, { "input": "20 11\n11100000111000011011", "output": "2" }, { "input": "20 19\n10100000000000000001", "output": "1" }, { "input": "50 13\n10011010100010100111010000010000000000010100000101", "output": "5" }, { "input": "50 8\n11010100000011001100001100010001110000101100110011", "output": "8" }, { "input": "99 4\n111111111111111111111111111111111111111111111111111111111011111111111111111111111111111111111111111", "output": "25" }, { "input": "99 98\n100000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001", "output": "1" }, { "input": "100 5\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111", "output": "20" }, { "input": "100 4\n1111111111111111111111111111111111111111111111111111111111111111111111111111110111111111111111111111", "output": "25" }, { "input": "100 4\n1111111111111111111111111111111111111111111111111111111111111101111111011111111111111111111111111111", "output": "25" }, { "input": "100 3\n1111110111111111111111111111111111111111101111111111111111111111111101111111111111111111111111111111", "output": "34" }, { "input": "100 8\n1111111111101110111111111111111111111111111111111111111111111111111111110011111111111111011111111111", "output": "13" }, { "input": "100 7\n1011111111111111111011101111111011111101111111111101111011110111111111111111111111110111111011111111", "output": "15" }, { "input": "100 9\n1101111110111110101111111111111111011001110111011101011111111111010101111111100011011111111010111111", "output": "12" }, { "input": "100 6\n1011111011111111111011010110011001010101111110111111000111011011111110101101110110101111110000100111", "output": "18" }, { "input": "100 7\n1110001111101001110011111111111101111101101001010001101000101100000101101101011111111101101000100001", "output": "16" }, { "input": "100 11\n1000010100011100011011100000010011001111011110100100001011010100011011111001101101110110010110001101", "output": "10" }, { "input": "100 9\n1001001110000011100100000001000110111101101010101001000101001010011001101100110011011110110011011111", "output": "13" }, { "input": "100 7\n1010100001110101111011000111000001110100100110110001110110011010100001100100001110111100110000101001", "output": "18" }, { "input": "100 10\n1110110000000110000000101110100000111000001011100000100110010001110111001010101000011000000001011011", "output": "12" }, { "input": "100 13\n1000000100000000100011000010010000101010011110000000001000011000110100001000010001100000011001011001", "output": "9" }, { "input": "100 11\n1000000000100000010000100001000100000000010000100100000000100100001000000001011000110001000000000101", "output": "12" }, { "input": "100 22\n1000100000001010000000000000000001000000100000000000000000010000000000001000000000000000000100000001", "output": "7" }, { "input": "100 48\n1000000000000000011000000000000000000000000000000001100000000000000000000000000000000000000000000001", "output": "3" }, { "input": "100 48\n1000000000000000000000100000000000000000000000000000000000000000000001000000000000000000100000000001", "output": "3" }, { "input": "100 75\n1000000100000000000000000000000000000000000000000000000000000000000000000000000001000000000000000001", "output": "3" }, { "input": "100 73\n1000000000000000000000000000000100000000000000000000000000000000000000000000000000000000000000000001", "output": "2" }, { "input": "100 99\n1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001", "output": "1" }, { "input": "100 1\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111", "output": "99" }, { "input": "100 2\n1111111111111111111111111111111110111111111111111111111111111111111111111111111111111111111111111111", "output": "50" }, { "input": "100 1\n1111111111111111011111111111111111111111111111111111111111111111111101111111111111111111111111111111", "output": "-1" }, { "input": "100 3\n1111111111111111111111111101111111111111111111111011111111111111111111111111111011111111111111111111", "output": "33" }, { "input": "100 1\n1101111111111111111111101111111111111111111111111111111111111011111111101111101111111111111111111111", "output": "-1" }, { "input": "100 6\n1111111111111111111111101111111101011110001111111111111111110111111111111111111111111110010111111111", "output": "17" }, { "input": "100 2\n1111111101111010110111011011110111101111111011111101010101011111011111111111111011111001101111101111", "output": "-1" }, { "input": "100 8\n1100110101111001101001111000111100110100011110111011001011111110000110101000001110111011100111011011", "output": "14" }, { "input": "100 10\n1000111110100000001001101100000010011100010101001100010011111001001101111110110111101111001010001101", "output": "11" }, { "input": "100 7\n1110000011010001110101011010000011110001000000011101110111010110001000011101111010010001101111110001", "output": "-1" }, { "input": "100 3\n1111010001000001011011000011001111000100101000101101000010111101111000010000011110110011001101010111", "output": "-1" }, { "input": "100 9\n1101010101101100010111011000010100001010000101010011001001100010110110000000010000101000000001101101", "output": "13" }, { "input": "100 14\n1010100000000000010101000010001100000000000011100010000001000001011010001110001010100000100001101101", "output": "9" }, { "input": "100 13\n1000000001101001110000010000011001000000000000001010000000100001001010000000000000000100010000000001", "output": "-1" }, { "input": "100 18\n1000000000000000110000000000000000010000000001000001000001000000000100000000000010000000000000000001", "output": "-1" }, { "input": "100 32\n1000000000000000000000000001000000000000000000000101000000000000000000000000000000000001000000000001", "output": "-1" }, { "input": "100 79\n1000000001000000000101000000000000000000000000000000000000000000000000000000000000000000000000000001", "output": "2" }, { "input": "100 41\n1000000000000000000000000000000000010000000000000000000000000000000000000000100000000000000000000001", "output": "3" }, { "input": "100 82\n1000000000000000000100000000000000000000000000000000000000000000000000000000000000000000000000000001", "output": "2" }, { "input": "100 96\n1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001", "output": "-1" }, { "input": "43 30\n1001000001111111010100100100110101011101101", "output": "2" }, { "input": "7 1\n1111111", "output": "6" }, { "input": "9 3\n101000001", "output": "-1" }, { "input": "10 3\n1100000001", "output": "-1" }, { "input": "8 2\n10000101", "output": "-1" }, { "input": "2 1\n11", "output": "1" } ]

1,572,551,933

2,147,483,647

Python 3

TIME_LIMIT_EXCEEDED

TESTS

0

1,000

0

#Gerardo Martínez A01235692 n, d = input().split() n = int(n) d = int(d) b = input() saltos_num = 0 i = 0 posible = True while(i != -n): saltos = min(d, (n - 1) - i) busca_i = i + saltos while(busca_i > i and b[busca_i] != "1"): busca_i = busca_i - 1 if(busca_i == i): posible = False break saltos_num = saltos_num - 1 i = busca_i if(posible): print(saltos_num , "\n") else: print(-1, "\n")

Title: The Way to Home Time Limit: None seconds Memory Limit: None megabytes Problem Description: A frog lives on the axis *Ox* and needs to reach home which is in the point *n*. She starts from the point 1. The frog can jump to the right at a distance not more than *d*. So, after she jumped from the point *x* she can reach the point *x*<=+<=*a*, where *a* is an integer from 1 to *d*. For each point from 1 to *n* is known if there is a lily flower in it. The frog can jump only in points with a lilies. Guaranteed that there are lilies in the points 1 and *n*. Determine the minimal number of jumps that the frog needs to reach home which is in the point *n* from the point 1. Consider that initially the frog is in the point 1. If the frog can not reach home, print -1. Input Specification: The first line contains two integers *n* and *d* (2<=≤<=*n*<=≤<=100, 1<=≤<=*d*<=≤<=*n*<=-<=1) — the point, which the frog wants to reach, and the maximal length of the frog jump. The second line contains a string *s* of length *n*, consisting of zeros and ones. If a character of the string *s* equals to zero, then in the corresponding point there is no lily flower. In the other case, in the corresponding point there is a lily flower. Guaranteed that the first and the last characters of the string *s* equal to one. Output Specification: If the frog can not reach the home, print -1. In the other case, print the minimal number of jumps that the frog needs to reach the home which is in the point *n* from the point 1. Demo Input: ['8 4\n10010101\n', '4 2\n1001\n', '8 4\n11100101\n', '12 3\n101111100101\n'] Demo Output: ['2\n', '-1\n', '3\n', '4\n'] Note: In the first example the from can reach home in two jumps: the first jump from the point 1 to the point 4 (the length of the jump is three), and the second jump from the point 4 to the point 8 (the length of the jump is four). In the second example the frog can not reach home, because to make it she need to jump on a distance three, but the maximum length of her jump equals to two.

```python #Gerardo Martínez A01235692 n, d = input().split() n = int(n) d = int(d) b = input() saltos_num = 0 i = 0 posible = True while(i != -n): saltos = min(d, (n - 1) - i) busca_i = i + saltos while(busca_i > i and b[busca_i] != "1"): busca_i = busca_i - 1 if(busca_i == i): posible = False break saltos_num = saltos_num - 1 i = busca_i if(posible): print(saltos_num , "\n") else: print(-1, "\n") ```

0

404

A

Valera and X

PROGRAMMING

1,000

[ "implementation" ]

null

Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet. Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if: - on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals. Help Valera, write the program that completes the described task for him.

The first line contains integer *n* (3<=≤<=*n*<=<<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters — the description of Valera's paper.

Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes.

[ "5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n", "3\nwsw\nsws\nwsw\n", "3\nxpx\npxp\nxpe\n" ]

[ "NO\n", "YES\n", "NO\n" ]

none

500

[ { "input": "5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox", "output": "NO" }, { "input": "3\nwsw\nsws\nwsw", "output": "YES" }, { "input": "3\nxpx\npxp\nxpe", "output": "NO" }, { "input": "5\nliiil\nilili\niilii\nilili\nliiil", "output": "YES" }, { "input": "7\nbwccccb\nckcccbj\nccbcbcc\ncccbccc\nccbcbcc\ncbcccbc\nbccccdt", "output": "NO" }, { "input": "13\nsooooooooooos\nosoooooooooso\noosooooooosoo\nooosooooosooo\noooosooosoooo\nooooososooooo\noooooosoooooo\nooooososooooo\noooosooosoooo\nooosooooosooo\noosooooooosoo\nosoooooooooso\nsooooooooooos", "output": "YES" }, { "input": "3\naaa\naaa\naaa", "output": "NO" }, { "input": "3\naca\noec\nzba", "output": "NO" }, { "input": "15\nrxeeeeeeeeeeeer\nereeeeeeeeeeere\needeeeeeeeeeoee\neeereeeeeeeewee\neeeereeeeebeeee\nqeeeereeejedyee\neeeeeerereeeeee\neeeeeeereeeeeee\neeeeeerereeeeze\neeeeereeereeeee\neeeereeeeegeeee\neeereeeeeeereee\neereeeeeeqeeved\ncreeeeeeceeeere\nreeerneeeeeeeer", "output": "NO" }, { "input": "5\nxxxxx\nxxxxx\nxxxxx\nxxxxx\nxxxxx", "output": "NO" }, { "input": "5\nxxxxx\nxxxxx\nxoxxx\nxxxxx\nxxxxx", "output": "NO" }, { "input": "5\noxxxo\nxoxox\nxxxxx\nxoxox\noxxxo", "output": "NO" }, { "input": "5\noxxxo\nxoxox\nxxoox\nxoxox\noxxxo", "output": "NO" }, { "input": "5\noxxxo\nxoxox\nxxaxx\nxoxox\noxxxo", "output": "NO" }, { "input": "5\noxxxo\nxoxox\noxoxx\nxoxox\noxxxo", "output": "NO" }, { "input": "3\nxxx\naxa\nxax", "output": "NO" }, { "input": "3\nxax\naxx\nxax", "output": "NO" }, { "input": "3\nxax\naxa\nxxx", "output": "NO" }, { "input": "3\nxax\nxxa\nxax", "output": "NO" }, { "input": "3\nxax\naaa\nxax", "output": "NO" }, { "input": "3\naax\naxa\nxax", "output": "NO" }, { "input": "3\nxaa\naxa\nxax", "output": "NO" }, { "input": "3\nxax\naxa\naax", "output": "NO" }, { "input": "3\nxax\naxa\nxaa", "output": "NO" }, { "input": "3\nxfx\naxa\nxax", "output": "NO" }, { "input": "3\nxax\nafa\nxax", "output": "NO" }, { "input": "3\nxax\naxa\nxaf", "output": "NO" }, { "input": "3\nxox\nxxx\nxxx", "output": "NO" }, { "input": "3\naxa\naax\nxxa", "output": "NO" }, { "input": "3\nxox\noxx\nxox", "output": "NO" }, { "input": "3\nxox\nooo\nxox", "output": "NO" }, { "input": "3\naaa\naab\nbbb", "output": "NO" }, { "input": "3\nxxx\nsxs\nxsx", "output": "NO" }, { "input": "5\nabbba\nbabab\nbbbbb\nbaaab\nabbba", "output": "NO" }, { "input": "5\nabaaa\nbbbbb\nbbabb\nbabab\nabbba", "output": "NO" }, { "input": "5\nxoxox\noxoxo\nooxoo\noxoxo\nxooox", "output": "NO" }, { "input": "3\nxox\noxx\nxxx", "output": "NO" }, { "input": "5\nxoooo\noxooo\nooxoo\noooxo\noooox", "output": "NO" }, { "input": "5\nxoooo\noxoxx\nooxoo\noxoxo\noxoox", "output": "NO" }, { "input": "3\naaa\nbab\naba", "output": "NO" } ]

1,655,259,662

2,147,483,647

Python 3

WRONG_ANSWER

TESTS

19

46

0

### Hello! World ... ### n = int(input()) flag = True for i in range(n): line = str(input()) line = [char for char in line] if line[i] == line[(len(line)-1)-i] and len(set(line)) == 2: # print(line[i], ' - ', line[(len(line)-1)-i]) pass else: # print(line[i], ' - ', line[(len(line)-1)-i]) flag = False break if flag: print('YES') else: print('NO')

Title: Valera and X Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet. Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if: - on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals. Help Valera, write the program that completes the described task for him. Input Specification: The first line contains integer *n* (3<=≤<=*n*<=<<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters — the description of Valera's paper. Output Specification: Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes. Demo Input: ['5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n', '3\nwsw\nsws\nwsw\n', '3\nxpx\npxp\nxpe\n'] Demo Output: ['NO\n', 'YES\n', 'NO\n'] Note: none

```python ### Hello! World ... ### n = int(input()) flag = True for i in range(n): line = str(input()) line = [char for char in line] if line[i] == line[(len(line)-1)-i] and len(set(line)) == 2: # print(line[i], ' - ', line[(len(line)-1)-i]) pass else: # print(line[i], ' - ', line[(len(line)-1)-i]) flag = False break if flag: print('YES') else: print('NO') ```

0

686

B

Little Robber Girl's Zoo

PROGRAMMING

1,100

[ "constructive algorithms", "implementation", "sortings" ]

null

Little Robber Girl likes to scare animals in her zoo for fun. She decided to arrange the animals in a row in the order of non-decreasing height. However, the animals were so scared that they couldn't stay in the right places. The robber girl was angry at first, but then she decided to arrange the animals herself. She repeatedly names numbers *l* and *r* such that *r*<=-<=*l*<=+<=1 is even. After that animals that occupy positions between *l* and *r* inclusively are rearranged as follows: the animal at position *l* swaps places with the animal at position *l*<=+<=1, the animal *l*<=+<=2 swaps with the animal *l*<=+<=3, ..., finally, the animal at position *r*<=-<=1 swaps with the animal *r*. Help the robber girl to arrange the animals in the order of non-decreasing height. You should name at most 20<=000 segments, since otherwise the robber girl will become bored and will start scaring the animals again.

The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — number of animals in the robber girl's zoo. The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109), where *a**i* is the height of the animal occupying the *i*-th place.

Print the sequence of operations that will rearrange the animals by non-decreasing height. The output should contain several lines, *i*-th of the lines should contain two space-separated integers *l**i* and *r**i* (1<=≤<=*l**i*<=<<=*r**i*<=≤<=*n*) — descriptions of segments the robber girl should name. The segments should be described in the order the operations are performed. The number of operations should not exceed 20<=000. If the animals are arranged correctly from the start, you are allowed to output nothing.

[ "4\n2 1 4 3\n", "7\n36 28 57 39 66 69 68\n", "5\n1 2 1 2 1\n" ]

[ "1 4\n", "1 4\n6 7\n", "2 5\n3 4\n1 4\n1 4\n" ]

Note that you don't have to minimize the number of operations. Any solution that performs at most 20 000 operations is allowed.

1,000

[ { "input": "4\n2 1 4 3", "output": "1 2\n3 4" }, { "input": "7\n36 28 57 39 66 69 68", "output": "1 2\n3 4\n6 7" }, { "input": "5\n1 2 1 2 1", "output": "2 3\n4 5\n3 4" }, { "input": "78\n7 3 8 8 9 8 10 9 12 11 16 14 17 17 18 18 20 20 25 22 27 26 29 27 35 35 36 36 37 37 38 38 40 39 42 42 48 46 49 49 58 50 60 58 65 61 68 66 69 69 69 69 70 69 71 71 77 73 78 77 80 79 85 83 86 86 86 86 88 87 91 90 96 91 98 97 99 98", "output": "1 2\n5 6\n7 8\n9 10\n11 12\n19 20\n21 22\n23 24\n33 34\n37 38\n41 42\n43 44\n45 46\n47 48\n53 54\n57 58\n59 60\n61 62\n63 64\n69 70\n71 72\n73 74\n75 76\n77 78" }, { "input": "99\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 4 4 4 4 4 4 4 4 4 4 4 4 4 4 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53\n53 54\n54 55\n55 56\n56 57\n57 58\n58 59\n59 60\n60 61\n61 62\n62 63\n63 64\n64 65\n65 66\n66 67\n67 68\n68 69\n69 70\n70 71\n71 72\n72 73\n73 74\n74 75\n75 76\n76 77\n77 78\n78 79\n79 80\n80 81\n81 82\n82 83\n83 84\n84 85\n85 86\n86 87\n87 88\n88 89\n89 90\n90 91\n91 92\n92 93\n..." }, { "input": "99\n4577 4577 4576 4576 4576 4576 4576 4576 4576 4576 4576 4576 4576 4575 4575 4575 4575 4575 4575 4574 4574 4574 4574 4574 4574 4574 4574 4574 4574 4573 4573 4573 4573 4573 4573 4573 4573 4573 4573 4573 4573 4572 4572 4572 4572 4572 4572 4572 4572 4572 4572 4572 4571 4571 4571 4571 4571 4571 4571 4571 4571 4570 4570 4570 4570 4570 4570 4570 4569 4569 4569 4569 4569 4569 4569 4569 4569 4569 4569 4568 4568 4568 4568 4568 4568 4568 4568 4568 4568 4568 4567 4567 4567 4567 4567 4567 4567 4567 4567", "output": "2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n18 19\n19 20\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53\n53 54\n54 55\n55 56\n56 57\n57 58\n58 59\n59 60\n60 61\n61 62\n62 63\n63 64\n64 65\n65 66\n66 67\n67 68\n68 69\n69 70\n70 71\n71 72\n72 73\n73 74\n74 75\n75 76\n76 77\n7..." }, { "input": "10\n44 23 65 17 48 29 49 88 91 85", "output": "1 2\n3 4\n4 5\n5 6\n6 7\n9 10\n2 3\n4 5\n8 9\n1 2\n3 4" }, { "input": "13\n605297997 425887240 859639341 200428931 888317166 983420497 81642057 628988722 389959969 358920886 646428392 324912711 401437250", "output": "1 2\n3 4\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n2 3\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n1 2\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n3 4\n5 6\n6 7\n8 9\n9 10\n2 3\n4 5\n5 6\n7 8\n8 9\n1 2\n3 4\n4 5\n6 7\n7 8\n3 4\n5 6\n6 7\n4 5\n3 4" }, { "input": "43\n644870843 160471908 227474511 47341477 175939701 563067024 749818136 707986934 201095131 736488829 346428456 342944986 316696712 101551423 672610101 897020945 708299245 587795677 408207112 985104524 278945228 192250326 157154304 301319412 270702270 954096281 649990285 37649442 300182190 382249227 605285302 392816037 419998044 84624133 332174228 996770879 816912092 283973844 498255316 374935144 294452244 529912248 553039417", "output": "1 2\n2 3\n3 4\n4 5\n5 6\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n16 17\n17 18\n18 19\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n2 3\n3 4\n7 8\n9 10\n10 11\n11 12\n12 13\n13 14\n15 16\n16 17\n17 18\n19 20\n20 21\n21 22\n22 23\n23 24\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n1 2\n6 7\n8 9\n9 10\n10 11\n11 12\n12 13\n1..." }, { "input": "97\n1 1 1 2 1 1 1 2 1 1 1 1 1 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 1 1 2 1 1 1 1 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 1 1 1 2 2 1 1 2 1 1 1 1 2 2 1 2 1 2 1 1 2 2 2 1 2 2 1 1 2 2 2 1 1 2 1 2 1 1 2", "output": "4 5\n5 6\n6 7\n8 9\n9 10\n10 11\n11 12\n12 13\n20 21\n22 23\n26 27\n28 29\n34 35\n35 36\n37 38\n38 39\n39 40\n40 41\n42 43\n44 45\n48 49\n58 59\n59 60\n60 61\n63 64\n64 65\n66 67\n67 68\n68 69\n69 70\n72 73\n74 75\n76 77\n77 78\n81 82\n84 85\n85 86\n89 90\n90 91\n92 93\n94 95\n95 96\n7 8\n8 9\n9 10\n10 11\n11 12\n19 20\n21 22\n25 26\n27 28\n33 34\n34 35\n36 37\n37 38\n38 39\n39 40\n41 42\n43 44\n47 48\n57 58\n58 59\n59 60\n62 63\n63 64\n65 66\n66 67\n67 68\n68 69\n71 72\n73 74\n75 76\n76 77\n80 81\n83 84\n..." }, { "input": "87\n2 2 1 2 3 1 3 2 3 2 3 3 1 3 3 3 2 2 1 1 2 3 2 1 2 2 3 3 1 1 1 3 2 3 1 2 1 3 3 3 3 3 3 2 3 2 3 3 2 1 1 3 1 1 3 3 2 3 1 1 3 3 3 2 3 1 3 2 2 2 1 3 3 3 1 1 2 3 2 3 2 1 3 3 3 1 3", "output": "2 3\n5 6\n7 8\n9 10\n12 13\n16 17\n17 18\n18 19\n19 20\n20 21\n22 23\n23 24\n24 25\n25 26\n28 29\n29 30\n30 31\n32 33\n34 35\n35 36\n36 37\n43 44\n45 46\n48 49\n49 50\n50 51\n52 53\n53 54\n56 57\n58 59\n59 60\n63 64\n65 66\n67 68\n68 69\n69 70\n70 71\n74 75\n75 76\n76 77\n78 79\n80 81\n81 82\n85 86\n1 2\n4 5\n6 7\n8 9\n11 12\n15 16\n16 17\n17 18\n18 19\n19 20\n21 22\n22 23\n23 24\n24 25\n27 28\n28 29\n29 30\n31 32\n33 34\n34 35\n35 36\n42 43\n44 45\n47 48\n48 49\n49 50\n51 52\n52 53\n55 56\n57 58\n58 59\n6..." }, { "input": "100\n3 2 5 4 3 3 3 3 4 3 1 2 3 2 3 1 4 1 5 2 5 3 3 5 2 3 5 4 3 4 1 5 5 2 2 1 3 5 1 3 5 2 2 1 4 3 1 3 5 1 1 3 5 5 5 4 5 5 1 5 3 5 4 3 5 4 1 1 2 1 2 5 1 2 2 2 3 5 5 5 4 2 3 2 1 2 3 5 2 2 2 2 5 3 5 4 2 5 3 4", "output": "1 2\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n19 20\n21 22\n22 23\n24 25\n25 26\n27 28\n28 29\n29 30\n30 31\n33 34\n34 35\n35 36\n36 37\n38 39\n39 40\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n49 50\n50 51\n51 52\n55 56\n58 59\n60 61\n62 63\n63 64\n65 66\n66 67\n67 68\n68 69\n69 70\n70 71\n72 73\n73 74\n74 75\n75 76\n76 77\n80 81\n81 82\n82 83\n83 84\n84 85\n85 86\n86 87\n88 89\n89 90\n90 91\n91 92\n93 94\n95 96\n96 97\n98 99\n99 100\n3 4\n4 5\n5 6\n..." }, { "input": "100\n245 230 240 248 247 235 240 228 247 243 244 240 246 234 244 247 247 232 247 233 241 247 236 247 230 228 243 237 246 231 246 231 233 235 229 244 247 248 245 248 231 230 238 247 235 248 240 239 233 232 230 229 229 244 247 246 248 247 247 234 243 242 247 228 238 238 236 243 236 228 229 245 232 246 241 243 248 235 242 237 244 239 238 245 231 235 234 237 238 237 234 232 231 236 233 238 228 243 242 246", "output": "1 2\n2 3\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n18 19\n19 20\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n38 39\n40 41\n41 42\n42 43\n43 44\n44 45\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53\n53 54\n54 55\n55 56\n57 58\n58 59\n59 60\n60 61\n61 62\n62 63\n63 64\n64 65\n65 66\n66 67\n67 68\n68 69\n69 70\n70 71\n71 72\n72 73\n73 74\n74 75\n75 76\n77 78\n78 79\n79 80\n80 81\n81 82\n8..." }, { "input": "100\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53\n53 54\n54 55\n55 56\n56 57\n57 58\n58 59\n59 60\n60 61\n61 62\n62 63\n63 64\n64 65\n65 66\n66 67\n67 68\n68 69\n69 70\n70 71\n71 72\n72 73\n73 74\n74 75\n75 76\n76 77\n77 78\n78 79\n79 80\n80 81\n81 82\n82 83\n83 84\n84 85\n85 86\n86 87\n87 88\n88 89\n89 90\n90 91\n91 92\n92 93\n93 94\n94 95\n95 96\n96 97\n97 98\n98 99\n99 100\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53\n53 54\n54 55\n55 56\n56 57\n57 58\n..." }, { "input": "98\n5 5 5 5 5 5 5 6 6 6 6 7 6 7 7 7 7 7 7 8 8 8 8 8 8 9 8 9 9 9 9 10 9 10 9 11 10 11 11 11 11 12 12 12 12 12 12 12 12 13 13 13 13 13 13 14 14 14 14 14 14 14 15 15 15 15 15 15 15 16 16 16 16 17 17 17 17 17 17 18 17 18 18 18 19 19 19 19 19 20 19 20 20 20 20 20 20 20", "output": "12 13\n26 27\n32 33\n34 35\n36 37\n80 81\n90 91\n33 34" }, { "input": "20\n2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 2 2 2 2", "output": "6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11" } ]

1,639,474,534

2,147,483,647

PyPy 3-64

WRONG_ANSWER

TESTS

2

93

0

n=int(input()) a=[int(i) for i in input().split()] b=sorted(a) if b==a: print() else: for i in range(n): for j in range(i+1,n): if a[i]>a[j]: a[i],a[j]=a[j],a[i] print(i+1,j+1)

Title: Little Robber Girl's Zoo Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Robber Girl likes to scare animals in her zoo for fun. She decided to arrange the animals in a row in the order of non-decreasing height. However, the animals were so scared that they couldn't stay in the right places. The robber girl was angry at first, but then she decided to arrange the animals herself. She repeatedly names numbers *l* and *r* such that *r*<=-<=*l*<=+<=1 is even. After that animals that occupy positions between *l* and *r* inclusively are rearranged as follows: the animal at position *l* swaps places with the animal at position *l*<=+<=1, the animal *l*<=+<=2 swaps with the animal *l*<=+<=3, ..., finally, the animal at position *r*<=-<=1 swaps with the animal *r*. Help the robber girl to arrange the animals in the order of non-decreasing height. You should name at most 20<=000 segments, since otherwise the robber girl will become bored and will start scaring the animals again. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — number of animals in the robber girl's zoo. The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109), where *a**i* is the height of the animal occupying the *i*-th place. Output Specification: Print the sequence of operations that will rearrange the animals by non-decreasing height. The output should contain several lines, *i*-th of the lines should contain two space-separated integers *l**i* and *r**i* (1<=≤<=*l**i*<=<<=*r**i*<=≤<=*n*) — descriptions of segments the robber girl should name. The segments should be described in the order the operations are performed. The number of operations should not exceed 20<=000. If the animals are arranged correctly from the start, you are allowed to output nothing. Demo Input: ['4\n2 1 4 3\n', '7\n36 28 57 39 66 69 68\n', '5\n1 2 1 2 1\n'] Demo Output: ['1 4\n', '1 4\n6 7\n', '2 5\n3 4\n1 4\n1 4\n'] Note: Note that you don't have to minimize the number of operations. Any solution that performs at most 20 000 operations is allowed.

```python n=int(input()) a=[int(i) for i in input().split()] b=sorted(a) if b==a: print() else: for i in range(n): for j in range(i+1,n): if a[i]>a[j]: a[i],a[j]=a[j],a[i] print(i+1,j+1) ```

0

892

B

Wrath

PROGRAMMING

1,200

[ "greedy", "implementation", "two pointers" ]

null

Hands that shed innocent blood! There are *n* guilty people in a line, the *i*-th of them holds a claw with length *L**i*. The bell rings and every person kills some of people in front of him. All people kill others at the same time. Namely, the *i*-th person kills the *j*-th person if and only if *j*<=<<=*i* and *j*<=≥<=*i*<=-<=*L**i*. You are given lengths of the claws. You need to find the total number of alive people after the bell rings.

The first line contains one integer *n* (1<=≤<=*n*<=≤<=106) — the number of guilty people. Second line contains *n* space-separated integers *L*1,<=*L*2,<=...,<=*L**n* (0<=≤<=*L**i*<=≤<=109), where *L**i* is the length of the *i*-th person's claw.

Print one integer — the total number of alive people after the bell rings.

[ "4\n0 1 0 10\n", "2\n0 0\n", "10\n1 1 3 0 0 0 2 1 0 3\n" ]

[ "1\n", "2\n", "3\n" ]

In first sample the last person kills everyone in front of him.

1,000

[ { "input": "4\n0 1 0 10", "output": "1" }, { "input": "2\n0 0", "output": "2" }, { "input": "10\n1 1 3 0 0 0 2 1 0 3", "output": "3" }, { "input": "10\n0 0 2 0 0 3 3 2 2 0", "output": "2" }, { "input": "1\n0", "output": "1" }, { "input": "5\n0 0 0 1 0", "output": "4" }, { "input": "6\n3 1 1 0 3 3", "output": "1" }, { "input": "8\n0 0 0 1 0 0 1 2", "output": "5" }, { "input": "1\n1000000000", "output": "1" }, { "input": "2\n1 3", "output": "1" }, { "input": "2\n1000000000 1000000000", "output": "1" }, { "input": "11\n1 0 0 1 1 3 2 0 0 2 3", "output": "4" }, { "input": "1\n1", "output": "1" } ]

1,511,890,121

1,721

Python 3

WRONG_ANSWER

TESTS

3

62

5,529,600

n=int(input()) A=[int(i) for i in input().split(" ")] ans=n last=n+1 for i in range(n-1,-1,-1): if max(0,i-A[i])<last: last=i-A[i] ans-=min(i,A[i]) #print(i) print(ans)

Title: Wrath Time Limit: None seconds Memory Limit: None megabytes Problem Description: Hands that shed innocent blood! There are *n* guilty people in a line, the *i*-th of them holds a claw with length *L**i*. The bell rings and every person kills some of people in front of him. All people kill others at the same time. Namely, the *i*-th person kills the *j*-th person if and only if *j*<=<<=*i* and *j*<=≥<=*i*<=-<=*L**i*. You are given lengths of the claws. You need to find the total number of alive people after the bell rings. Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=106) — the number of guilty people. Second line contains *n* space-separated integers *L*1,<=*L*2,<=...,<=*L**n* (0<=≤<=*L**i*<=≤<=109), where *L**i* is the length of the *i*-th person's claw. Output Specification: Print one integer — the total number of alive people after the bell rings. Demo Input: ['4\n0 1 0 10\n', '2\n0 0\n', '10\n1 1 3 0 0 0 2 1 0 3\n'] Demo Output: ['1\n', '2\n', '3\n'] Note: In first sample the last person kills everyone in front of him.

```python n=int(input()) A=[int(i) for i in input().split(" ")] ans=n last=n+1 for i in range(n-1,-1,-1): if max(0,i-A[i])<last: last=i-A[i] ans-=min(i,A[i]) #print(i) print(ans) ```

0

315

A

Sereja and Bottles

PROGRAMMING

1,400

[ "brute force" ]

null

Sereja and his friends went to a picnic. The guys had *n* soda bottles just for it. Sereja forgot the bottle opener as usual, so the guys had to come up with another way to open bottles. Sereja knows that the *i*-th bottle is from brand *a**i*, besides, you can use it to open other bottles of brand *b**i*. You can use one bottle to open multiple other bottles. Sereja can open bottle with opened bottle or closed bottle. Knowing this, Sereja wants to find out the number of bottles they've got that they won't be able to open in any way. Help him and find this number.

The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of bottles. The next *n* lines contain the bottles' description. The *i*-th line contains two integers *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the description of the *i*-th bottle.

In a single line print a single integer — the answer to the problem.

[ "4\n1 1\n2 2\n3 3\n4 4\n", "4\n1 2\n2 3\n3 4\n4 1\n" ]

[ "4\n", "0\n" ]

none

500

[ { "input": "4\n1 1\n2 2\n3 3\n4 4", "output": "4" }, { "input": "4\n1 2\n2 3\n3 4\n4 1", "output": "0" }, { "input": "3\n2 828\n4 392\n4 903", "output": "3" }, { "input": "4\n2 3\n1 772\n3 870\n3 668", "output": "2" }, { "input": "5\n1 4\n6 6\n4 3\n3 4\n4 758", "output": "2" }, { "input": "6\n4 843\n2 107\n10 943\n9 649\n7 806\n6 730", "output": "6" }, { "input": "7\n351 955\n7 841\n102 377\n394 102\n549 440\n630 324\n624 624", "output": "6" }, { "input": "8\n83 978\n930 674\n542 22\n834 116\n116 271\n640 930\n659 930\n705 987", "output": "6" }, { "input": "9\n162 942\n637 967\n356 108\n768 53\n656 656\n575 32\n32 575\n53 53\n351 222", "output": "6" }, { "input": "10\n423 360\n947 538\n507 484\n31 947\n414 351\n169 901\n901 21\n592 22\n763 200\n656 485", "output": "8" }, { "input": "1\n1000 1000", "output": "1" }, { "input": "1\n500 1000", "output": "1" }, { "input": "11\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11", "output": "11" }, { "input": "49\n1 758\n5 3\n5 3\n4 2\n4 36\n3 843\n5 107\n1 943\n1 649\n2 806\n3 730\n2 351\n2 102\n1 4\n3 4\n3 955\n2 841\n2 377\n5 2\n3 440\n4 324\n3 3\n3 83\n2 2\n2 1\n4 1\n1 931\n3 4\n2 5\n2 5\n4 73\n5 830\n3 4\n3 5\n5 291\n1 2\n5 3\n4 4\n2 3\n3 151\n4 2\n4 431\n5 1\n2 5\n2 4\n4 2\n4 4\n3 1\n5 2", "output": "0" }, { "input": "50\n507 31\n31 250\n414 763\n169 304\n901 9\n592 610\n763 414\n656 789\n411 422\n360 468\n625 504\n538 201\n549 619\n484 797\n596 282\n42 310\n603 656\n351 623\n292 293\n837 180\n375 658\n21 192\n597 729\n22 512\n349 635\n200 56\n669 647\n485 887\n282 939\n735 808\n54 417\n1000 310\n419 652\n939 617\n901 669\n789 390\n128 549\n468 511\n729 837\n894 729\n649 894\n484 22\n808 586\n422 286\n311 427\n618 656\n814 933\n515 901\n310 894\n617 330", "output": "30" }, { "input": "2\n7 7\n5 359", "output": "2" }, { "input": "2\n465 706\n706 706", "output": "1" }, { "input": "2\n1 1\n1 1", "output": "0" }, { "input": "3\n1 1\n1 1\n2 2", "output": "1" }, { "input": "5\n1 1\n1 2\n2 3\n3 4\n4 3", "output": "1" }, { "input": "3\n1 2\n1 2\n1 1", "output": "1" } ]

1,603,461,666

2,147,483,647

Python 3

WRONG_ANSWER

TESTS

2

156

0

n = int(input()) ans = n for _ in range(n): a,b = [int(x) for x in input().split(" ")] if a-b: ans -= 1 print(ans)

Title: Sereja and Bottles Time Limit: None seconds Memory Limit: None megabytes Problem Description: Sereja and his friends went to a picnic. The guys had *n* soda bottles just for it. Sereja forgot the bottle opener as usual, so the guys had to come up with another way to open bottles. Sereja knows that the *i*-th bottle is from brand *a**i*, besides, you can use it to open other bottles of brand *b**i*. You can use one bottle to open multiple other bottles. Sereja can open bottle with opened bottle or closed bottle. Knowing this, Sereja wants to find out the number of bottles they've got that they won't be able to open in any way. Help him and find this number. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of bottles. The next *n* lines contain the bottles' description. The *i*-th line contains two integers *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the description of the *i*-th bottle. Output Specification: In a single line print a single integer — the answer to the problem. Demo Input: ['4\n1 1\n2 2\n3 3\n4 4\n', '4\n1 2\n2 3\n3 4\n4 1\n'] Demo Output: ['4\n', '0\n'] Note: none

```python n = int(input()) ans = n for _ in range(n): a,b = [int(x) for x in input().split(" ")] if a-b: ans -= 1 print(ans) ```

0

112

A

Petya and Strings

PROGRAMMING

800

[ "implementation", "strings" ]

A. Petya and Strings

2

256

Little Petya loves presents. His mum bought him two strings of the same size for his birthday. The strings consist of uppercase and lowercase Latin letters. Now Petya wants to compare those two strings lexicographically. The letters' case does not matter, that is an uppercase letter is considered equivalent to the corresponding lowercase letter. Help Petya perform the comparison.

Each of the first two lines contains a bought string. The strings' lengths range from 1 to 100 inclusive. It is guaranteed that the strings are of the same length and also consist of uppercase and lowercase Latin letters.

If the first string is less than the second one, print "-1". If the second string is less than the first one, print "1". If the strings are equal, print "0". Note that the letters' case is not taken into consideration when the strings are compared.

[ "aaaa\naaaA\n", "abs\nAbz\n", "abcdefg\nAbCdEfF\n" ]

[ "0\n", "-1\n", "1\n" ]

If you want more formal information about the lexicographical order (also known as the "dictionary order" or "alphabetical order"), you can visit the following site: - http://en.wikipedia.org/wiki/Lexicographical_order

500

[ { "input": "aaaa\naaaA", "output": "0" }, { "input": "abs\nAbz", "output": "-1" }, { "input": "abcdefg\nAbCdEfF", "output": "1" }, { "input": "asadasdasd\nasdwasdawd", "output": "-1" }, { "input": "aslkjlkasdd\nasdlkjdajwi", "output": "1" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "0" }, { "input": "aAaaaAAaAaaAzZsssSsdDfeEaeqZlpP\nAaaaAaaAaaAaZzSSSSsDdFeeAeQZLpp", "output": "0" }, { "input": "bwuEhEveouaTECagLZiqmUdxEmhRSOzMauJRWLQMppZOumxhAmwuGeDIkvkBLvMXwUoFmpAfDprBcFtEwOULcZWRQhcTbTbX\nHhoDWbcxwiMnCNexOsKsujLiSGcLllXOkRSbnOzThAjnnliLYFFmsYkOfpTxRNEfBsoUHfoLTiqAINRPxWRqrTJhgfkKcDOH", "output": "-1" }, { "input": "kGWUuguKzcvxqKTNpxeDWXpXkrXDvGMFGoXKDfPBZvWSDUyIYBynbKOUonHvmZaKeirUhfmVRKtGhAdBfKMWXDUoqvbfpfHYcg\ncvOULleuIIiYVVxcLZmHVpNGXuEpzcWZZWyMOwIwbpkKPwCfkVbKkUuosvxYCKjqfVmHfJKbdrsAcatPYgrCABaFcoBuOmMfFt", "output": "1" }, { "input": "nCeNVIzHqPceNhjHeHvJvgBsNFiXBATRrjSTXJzhLMDMxiJztphxBRlDlqwDFImWeEPkggZCXSRwelOdpNrYnTepiOqpvkr\nHJbjJFtlvNxIbkKlxQUwmZHJFVNMwPAPDRslIoXISBYHHfymyIaQHLgECPxAmqnOCizwXnIUBRmpYUBVPenoUKhCobKdOjL", "output": "1" }, { "input": "ttXjenUAlfixytHEOrPkgXmkKTSGYuyVXGIHYmWWYGlBYpHkujueqBSgjLguSgiMGJWATIGEUjjAjKXdMiVbHozZUmqQtFrT\nJziDBFBDmDJCcGqFsQwDFBYdOidLxxhBCtScznnDgnsiStlWFnEXQrJxqTXKPxZyIGfLIToETKWZBPUIBmLeImrlSBWCkTNo", "output": "1" }, { "input": "AjQhPqSVhwQQjcgCycjKorWBgFCRuQBwgdVuAPSMJAvTyxGVuFHjfJzkKfsmfhFbKqFrFIohSZBbpjgEHebezmVlGLTPSCTMf\nXhxWuSnMmKFrCUOwkTUmvKAfbTbHWzzOTzxJatLLCdlGnHVaBUnxDlsqpvjLHMThOPAFBggVKDyKBrZAmjnjrhHlrnSkyzBja", "output": "-1" }, { "input": "HCIgYtnqcMyjVngziNflxKHtdTmcRJhzMAjFAsNdWXFJYEhiTzsQUtFNkAbdrFBRmvLirkuirqTDvIpEfyiIqkrwsjvpPWTEdI\nErqiiWKsmIjyZuzgTlTqxYZwlrpvRyaVhRTOYUqtPMVGGtWOkDCOOQRKrkkRzPftyQCkYkzKkzTPqqXmeZhvvEEiEhkdOmoMvy", "output": "1" }, { "input": "mtBeJYILXcECGyEVSyzLFdQJbiVnnfkbsYYsdUJSIRmyzLfTTtFwIBmRLVnwcewIqcuydkcLpflHAFyDaToLiFMgeHvQorTVbI\nClLvyejznjbRfCDcrCzkLvqQaGzTjwmWONBdCctJAPJBcQrcYvHaSLQgPIJbmkFBhFzuQLBiRzAdNHulCjIAkBvZxxlkdzUWLR", "output": "1" }, { "input": "tjucSbGESVmVridTBjTmpVBCwwdWKBPeBvmgdxgIVLwQxveETnSdxkTVJpXoperWSgdpPMKNmwDiGeHfxnuqaDissgXPlMuNZIr\nHfjOOJhomqNIKHvqSgfySjlsWJQBuWYwhLQhlZYlpZwboMpoLoluGsBmhhlYgeIouwdkPfiaAIrkYRlxtiFazOPOllPsNZHcIZd", "output": "1" }, { "input": "AanbDfbZNlUodtBQlvPMyomStKNhgvSGhSbTdabxGFGGXCdpsJDimsAykKjfBDPMulkhBMsqLmVKLDoesHZsRAEEdEzqigueXInY\ncwfyjoppiJNrjrOLNZkqcGimrpTsiyFBVgMWEPXsMrxLJDDbtYzerXiFGuLBcQYitLdqhGHBpdjRnkUegmnwhGHAKXGyFtscWDSI", "output": "-1" }, { "input": "HRfxniwuJCaHOcaOVgjOGHXKrwxrDQxJpppeGDXnTAowyKbCsCQPbchCKeTWOcKbySSYnoaTJDnmRcyGPbfXJyZoPcARHBu\nxkLXvwkvGIWSQaFTznLOctUXNuzzBBOlqvzmVfTSejekTAlwidRrsxkbZTsGGeEWxCXHzqWVuLGoCyrGjKkQoHqduXwYQKC", "output": "-1" }, { "input": "OjYwwNuPESIazoyLFREpObIaMKhCaKAMWMfRGgucEuyNYRantwdwQkmflzfqbcFRaXBnZoIUGsFqXZHGKwlaBUXABBcQEWWPvkjW\nRxLqGcTTpBwHrHltCOllnTpRKLDofBUqqHxnOtVWPgvGaeHIevgUSOeeDOJubfqonFpVNGVbHFcAhjnyFvrrqnRgKhkYqQZmRfUl", "output": "-1" }, { "input": "tatuhQPIzjptlzzJpCAPXSRTKZRlwgfoCIsFjJquRoIDyZZYRSPdFUTjjUPhLBBfeEIfLQpygKXRcyQFiQsEtRtLnZErBqW\ntkHUjllbafLUWhVCnvblKjgYIEoHhsjVmrDBmAWbvtkHxDbRFvsXAjHIrujaDbYwOZmacknhZPeCcorbRgHjjgAgoJdjvLo", "output": "-1" }, { "input": "cymCPGqdXKUdADEWDdUaLEEMHiXHsdAZuDnJDMUvxvrLRBrPSDpXPAgMRoGplLtniFRTomDTAHXWAdgUveTxaqKVSvnOyhOwiRN\nuhmyEWzapiRNPFDisvHTbenXMfeZaHqOFlKjrfQjUBwdFktNpeiRoDWuBftZLcCZZAVfioOihZVNqiNCNDIsUdIhvbcaxpTRWoV", "output": "-1" }, { "input": "sSvpcITJAwghVfJaLKBmyjOkhltTGjYJVLWCYMFUomiJaKQYhXTajvZVHIMHbyckYROGQZzjWyWCcnmDmrkvTKfHSSzCIhsXgEZa\nvhCXkCwAmErGVBPBAnkSYEYvseFKbWSktoqaHYXUmYkHfOkRwuEyBRoGoBrOXBKVxXycjZGStuvDarnXMbZLWrbjrisDoJBdSvWJ", "output": "-1" }, { "input": "hJDANKUNBisOOINDsTixJmYgHNogtpwswwcvVMptfGwIjvqgwTYFcqTdyAqaqlnhOCMtsnWXQqtjFwQlEcBtMFAtSqnqthVb\nrNquIcjNWESjpPVWmzUJFrelpUZeGDmSvCurCqVmKHKVAAPkaHksniOlzjiKYIJtvbuQWZRufMebpTFPqyxIWWjfPaWYiNlK", "output": "-1" }, { "input": "ycLoapxsfsDTHMSfAAPIUpiEhQKUIXUcXEiopMBuuZLHtfPpLmCHwNMNQUwsEXxCEmKHTBSnKhtQhGWUvppUFZUgSpbeChX\ndCZhgVXofkGousCzObxZSJwXcHIaqUDSCPKzXntcVmPxtNcXmVcjsetZYxedmgQzXTZHMvzjoaXCMKsncGciSDqQWIIRlys", "output": "1" }, { "input": "nvUbnrywIePXcoukIhwTfUVcHUEgXcsMyNQhmMlTltZiCooyZiIKRIGVHMCnTKgzXXIuvoNDEZswKoACOBGSyVNqTNQqMhAG\nplxuGSsyyJjdvpddrSebOARSAYcZKEaKjqbCwvjhNykuaECoQVHTVFMKXwvrQXRaqXsHsBaGVhCxGRxNyGUbMlxOarMZNXxy", "output": "-1" }, { "input": "EncmXtAblQzcVRzMQqdDqXfAhXbtJKQwZVWyHoWUckohnZqfoCmNJDzexFgFJYrwNHGgzCJTzQQFnxGlhmvQTpicTkEeVICKac\nNIUNZoMLFMyAjVgQLITELJSodIXcGSDWfhFypRoGYuogJpnqGTotWxVqpvBHjFOWcDRDtARsaHarHaOkeNWEHGTaGOFCOFEwvK", "output": "-1" }, { "input": "UG\nak", "output": "1" }, { "input": "JZR\nVae", "output": "-1" }, { "input": "a\nZ", "output": "-1" }, { "input": "rk\nkv", "output": "1" }, { "input": "RvuT\nbJzE", "output": "1" }, { "input": "PPS\nydq", "output": "-1" }, { "input": "q\nq", "output": "0" }, { "input": "peOw\nIgSJ", "output": "1" }, { "input": "PyK\noKN", "output": "1" }, { "input": "O\ni", "output": "1" }, { "input": "NmGY\npDlP", "output": "-1" }, { "input": "nG\nZf", "output": "-1" }, { "input": "m\na", "output": "1" }, { "input": "MWyB\nWZEV", "output": "-1" }, { "input": "Gre\nfxc", "output": "1" }, { "input": "Ooq\nwap", "output": "-1" }, { "input": "XId\nlbB", "output": "1" }, { "input": "lfFpECEqUMEOJhipvkZjDPcpDNJedOVXiSMgBvBZbtfzIKekcvpWPCazKAhJyHircRtgcBIJwwstpHaLAgxFOngAWUZRgCef\nLfFPEcequmeojHIpVkzjDPcpdNJEDOVXiSmGBVBZBtfZikEKcvPwpCAzKAHJyHIrCRTgCbIJWwSTphALagXfOnGAwUzRGcEF", "output": "0" }, { "input": "DQBdtSEDtFGiNRUeJNbOIfDZnsryUlzJHGTXGFXnwsVyxNtLgmklmFvRCzYETBVdmkpJJIvIOkMDgCFHZOTODiYrkwXd\nDQbDtsEdTFginRUEJNBOIfdZnsryulZJHGtxGFxnwSvYxnTLgmKlmFVRCzyEtBVdmKpJjiVioKMDgCFhzoTODiYrKwXD", "output": "0" }, { "input": "tYWRijFQSzHBpCjUzqBtNvBKyzZRnIdWEuyqnORBQTLyOQglIGfYJIRjuxnbLvkqZakNqPiGDvgpWYkfxYNXsdoKXZtRkSasfa\nTYwRiJfqsZHBPcJuZQBTnVbkyZZRnidwEuYQnorbQTLYOqGligFyjirJUxnblVKqZaknQpigDVGPwyKfxyNXSDoKxztRKSaSFA", "output": "0" }, { "input": "KhScXYiErQIUtmVhNTCXSLAviefIeHIIdiGhsYnPkSBaDTvMkyanfMLBOvDWgRybLtDqvXVdVjccNunDyijhhZEAKBrdz\nkHsCXyiErqIuTMVHNTCxSLaViEFIEhIIDiGHsYNpKsBAdTvMKyANFMLBovdwGRYbLtdQVxvDVJCcNUndYiJHhzeakBrdZ", "output": "0" }, { "input": "cpPQMpjRQJKQVXjWDYECXbagSmNcVfOuBWNZxihdERraVuiOpSVDCPgTGuSQALNoVjySceHcKXwOEpSzXrEqWwwrYeppNiWhDVg\nCPPqmPjRqJkQvxJwdyECXBAGsMNcVfOuBWNzxIhderRavUiOpSvDCpGTgusqAlNovjyScEhCKXwoePSZxrEQwWwryEPPniWHDvG", "output": "0" }, { "input": "SajcCGMepaLjZIWLRBGFcrZRCRvvoCsIyKsQerbrwsIamxxpRmQSZSalasJLVFbCHCuXJlubciQAvLxXYBazLsMKLHLdDQ\nsaJcCgmEpaLJziWlrBgFcRzrCrVVOcSIykSQerBrwSIamxxPrMqSzSalASjLVFbChCUxjLUbCIQAVlxxybAZLsmkLhLDdQ", "output": "0" }, { "input": "kigPrWNTOUNDBskAfefjhHYZNYdnfZWuXWzHiBxFQryBbAkPtenFwWvCSTYGpzOntUNzNUhxRWjKmicTwLwJAnbAxj\nkigpRWntOUNdBsKaFEFjhhYZnYDNfzWuXwZhibxFQRybbakPteNfwwvcStyGPzoNTunznuHXrWjKMIctWLWJANBAxJ", "output": "0" }, { "input": "nTomZZuTTRTAAPoUsySVFGElrpQRNLjqvFmcYytiheQnjUhPLnqNBiYtQkljbcvmjuNAVKbvQOWpqqFlQhAhULIhquoCnjUI\nntOmzZuttrtAAPOUSySVFgeLRPQrNLjQvfmCyYTiHEQnjuHPlNQNbIYtqKLJBCVmjunavkbvQOWPQQFlqHaHULIHQuOcnJUi", "output": "0" }, { "input": "abac\nadaa", "output": "-1" }, { "input": "Bbc\nabc", "output": "1" }, { "input": "aaaba\naaaab", "output": "1" } ]

1,699,006,915

2,147,483,647

Python 3

OK

TESTS

53

92

0

a = str(input()) b = str(input()) if a.lower()>b.lower(): print (1) elif a.lower()<b.lower(): print (-1) else: print (0)

Title: Petya and Strings Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Little Petya loves presents. His mum bought him two strings of the same size for his birthday. The strings consist of uppercase and lowercase Latin letters. Now Petya wants to compare those two strings lexicographically. The letters' case does not matter, that is an uppercase letter is considered equivalent to the corresponding lowercase letter. Help Petya perform the comparison. Input Specification: Each of the first two lines contains a bought string. The strings' lengths range from 1 to 100 inclusive. It is guaranteed that the strings are of the same length and also consist of uppercase and lowercase Latin letters. Output Specification: If the first string is less than the second one, print "-1". If the second string is less than the first one, print "1". If the strings are equal, print "0". Note that the letters' case is not taken into consideration when the strings are compared. Demo Input: ['aaaa\naaaA\n', 'abs\nAbz\n', 'abcdefg\nAbCdEfF\n'] Demo Output: ['0\n', '-1\n', '1\n'] Note: If you want more formal information about the lexicographical order (also known as the "dictionary order" or "alphabetical order"), you can visit the following site: - http://en.wikipedia.org/wiki/Lexicographical_order

```python a = str(input()) b = str(input()) if a.lower()>b.lower(): print (1) elif a.lower()<b.lower(): print (-1) else: print (0) ```

3.977

597

A

Divisibility

PROGRAMMING

1,600

[ "math" ]

null

Find the number of *k*-divisible numbers on the segment [*a*,<=*b*]. In other words you need to find the number of such integer values *x* that *a*<=≤<=*x*<=≤<=*b* and *x* is divisible by *k*.

The only line contains three space-separated integers *k*, *a* and *b* (1<=≤<=*k*<=≤<=1018;<=-<=1018<=≤<=*a*<=≤<=*b*<=≤<=1018).

Print the required number.

[ "1 1 10\n", "2 -4 4\n" ]

[ "10\n", "5\n" ]

none

500

[ { "input": "1 1 10", "output": "10" }, { "input": "2 -4 4", "output": "5" }, { "input": "1 1 1", "output": "1" }, { "input": "1 0 0", "output": "1" }, { "input": "1 0 1", "output": "2" }, { "input": "1 10181 10182", "output": "2" }, { "input": "1 10182 10183", "output": "2" }, { "input": "1 -191 1011", "output": "1203" }, { "input": "2 0 0", "output": "1" }, { "input": "2 0 1", "output": "1" }, { "input": "2 1 2", "output": "1" }, { "input": "2 2 3", "output": "1" }, { "input": "2 -1 0", "output": "1" }, { "input": "2 -1 1", "output": "1" }, { "input": "2 -7 -6", "output": "1" }, { "input": "2 -7 -5", "output": "1" }, { "input": "2 -6 -6", "output": "1" }, { "input": "2 -6 -4", "output": "2" }, { "input": "2 -6 13", "output": "10" }, { "input": "2 -19171 1911", "output": "10541" }, { "input": "3 123 456", "output": "112" }, { "input": "3 124 456", "output": "111" }, { "input": "3 125 456", "output": "111" }, { "input": "3 381 281911", "output": "93844" }, { "input": "3 381 281912", "output": "93844" }, { "input": "3 381 281913", "output": "93845" }, { "input": "3 382 281911", "output": "93843" }, { "input": "3 382 281912", "output": "93843" }, { "input": "3 382 281913", "output": "93844" }, { "input": "3 383 281911", "output": "93843" }, { "input": "3 383 281912", "output": "93843" }, { "input": "3 383 281913", "output": "93844" }, { "input": "3 -381 281911", "output": "94098" }, { "input": "3 -381 281912", "output": "94098" }, { "input": "3 -381 281913", "output": "94099" }, { "input": "3 -380 281911", "output": "94097" }, { "input": "3 -380 281912", "output": "94097" }, { "input": "3 -380 281913", "output": "94098" }, { "input": "3 -379 281911", "output": "94097" }, { "input": "3 -379 281912", "output": "94097" }, { "input": "3 -379 281913", "output": "94098" }, { "input": "3 -191381 -1911", "output": "63157" }, { "input": "3 -191381 -1910", "output": "63157" }, { "input": "3 -191381 -1909", "output": "63157" }, { "input": "3 -191380 -1911", "output": "63157" }, { "input": "3 -191380 -1910", "output": "63157" }, { "input": "3 -191380 -1909", "output": "63157" }, { "input": "3 -191379 -1911", "output": "63157" }, { "input": "3 -191379 -1910", "output": "63157" }, { "input": "3 -191379 -1909", "output": "63157" }, { "input": "3 -2810171 0", "output": "936724" }, { "input": "3 0 29101", "output": "9701" }, { "input": "3 -2810170 0", "output": "936724" }, { "input": "3 0 29102", "output": "9701" }, { "input": "3 -2810169 0", "output": "936724" }, { "input": "3 0 29103", "output": "9702" }, { "input": "1 -1000000000000000000 1000000000000000000", "output": "2000000000000000001" }, { "input": "2 -1000000000000000000 1000000000000000000", "output": "1000000000000000001" }, { "input": "3 -1000000000000000000 1000000000000000000", "output": "666666666666666667" }, { "input": "4 -1000000000000000000 1000000000000000000", "output": "500000000000000001" }, { "input": "5 -1000000000000000000 1000000000000000000", "output": "400000000000000001" }, { "input": "6 -1000000000000000000 1000000000000000000", "output": "333333333333333333" }, { "input": "7 -1000000000000000000 1000000000000000000", "output": "285714285714285715" }, { "input": "1 -1000000000000000000 -100000000000000000", "output": "900000000000000001" }, { "input": "2 -1000000000000000000 -10000000000000000", "output": "495000000000000001" }, { "input": "3 -1000000000000000000 -10218000000000000", "output": "329927333333333334" }, { "input": "4 -1000000000000000000 -320110181919100", "output": "249919972454520226" }, { "input": "5 -1000000000000000000 -402710171917", "output": "199999919457965617" }, { "input": "6 -1000000000000000000 -6666666666", "output": "166666665555555556" }, { "input": "7 -1000000000000000000 -77777777777778", "output": "142846031746031746" }, { "input": "1000000000000000000 -1000000000000000000 1000000000000000000", "output": "3" }, { "input": "1000000000000000000 0 1000000000000000000", "output": "2" }, { "input": "1000000000000000000 1000000000000000000 1000000000000000000", "output": "1" }, { "input": "100000000000000321 1000000000000000000 1000000000000000000", "output": "0" }, { "input": "100000000000000321 -1000000000000000000 1000000000000000000", "output": "19" }, { "input": "1000000000000000000 0 0", "output": "1" }, { "input": "1000000000000000000 1 1", "output": "0" }, { "input": "1000000000000000000 -1 -1", "output": "0" }, { "input": "1000000000000000000 -2 -1", "output": "0" }, { "input": "142000000000000271 -228118171 -1382811", "output": "0" }, { "input": "1 1 1000000000000000000", "output": "1000000000000000000" } ]

1,596,437,560

2,147,483,647

PyPy 3

OK

TESTS

81

140

20,172,800

k,a,b = list(map(int,input().split(" "))) a -= 1 print(b//k-a//k)

Title: Divisibility Time Limit: None seconds Memory Limit: None megabytes Problem Description: Find the number of *k*-divisible numbers on the segment [*a*,<=*b*]. In other words you need to find the number of such integer values *x* that *a*<=≤<=*x*<=≤<=*b* and *x* is divisible by *k*. Input Specification: The only line contains three space-separated integers *k*, *a* and *b* (1<=≤<=*k*<=≤<=1018;<=-<=1018<=≤<=*a*<=≤<=*b*<=≤<=1018). Output Specification: Print the required number. Demo Input: ['1 1 10\n', '2 -4 4\n'] Demo Output: ['10\n', '5\n'] Note: none

```python k,a,b = list(map(int,input().split(" "))) a -= 1 print(b//k-a//k) ```

3

271

A

Beautiful Year

PROGRAMMING

800

[ "brute force" ]

null

It seems like the year of 2013 came only yesterday. Do you know a curious fact? The year of 2013 is the first year after the old 1987 with only distinct digits. Now you are suggested to solve the following problem: given a year number, find the minimum year number which is strictly larger than the given one and has only distinct digits.

The single line contains integer *y* (1000<=≤<=*y*<=≤<=9000) — the year number.

Print a single integer — the minimum year number that is strictly larger than *y* and all it's digits are distinct. It is guaranteed that the answer exists.

[ "1987\n", "2013\n" ]

[ "2013\n", "2014\n" ]

none

500

[ { "input": "1987", "output": "2013" }, { "input": "2013", "output": "2014" }, { "input": "1000", "output": "1023" }, { "input": "1001", "output": "1023" }, { "input": "1234", "output": "1235" }, { "input": "5555", "output": "5601" }, { "input": "9000", "output": "9012" }, { "input": "1111", "output": "1203" }, { "input": "8999", "output": "9012" }, { "input": "4572", "output": "4573" }, { "input": "6666", "output": "6701" }, { "input": "2001", "output": "2013" }, { "input": "3000", "output": "3012" }, { "input": "7712", "output": "7801" }, { "input": "8088", "output": "8091" }, { "input": "1594", "output": "1596" }, { "input": "6016", "output": "6017" }, { "input": "8800", "output": "8901" }, { "input": "3331", "output": "3401" }, { "input": "5090", "output": "5091" }, { "input": "2342", "output": "2345" }, { "input": "2334", "output": "2340" }, { "input": "1123", "output": "1203" }, { "input": "8989", "output": "9012" }, { "input": "8977", "output": "9012" }, { "input": "6869", "output": "6870" }, { "input": "8999", "output": "9012" } ]

1,695,837,904

2,147,483,647

Python 3

OK

TESTS

27

92

0

n=int(input()) for i in range(1,200): n=n+1 if len(set(str(n)))==4: print(n) break

Title: Beautiful Year Time Limit: None seconds Memory Limit: None megabytes Problem Description: It seems like the year of 2013 came only yesterday. Do you know a curious fact? The year of 2013 is the first year after the old 1987 with only distinct digits. Now you are suggested to solve the following problem: given a year number, find the minimum year number which is strictly larger than the given one and has only distinct digits. Input Specification: The single line contains integer *y* (1000<=≤<=*y*<=≤<=9000) — the year number. Output Specification: Print a single integer — the minimum year number that is strictly larger than *y* and all it's digits are distinct. It is guaranteed that the answer exists. Demo Input: ['1987\n', '2013\n'] Demo Output: ['2013\n', '2014\n'] Note: none

```python n=int(input()) for i in range(1,200): n=n+1 if len(set(str(n)))==4: print(n) break ```

3

279

B

Books

PROGRAMMING

1,400

[ "binary search", "brute force", "implementation", "two pointers" ]

null

When Valera has got some free time, he goes to the library to read some books. Today he's got *t* free minutes to read. That's why Valera took *n* books in the library and for each book he estimated the time he is going to need to read it. Let's number the books by integers from 1 to *n*. Valera needs *a**i* minutes to read the *i*-th book. Valera decided to choose an arbitrary book with number *i* and read the books one by one, starting from this book. In other words, he will first read book number *i*, then book number *i*<=+<=1, then book number *i*<=+<=2 and so on. He continues the process until he either runs out of the free time or finishes reading the *n*-th book. Valera reads each book up to the end, that is, he doesn't start reading the book if he doesn't have enough free time to finish reading it. Print the maximum number of books Valera can read.

The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=105; 1<=≤<=*t*<=≤<=109) — the number of books and the number of free minutes Valera's got. The second line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104), where number *a**i* shows the number of minutes that the boy needs to read the *i*-th book.

Print a single integer — the maximum number of books Valera can read.

[ "4 5\n3 1 2 1\n", "3 3\n2 2 3\n" ]

[ "3\n", "1\n" ]

none

1,000

[ { "input": "4 5\n3 1 2 1", "output": "3" }, { "input": "3 3\n2 2 3", "output": "1" }, { "input": "1 3\n5", "output": "0" }, { "input": "1 10\n4", "output": "1" }, { "input": "2 10\n6 4", "output": "2" }, { "input": "6 10\n2 3 4 2 1 1", "output": "4" }, { "input": "7 13\n6 8 14 9 4 11 10", "output": "2" }, { "input": "10 15\n10 9 1 1 5 10 5 3 7 2", "output": "3" }, { "input": "20 30\n8 1 2 6 9 4 1 9 9 10 4 7 8 9 5 7 1 8 7 4", "output": "6" }, { "input": "30 60\n16 13 22 38 13 35 17 17 20 38 12 19 9 22 20 3 35 34 34 21 35 40 22 3 27 19 12 4 8 19", "output": "4" }, { "input": "100 100\n75 92 18 6 81 67 7 92 100 65 82 32 50 67 85 31 80 91 84 63 39 52 92 81 1 98 24 12 43 48 17 86 51 72 48 95 45 50 12 66 19 79 49 89 34 1 97 75 20 33 96 27 42 23 73 71 93 1 85 19 66 14 17 61 20 39 36 33 42 61 56 64 23 91 80 99 40 74 13 18 98 85 74 39 62 84 46 74 50 23 38 11 79 14 9 25 66 100 25 52", "output": "3" }, { "input": "10 1\n4418 7528 8170 1736 1317 3205 8183 4995 8039 4708", "output": "0" }, { "input": "50 2\n124 214 63 73 996 760 38 571 451 300 970 1 706 937 837 494 619 88 851 411 957 990 842 613 821 649 627 34 693 678 734 116 816 985 705 940 499 493 922 967 854 439 112 644 961 438 189 572 655 550", "output": "1" } ]

1,683,884,876

2,147,483,647

Python 3

TIME_LIMIT_EXCEEDED

TESTS

8

2,000

12,697,600

n, t = map(int, input().split()) a = list(map(int, input().split())) def search(a, t): l = -1 r = len(a) while r - l > 1: i = (l + r) // 2 s = 0 for k in range(i+1): s += a[k] if s <= t: l = i else: r = i return l + 1 max_books = 0 j = 0 while j < n: books_read = search(a[j:], t) max_books = max(max_books, books_read) j += 1 print(max_books)

Title: Books Time Limit: None seconds Memory Limit: None megabytes Problem Description: When Valera has got some free time, he goes to the library to read some books. Today he's got *t* free minutes to read. That's why Valera took *n* books in the library and for each book he estimated the time he is going to need to read it. Let's number the books by integers from 1 to *n*. Valera needs *a**i* minutes to read the *i*-th book. Valera decided to choose an arbitrary book with number *i* and read the books one by one, starting from this book. In other words, he will first read book number *i*, then book number *i*<=+<=1, then book number *i*<=+<=2 and so on. He continues the process until he either runs out of the free time or finishes reading the *n*-th book. Valera reads each book up to the end, that is, he doesn't start reading the book if he doesn't have enough free time to finish reading it. Print the maximum number of books Valera can read. Input Specification: The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=105; 1<=≤<=*t*<=≤<=109) — the number of books and the number of free minutes Valera's got. The second line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104), where number *a**i* shows the number of minutes that the boy needs to read the *i*-th book. Output Specification: Print a single integer — the maximum number of books Valera can read. Demo Input: ['4 5\n3 1 2 1\n', '3 3\n2 2 3\n'] Demo Output: ['3\n', '1\n'] Note: none

```python n, t = map(int, input().split()) a = list(map(int, input().split())) def search(a, t): l = -1 r = len(a) while r - l > 1: i = (l + r) // 2 s = 0 for k in range(i+1): s += a[k] if s <= t: l = i else: r = i return l + 1 max_books = 0 j = 0 while j < n: books_read = search(a[j:], t) max_books = max(max_books, books_read) j += 1 print(max_books) ```

0

689

B

Mike and Shortcuts

PROGRAMMING

1,600

[ "dfs and similar", "graphs", "greedy", "shortest paths" ]

null

Recently, Mike was very busy with studying for exams and contests. Now he is going to chill a bit by doing some sight seeing in the city. City consists of *n* intersections numbered from 1 to *n*. Mike starts walking from his house located at the intersection number 1 and goes along some sequence of intersections. Walking from intersection number *i* to intersection *j* requires |*i*<=-<=*j*| units of energy. The total energy spent by Mike to visit a sequence of intersections *p*1<==<=1,<=*p*2,<=...,<=*p**k* is equal to units of energy. Of course, walking would be boring if there were no shortcuts. A shortcut is a special path that allows Mike walking from one intersection to another requiring only 1 unit of energy. There are exactly *n* shortcuts in Mike's city, the *i**th* of them allows walking from intersection *i* to intersection *a**i* (*i*<=≤<=*a**i*<=≤<=*a**i*<=+<=1) (but not in the opposite direction), thus there is exactly one shortcut starting at each intersection. Formally, if Mike chooses a sequence *p*1<==<=1,<=*p*2,<=...,<=*p**k* then for each 1<=≤<=*i*<=<<=*k* satisfying *p**i*<=+<=1<==<=*a**p**i* and *a**p**i*<=≠<=*p**i* Mike will spend only 1 unit of energy instead of |*p**i*<=-<=*p**i*<=+<=1| walking from the intersection *p**i* to intersection *p**i*<=+<=1. For example, if Mike chooses a sequence *p*1<==<=1,<=*p*2<==<=*a**p*1,<=*p*3<==<=*a**p*2,<=...,<=*p**k*<==<=*a**p**k*<=-<=1, he spends exactly *k*<=-<=1 units of total energy walking around them. Before going on his adventure, Mike asks you to find the minimum amount of energy required to reach each of the intersections from his home. Formally, for each 1<=≤<=*i*<=≤<=*n* Mike is interested in finding minimum possible total energy of some sequence *p*1<==<=1,<=*p*2,<=...,<=*p**k*<==<=*i*.

The first line contains an integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of Mike's city intersection. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (*i*<=≤<=*a**i*<=≤<=*n* , , describing shortcuts of Mike's city, allowing to walk from intersection *i* to intersection *a**i* using only 1 unit of energy. Please note that the shortcuts don't allow walking in opposite directions (from *a**i* to *i*).

In the only line print *n* integers *m*1,<=*m*2,<=...,<=*m**n*, where *m**i* denotes the least amount of total energy required to walk from intersection 1 to intersection *i*.

[ "3\n2 2 3\n", "5\n1 2 3 4 5\n", "7\n4 4 4 4 7 7 7\n" ]

[ "0 1 2 \n", "0 1 2 3 4 \n", "0 1 2 1 2 3 3 \n" ]

In the first sample case desired sequences are: 1: 1; *m*1 = 0; 2: 1, 2; *m*2 = 1; 3: 1, 3; *m*3 = |3 - 1| = 2. In the second sample case the sequence for any intersection 1 < *i* is always 1, *i* and *m**i* = |1 - *i*|. In the third sample case — consider the following intersection sequences: 1: 1; *m*1 = 0; 2: 1, 2; *m*2 = |2 - 1| = 1; 3: 1, 4, 3; *m*3 = 1 + |4 - 3| = 2; 4: 1, 4; *m*4 = 1; 5: 1, 4, 5; *m*5 = 1 + |4 - 5| = 2; 6: 1, 4, 6; *m*6 = 1 + |4 - 6| = 3; 7: 1, 4, 5, 7; *m*7 = 1 + |4 - 5| + 1 = 3.

1,000

[ { "input": "3\n2 2 3", "output": "0 1 2 " }, { "input": "5\n1 2 3 4 5", "output": "0 1 2 3 4 " }, { "input": "7\n4 4 4 4 7 7 7", "output": "0 1 2 1 2 3 3 " }, { "input": "98\n17 17 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 90 90 90 90 90 90 90 90 90 90 90 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 95 95 95 95 95 97 98 98", "output": "0 1 2 3 4 5 6 7 8 8 7 6 5 4 3 2 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 4 4 5 6 5 6 7 8 " }, { "input": "91\n4 6 23 23 23 23 23 28 39 39 39 39 39 39 39 39 39 39 39 39 39 39 39 39 39 39 39 39 39 39 47 47 47 54 54 54 54 54 54 54 58 58 58 58 58 58 69 69 69 69 69 69 69 69 69 69 69 69 70 70 70 70 70 70 70 70 70 70 71 72 72 72 73 75 77 77 77 82 82 84 84 84 84 84 85 86 87 89 89 90 91", "output": "0 1 2 1 2 2 3 4 5 6 7 8 9 10 10 9 8 7 6 5 4 3 2 3 4 5 6 5 6 7 8 9 9 8 7 6 5 4 3 4 5 6 7 8 9 10 9 10 9 8 7 6 5 4 5 6 7 6 7 8 9 10 11 10 9 8 7 6 5 6 6 7 8 9 10 11 11 12 13 14 14 13 14 14 15 16 17 18 19 20 21 " }, { "input": "82\n1 5 11 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 39 39 39 39 39 45 45 45 45 45 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 71 71 71 71 71 71 71 73 73 75 75 76 77 79 81 81 81 82", "output": "0 1 2 3 2 3 4 5 5 4 3 4 5 6 7 8 9 10 11 12 13 12 11 10 9 8 7 6 5 4 3 4 5 6 7 8 9 10 9 9 8 7 6 5 4 5 6 7 8 9 10 11 12 13 14 15 16 16 15 14 13 12 11 10 9 8 7 6 5 6 6 7 8 9 10 11 12 13 14 15 15 16 " }, { "input": "4\n2 3 3 4", "output": "0 1 2 3 " } ]

1,560,725,402

902

Python 3

WRONG_ANSWER

TESTS

3

93

0

n = int(input()) a = list(map(int, input().split())) INF = float('inf') dp = [INF] * (n + 1) dp[0] = 0 for i in range(n): dp[i + 1] = min(dp[i] + 1, dp[i + 1]) dp[a[i] - 1] = min(dp[a[i] - 1], dp[i] + 1) print(*dp[:-1])

Title: Mike and Shortcuts Time Limit: None seconds Memory Limit: None megabytes Problem Description: Recently, Mike was very busy with studying for exams and contests. Now he is going to chill a bit by doing some sight seeing in the city. City consists of *n* intersections numbered from 1 to *n*. Mike starts walking from his house located at the intersection number 1 and goes along some sequence of intersections. Walking from intersection number *i* to intersection *j* requires |*i*<=-<=*j*| units of energy. The total energy spent by Mike to visit a sequence of intersections *p*1<==<=1,<=*p*2,<=...,<=*p**k* is equal to units of energy. Of course, walking would be boring if there were no shortcuts. A shortcut is a special path that allows Mike walking from one intersection to another requiring only 1 unit of energy. There are exactly *n* shortcuts in Mike's city, the *i**th* of them allows walking from intersection *i* to intersection *a**i* (*i*<=≤<=*a**i*<=≤<=*a**i*<=+<=1) (but not in the opposite direction), thus there is exactly one shortcut starting at each intersection. Formally, if Mike chooses a sequence *p*1<==<=1,<=*p*2,<=...,<=*p**k* then for each 1<=≤<=*i*<=<<=*k* satisfying *p**i*<=+<=1<==<=*a**p**i* and *a**p**i*<=≠<=*p**i* Mike will spend only 1 unit of energy instead of |*p**i*<=-<=*p**i*<=+<=1| walking from the intersection *p**i* to intersection *p**i*<=+<=1. For example, if Mike chooses a sequence *p*1<==<=1,<=*p*2<==<=*a**p*1,<=*p*3<==<=*a**p*2,<=...,<=*p**k*<==<=*a**p**k*<=-<=1, he spends exactly *k*<=-<=1 units of total energy walking around them. Before going on his adventure, Mike asks you to find the minimum amount of energy required to reach each of the intersections from his home. Formally, for each 1<=≤<=*i*<=≤<=*n* Mike is interested in finding minimum possible total energy of some sequence *p*1<==<=1,<=*p*2,<=...,<=*p**k*<==<=*i*. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of Mike's city intersection. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (*i*<=≤<=*a**i*<=≤<=*n* , , describing shortcuts of Mike's city, allowing to walk from intersection *i* to intersection *a**i* using only 1 unit of energy. Please note that the shortcuts don't allow walking in opposite directions (from *a**i* to *i*). Output Specification: In the only line print *n* integers *m*1,<=*m*2,<=...,<=*m**n*, where *m**i* denotes the least amount of total energy required to walk from intersection 1 to intersection *i*. Demo Input: ['3\n2 2 3\n', '5\n1 2 3 4 5\n', '7\n4 4 4 4 7 7 7\n'] Demo Output: ['0 1 2 \n', '0 1 2 3 4 \n', '0 1 2 1 2 3 3 \n'] Note: In the first sample case desired sequences are: 1: 1; *m*1 = 0; 2: 1, 2; *m*2 = 1; 3: 1, 3; *m*3 = |3 - 1| = 2. In the second sample case the sequence for any intersection 1 < *i* is always 1, *i* and *m**i* = |1 - *i*|. In the third sample case — consider the following intersection sequences: 1: 1; *m*1 = 0; 2: 1, 2; *m*2 = |2 - 1| = 1; 3: 1, 4, 3; *m*3 = 1 + |4 - 3| = 2; 4: 1, 4; *m*4 = 1; 5: 1, 4, 5; *m*5 = 1 + |4 - 5| = 2; 6: 1, 4, 6; *m*6 = 1 + |4 - 6| = 3; 7: 1, 4, 5, 7; *m*7 = 1 + |4 - 5| + 1 = 3.

```python n = int(input()) a = list(map(int, input().split())) INF = float('inf') dp = [INF] * (n + 1) dp[0] = 0 for i in range(n): dp[i + 1] = min(dp[i] + 1, dp[i + 1]) dp[a[i] - 1] = min(dp[a[i] - 1], dp[i] + 1) print(*dp[:-1]) ```

0

41

A

Translation

PROGRAMMING

800

[ "implementation", "strings" ]

A. Translation

2

256

The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.

The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.

If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.

[ "code\nedoc\n", "abb\naba\n", "code\ncode\n" ]

[ "YES\n", "NO\n", "NO\n" ]

none

500

[ { "input": "code\nedoc", "output": "YES" }, { "input": "abb\naba", "output": "NO" }, { "input": "code\ncode", "output": "NO" }, { "input": "abacaba\nabacaba", "output": "YES" }, { "input": "q\nq", "output": "YES" }, { "input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk", "output": "NO" }, { "input": "z\na", "output": "NO" }, { "input": "asd\ndsa", "output": "YES" }, { "input": "abcdef\nfecdba", "output": "NO" }, { "input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu", "output": "NO" }, { "input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf", "output": "NO" }, { "input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp", "output": "NO" }, { "input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb", "output": "NO" }, { "input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom", "output": "NO" }, { "input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh", "output": "NO" }, { "input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy", "output": "NO" }, { "input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko", "output": "NO" }, { "input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv", "output": "NO" }, { "input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd", "output": "NO" }, { "input": "w\nw", "output": "YES" }, { "input": "vz\nzv", "output": "YES" }, { "input": "ry\nyr", "output": "YES" }, { "input": "xou\nuox", "output": "YES" }, { "input": "axg\ngax", "output": "NO" }, { "input": "zdsl\nlsdz", "output": "YES" }, { "input": "kudl\nldku", "output": "NO" }, { "input": "zzlzwnqlcl\nlclqnwzlzz", "output": "YES" }, { "input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv", "output": "YES" }, { "input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar", "output": "NO" }, { "input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn", "output": "YES" }, { "input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum", "output": "YES" }, { "input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv", "output": "YES" }, { "input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm", "output": "NO" }, { "input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd", "output": "NO" }, { "input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg", "output": "YES" }, { "input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis", "output": "YES" }, { "input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy", "output": "NO" }, { "input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw", "output": "YES" }, { "input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi", "output": "YES" }, { "input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib", "output": "YES" } ]

1,689,938,129

2,147,483,647

Python 3

OK

TESTS

40

92

0

x=input() y=input() if(x[::-1]==y):print("YES") else: print("NO")

Title: Translation Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. Input Specification: The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. Output Specification: If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. Demo Input: ['code\nedoc\n', 'abb\naba\n', 'code\ncode\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none

```python x=input() y=input() if(x[::-1]==y):print("YES") else: print("NO") ```

3.977

44

A

Indian Summer

PROGRAMMING

900

[ "implementation" ]

A. Indian Summer

2

256

Indian summer is such a beautiful time of the year! A girl named Alyona is walking in the forest and picking a bouquet from fallen leaves. Alyona is very choosy — she doesn't take a leaf if it matches the color and the species of the tree of one of the leaves she already has. Find out how many leaves Alyona has picked.

The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of leaves Alyona has found. The next *n* lines contain the leaves' descriptions. Each leaf is characterized by the species of the tree it has fallen from and by the color. The species of the trees and colors are given in names, consisting of no more than 10 lowercase Latin letters. A name can not be an empty string. The species of a tree and the color are given in each line separated by a space.

Output the single number — the number of Alyona's leaves.

[ "5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green\n", "3\noak yellow\noak yellow\noak yellow\n" ]

[ "4\n", "1\n" ]

none

0

[ { "input": "5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green", "output": "4" }, { "input": "3\noak yellow\noak yellow\noak yellow", "output": "1" }, { "input": "5\nxbnbkzn hp\nkaqkl vrgzbvqstu\nj aqidx\nhos gyul\nwefxmh tygpluae", "output": "5" }, { "input": "1\nqvwli hz", "output": "1" }, { "input": "4\nsrhk x\nsrhk x\nqfoe vnrjuab\nqfoe vnrjuab", "output": "2" }, { "input": "4\nsddqllmmpk syded\nfprsq fnenjnaz\nn hdej\nsddqllmmpk syded", "output": "3" }, { "input": "17\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw", "output": "1" }, { "input": "18\nb d\nrfdb esp\nrfdb esp\nb d\nrfdb esp\nrfdb esp\nb d\nb d\nrfdb esp\nrfdb esp\nb d\nrfdb esp\nb d\nrfdb esp\nb d\nb d\nrfdb esp\nrfdb esp", "output": "2" }, { "input": "13\nsvpzwtwn rykzfdce\nqweiyeck jkreouy\nhk nnli\ntwxrnbbdt vtuv\nxokqjtylly sz\nesdt dbfidjslq\ng ybqgomvw\nxcpfjmf zcqvz\nifajadhj invzueip\nvdemdnxifb hckwebmi\nsdpnhipam wvowzavh\nuqdlfskhgo vunbpghae\ne dtigwnb", "output": "13" }, { "input": "20\nm vkfh\nvptikamead mvx\nitu mf\nklruxckw aqega\nekqkd enjllwol\ncc uybfdh\nimrfdngvo u\ne uh\ntwt jsslcfuogk\nbljwqsag tuqbdn\nqcv q\nasx gzhvwwmajj\nqcv q\nekqkd enjllwol\nasx gzhvwwmajj\nks vv\nkzyfi cn\ncc uybfdh\nitu mf\ncjbjhtbyvk vatwfmux", "output": "15" }, { "input": "2\nab ab\na bab", "output": "2" } ]

1,651,939,112

2,147,483,647

Python 3

OK

TESTS

29

92

0

n=int(input()) l=[] for i in range(n): s=input() l.append(s) le=len(set(l)) print(le)

Title: Indian Summer Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Indian summer is such a beautiful time of the year! A girl named Alyona is walking in the forest and picking a bouquet from fallen leaves. Alyona is very choosy — she doesn't take a leaf if it matches the color and the species of the tree of one of the leaves she already has. Find out how many leaves Alyona has picked. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of leaves Alyona has found. The next *n* lines contain the leaves' descriptions. Each leaf is characterized by the species of the tree it has fallen from and by the color. The species of the trees and colors are given in names, consisting of no more than 10 lowercase Latin letters. A name can not be an empty string. The species of a tree and the color are given in each line separated by a space. Output Specification: Output the single number — the number of Alyona's leaves. Demo Input: ['5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green\n', '3\noak yellow\noak yellow\noak yellow\n'] Demo Output: ['4\n', '1\n'] Note: none

```python n=int(input()) l=[] for i in range(n): s=input() l.append(s) le=len(set(l)) print(le) ```

3.977

78

B

Easter Eggs

PROGRAMMING

1,200

[ "constructive algorithms", "implementation" ]

B. Easter Eggs

2

256

The Easter Rabbit laid *n* eggs in a circle and is about to paint them. Each egg should be painted one color out of 7: red, orange, yellow, green, blue, indigo or violet. Also, the following conditions should be satisfied: - Each of the seven colors should be used to paint at least one egg. - Any four eggs lying sequentially should be painted different colors. Help the Easter Rabbit paint the eggs in the required manner. We know that it is always possible.

The only line contains an integer *n* — the amount of eggs (7<=≤<=*n*<=≤<=100).

Print one line consisting of *n* characters. The *i*-th character should describe the color of the *i*-th egg in the order they lie in the circle. The colors should be represented as follows: "R" stands for red, "O" stands for orange, "Y" stands for yellow, "G" stands for green, "B" stands for blue, "I" stands for indigo, "V" stands for violet. If there are several answers, print any of them.

[ "8\n", "13\n" ]

[ "ROYGRBIV\n", "ROYGBIVGBIVYG\n" ]

The way the eggs will be painted in the first sample is shown on the picture:

1,000

[ { "input": "8", "output": "ROYGBIVG" }, { "input": "13", "output": "ROYGBIVOYGBIV" }, { "input": "7", "output": "ROYGBIV" }, { "input": "10", "output": "ROYGBIVYGB" }, { "input": "14", "output": "ROYGBIVROYGBIV" }, { "input": "50", "output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVG" }, { "input": "9", "output": "ROYGBIVGB" }, { "input": "11", "output": "ROYGBIVYGBI" }, { "input": "12", "output": "ROYGBIVOYGBI" }, { "input": "15", "output": "ROYGBIVROYGBIVG" }, { "input": "16", "output": "ROYGBIVROYGBIVGB" }, { "input": "17", "output": "ROYGBIVROYGBIVYGB" }, { "input": "18", "output": "ROYGBIVROYGBIVYGBI" }, { "input": "19", "output": "ROYGBIVROYGBIVOYGBI" }, { "input": "20", "output": "ROYGBIVROYGBIVOYGBIV" }, { "input": "21", "output": "ROYGBIVROYGBIVROYGBIV" }, { "input": "22", "output": "ROYGBIVROYGBIVROYGBIVG" }, { "input": "23", "output": "ROYGBIVROYGBIVROYGBIVGB" }, { "input": "24", "output": "ROYGBIVROYGBIVROYGBIVYGB" }, { "input": "25", "output": "ROYGBIVROYGBIVROYGBIVYGBI" }, { "input": "28", "output": "ROYGBIVROYGBIVROYGBIVROYGBIV" }, { "input": "29", "output": "ROYGBIVROYGBIVROYGBIVROYGBIVG" }, { "input": "34", "output": "ROYGBIVROYGBIVROYGBIVROYGBIVOYGBIV" }, { "input": "43", "output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVG" }, { "input": "61", "output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVOYGBI" }, { "input": "79", "output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVGB" }, { "input": "81", "output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVYGBI" }, { "input": "92", "output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVG" }, { "input": "95", "output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVYGBI" }, { "input": "96", "output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVOYGBI" }, { "input": "97", "output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVOYGBIV" }, { "input": "98", "output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIV" }, { "input": "99", "output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVG" }, { "input": "100", "output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVGB" } ]

1,561,709,204

2,147,483,647

Python 3

OK

TESTS

34

218

0

hat = int(input()) lst = ['R', 'O', 'Y', 'G', 'B', 'I', 'V'] new = "" if hat == 7: print("".join(lst)) elif hat == 8: print("ROYGRBIV") elif hat == 9: print("ROYGROBIV") elif hat == 10: print("ROYGROYBIV") else: new += "".join(lst) * int(hat / 7) x = 3 for i in range(hat % 7): if x > 6: x = 3 new += lst[x] x += 1 print(new)

Title: Easter Eggs Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The Easter Rabbit laid *n* eggs in a circle and is about to paint them. Each egg should be painted one color out of 7: red, orange, yellow, green, blue, indigo or violet. Also, the following conditions should be satisfied: - Each of the seven colors should be used to paint at least one egg. - Any four eggs lying sequentially should be painted different colors. Help the Easter Rabbit paint the eggs in the required manner. We know that it is always possible. Input Specification: The only line contains an integer *n* — the amount of eggs (7<=≤<=*n*<=≤<=100). Output Specification: Print one line consisting of *n* characters. The *i*-th character should describe the color of the *i*-th egg in the order they lie in the circle. The colors should be represented as follows: "R" stands for red, "O" stands for orange, "Y" stands for yellow, "G" stands for green, "B" stands for blue, "I" stands for indigo, "V" stands for violet. If there are several answers, print any of them. Demo Input: ['8\n', '13\n'] Demo Output: ['ROYGRBIV\n', 'ROYGBIVGBIVYG\n'] Note: The way the eggs will be painted in the first sample is shown on the picture:

```python hat = int(input()) lst = ['R', 'O', 'Y', 'G', 'B', 'I', 'V'] new = "" if hat == 7: print("".join(lst)) elif hat == 8: print("ROYGRBIV") elif hat == 9: print("ROYGROBIV") elif hat == 10: print("ROYGROYBIV") else: new += "".join(lst) * int(hat / 7) x = 3 for i in range(hat % 7): if x > 6: x = 3 new += lst[x] x += 1 print(new) ```

3.9455

69

A

Young Physicist

PROGRAMMING

1,000

[ "implementation", "math" ]

A. Young Physicist

2

256

A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.

The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).

Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.

[ "3\n4 1 7\n-2 4 -1\n1 -5 -3\n", "3\n3 -1 7\n-5 2 -4\n2 -1 -3\n" ]

[ "NO", "YES" ]

none

500

[ { "input": "3\n4 1 7\n-2 4 -1\n1 -5 -3", "output": "NO" }, { "input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3", "output": "YES" }, { "input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41", "output": "NO" }, { "input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33", "output": "NO" }, { "input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7", "output": "NO" }, { "input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38", "output": "NO" }, { "input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6", "output": "YES" }, { "input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0", "output": "YES" }, { "input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0", "output": "YES" }, { "input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0", "output": "YES" }, { "input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0", "output": "YES" }, { "input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0", "output": "YES" }, { "input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87", "output": "YES" }, { "input": "3\n1 2 3\n3 2 1\n0 0 0", "output": "NO" }, { "input": "2\n5 -23 12\n0 0 0", "output": "NO" }, { "input": "1\n0 0 0", "output": "YES" }, { "input": "1\n1 -2 0", "output": "NO" }, { "input": "2\n-23 77 -86\n23 -77 86", "output": "YES" }, { "input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82", "output": "YES" }, { "input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0", "output": "YES" }, { "input": "3\n96 49 -12\n2 -66 28\n-98 17 -16", "output": "YES" }, { "input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0", "output": "YES" }, { "input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53", "output": "YES" }, { "input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1", "output": "YES" }, { "input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0", "output": "YES" }, { "input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0", "output": "YES" }, { "input": "3\n0 2 -2\n1 -1 3\n-3 0 0", "output": "NO" } ]

1,605,428,503

2,147,483,647

Python 3

OK

TESTS

81

218

307,200

n=int(input()) lista=[] for i in range(n): l=list(map(int,input().split())) lista.append(l) x=0 y=0 z=0 for i in range(n): for j in range(2): if j==0: x+=lista[i][j] if j==1: y+=lista[i][j] if j==2: z+=lista[i][j] if x==0 and y==0 and z==0: print("YES") else: print("NO")

Title: Young Physicist Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. Input Specification: The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). Output Specification: Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. Demo Input: ['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n'] Demo Output: ['NO', 'YES'] Note: none

```python n=int(input()) lista=[] for i in range(n): l=list(map(int,input().split())) lista.append(l) x=0 y=0 z=0 for i in range(n): for j in range(2): if j==0: x+=lista[i][j] if j==1: y+=lista[i][j] if j==2: z+=lista[i][j] if x==0 and y==0 and z==0: print("YES") else: print("NO") ```

3.944928

47

B

Coins

PROGRAMMING

1,200

[ "implementation" ]

B. Coins

2

256

One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal.

The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters «A», «B» and «C». Each result is a line that appears as (letter)(> or < sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A<B.

It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters «A», «B» and «C» which represent the coins in the increasing order of their weights.

[ "A>B\nC<B\nA>C\n", "A<B\nB>C\nC>A\n" ]

[ "CBA", "ACB" ]

none

1,000

[ { "input": "A>B\nC<B\nA>C", "output": "CBA" }, { "input": "A<B\nB>C\nC>A", "output": "ACB" }, { "input": "A<C\nB<A\nB>C", "output": "Impossible" }, { "input": "A<B\nA<C\nB>C", "output": "ACB" }, { "input": "B>A\nC<B\nC>A", "output": "ACB" }, { "input": "A>B\nB>C\nC<A", "output": "CBA" }, { "input": "A>C\nA>B\nB<C", "output": "BCA" }, { "input": "C<B\nB>A\nA<C", "output": "ACB" }, { "input": "C<B\nA>B\nC<A", "output": "CBA" }, { "input": "C>B\nB>A\nA<C", "output": "ABC" }, { "input": "C<B\nB<A\nC>A", "output": "Impossible" }, { "input": "B<C\nC<A\nA>B", "output": "BCA" }, { "input": "A>B\nC<B\nC<A", "output": "CBA" }, { "input": "B>A\nC>B\nA>C", "output": "Impossible" }, { "input": "B<A\nC>B\nC>A", "output": "BAC" }, { "input": "A<B\nC>B\nA<C", "output": "ABC" }, { "input": "A<B\nC<A\nB<C", "output": "Impossible" }, { "input": "A>C\nC<B\nB>A", "output": "CAB" }, { "input": "C>A\nA<B\nB>C", "output": "ACB" }, { "input": "C>A\nC<B\nB>A", "output": "ACB" }, { "input": "B>C\nB>A\nA<C", "output": "ACB" }, { "input": "C<B\nC<A\nB<A", "output": "CBA" }, { "input": "A<C\nA<B\nB>C", "output": "ACB" }, { "input": "B>A\nA>C\nB>C", "output": "CAB" }, { "input": "B<A\nA<C\nC<B", "output": "Impossible" }, { "input": "A<C\nB>C\nA>B", "output": "Impossible" }, { "input": "B>A\nC<A\nC>B", "output": "Impossible" }, { "input": "A>C\nC>B\nB<A", "output": "BCA" }, { "input": "B<C\nB<A\nA>C", "output": "BCA" }, { "input": "A>B\nC>B\nA<C", "output": "BAC" }, { "input": "C<B\nC<A\nB<A", "output": "CBA" }, { "input": "A<C\nA>B\nB>C", "output": "Impossible" }, { "input": "B>A\nB>C\nA<C", "output": "ACB" }, { "input": "B>C\nC<A\nB<A", "output": "CBA" }, { "input": "C>A\nB>A\nB>C", "output": "ACB" }, { "input": "B<A\nB>C\nA<C", "output": "Impossible" }, { "input": "B<C\nA<B\nC>A", "output": "ABC" }, { "input": "C<B\nB>A\nA>C", "output": "CAB" }, { "input": "A>B\nC>A\nB<C", "output": "BAC" }, { "input": "A>B\nB>C\nC<A", "output": "CBA" }, { "input": "B>C\nC>A\nA>B", "output": "Impossible" }, { "input": "B<A\nB>C\nC<A", "output": "CBA" }, { "input": "C>B\nB>A\nC>A", "output": "ABC" }, { "input": "A>C\nA>B\nB>C", "output": "CBA" }, { "input": "B<C\nA>B\nA<C", "output": "BAC" }, { "input": "C>A\nC<B\nB>A", "output": "ACB" }, { "input": "C>B\nA<B\nC<A", "output": "Impossible" }, { "input": "A<C\nC<B\nA>B", "output": "Impossible" }, { "input": "B>C\nA<B\nA<C", "output": "ACB" }, { "input": "C>A\nA<B\nC>B", "output": "ABC" } ]

1,638,086,118

2,147,483,647

Python 3

RUNTIME_ERROR

TESTS

2

62

0

#!/usr/bin/env python # coding=utf-8 ''' Author: Deean Date: 2021-11-28 15:43:48 LastEditTime: 2021-11-28 15:52:28 Description: Coins FilePath: CF47B.py ''' def func(): left, right = [], [] for _ in range(3): s = input().strip() if "<" in s: a, b = s.split("<") else: b, a = s.split(">") left.append(a) right.append(b) for item in left: if left.count(item) == 2: minimum = item break else: print("Impossible") for item in right: if right.count(item) == 2: maximum = item break else: print("Impossible") print(minimum + "ABC".replace(minimum, "").replace(maximum, "") + maximum) if __name__ == '__main__': func()

Title: Coins Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal. Input Specification: The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters «A», «B» and «C». Each result is a line that appears as (letter)(> or < sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A<B. Output Specification: It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters «A», «B» and «C» which represent the coins in the increasing order of their weights. Demo Input: ['A>B\nC<B\nA>C\n', 'A<B\nB>C\nC>A\n'] Demo Output: ['CBA', 'ACB'] Note: none

```python #!/usr/bin/env python # coding=utf-8 ''' Author: Deean Date: 2021-11-28 15:43:48 LastEditTime: 2021-11-28 15:52:28 Description: Coins FilePath: CF47B.py ''' def func(): left, right = [], [] for _ in range(3): s = input().strip() if "<" in s: a, b = s.split("<") else: b, a = s.split(">") left.append(a) right.append(b) for item in left: if left.count(item) == 2: minimum = item break else: print("Impossible") for item in right: if right.count(item) == 2: maximum = item break else: print("Impossible") print(minimum + "ABC".replace(minimum, "").replace(maximum, "") + maximum) if __name__ == '__main__': func() ```

-1

118

A

String Task

PROGRAMMING

1,000

[ "implementation", "strings" ]

null

Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it: - deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones. Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string. Help Petya cope with this easy task.

The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.

Print the resulting string. It is guaranteed that this string is not empty.

[ "tour\n", "Codeforces\n", "aBAcAba\n" ]

[ ".t.r\n", ".c.d.f.r.c.s\n", ".b.c.b\n" ]

none

500

[ { "input": "tour", "output": ".t.r" }, { "input": "Codeforces", "output": ".c.d.f.r.c.s" }, { "input": "aBAcAba", "output": ".b.c.b" }, { "input": "obn", "output": ".b.n" }, { "input": "wpwl", "output": ".w.p.w.l" }, { "input": "ggdvq", "output": ".g.g.d.v.q" }, { "input": "pumesz", "output": ".p.m.s.z" }, { "input": "g", "output": ".g" }, { "input": "zjuotps", "output": ".z.j.t.p.s" }, { "input": "jzbwuehe", "output": ".j.z.b.w.h" }, { "input": "tnkgwuugu", "output": ".t.n.k.g.w.g" }, { "input": "kincenvizh", "output": ".k.n.c.n.v.z.h" }, { "input": "xattxjenual", "output": ".x.t.t.x.j.n.l" }, { "input": "ktajqhpqsvhw", "output": ".k.t.j.q.h.p.q.s.v.h.w" }, { "input": "xnhcigytnqcmy", "output": ".x.n.h.c.g.t.n.q.c.m" }, { "input": "jfmtbejyilxcec", "output": ".j.f.m.t.b.j.l.x.c.c" }, { "input": "D", "output": ".d" }, { "input": "ab", "output": ".b" }, { "input": "Ab", "output": ".b" }, { "input": "aB", "output": ".b" }, { "input": "AB", "output": ".b" }, { "input": "ba", "output": ".b" }, { "input": "bA", "output": ".b" }, { "input": "Ba", "output": ".b" }, { "input": "BA", "output": ".b" }, { "input": "aab", "output": ".b" }, { "input": "baa", "output": ".b" }, { "input": "femOZeCArKCpUiHYnbBPTIOFmsHmcpObtPYcLCdjFrUMIyqYzAokKUiiKZRouZiNMoiOuGVoQzaaCAOkquRjmmKKElLNqCnhGdQM", "output": ".f.m.z.c.r.k.c.p.h.n.b.b.p.t.f.m.s.h.m.c.p.b.t.p.c.l.c.d.j.f.r.m.q.z.k.k.k.z.r.z.n.m.g.v.q.z.c.k.q.r.j.m.m.k.k.l.l.n.q.c.n.h.g.d.q.m" }, { "input": "VMBPMCmMDCLFELLIISUJDWQRXYRDGKMXJXJHXVZADRZWVWJRKFRRNSAWKKDPZZLFLNSGUNIVJFBEQsMDHSBJVDTOCSCgZWWKvZZN", "output": ".v.m.b.p.m.c.m.m.d.c.l.f.l.l.s.j.d.w.q.r.x.r.d.g.k.m.x.j.x.j.h.x.v.z.d.r.z.w.v.w.j.r.k.f.r.r.n.s.w.k.k.d.p.z.z.l.f.l.n.s.g.n.v.j.f.b.q.s.m.d.h.s.b.j.v.d.t.c.s.c.g.z.w.w.k.v.z.z.n" }, { "input": "MCGFQQJNUKuAEXrLXibVjClSHjSxmlkQGTKZrRaDNDomIPOmtSgjJAjNVIVLeUGUAOHNkCBwNObVCHOWvNkLFQQbFnugYVMkJruJ", "output": ".m.c.g.f.q.q.j.n.k.x.r.l.x.b.v.j.c.l.s.h.j.s.x.m.l.k.q.g.t.k.z.r.r.d.n.d.m.p.m.t.s.g.j.j.j.n.v.v.l.g.h.n.k.c.b.w.n.b.v.c.h.w.v.n.k.l.f.q.q.b.f.n.g.v.m.k.j.r.j" }, { "input": "iyaiuiwioOyzUaOtAeuEYcevvUyveuyioeeueoeiaoeiavizeeoeyYYaaAOuouueaUioueauayoiuuyiuovyOyiyoyioaoyuoyea", "output": ".w.z.t.c.v.v.v.v.z.v" }, { "input": "yjnckpfyLtzwjsgpcrgCfpljnjwqzgVcufnOvhxplvflxJzqxnhrwgfJmPzifgubvspffmqrwbzivatlmdiBaddiaktdsfPwsevl", "output": ".j.n.c.k.p.f.l.t.z.w.j.s.g.p.c.r.g.c.f.p.l.j.n.j.w.q.z.g.v.c.f.n.v.h.x.p.l.v.f.l.x.j.z.q.x.n.h.r.w.g.f.j.m.p.z.f.g.b.v.s.p.f.f.m.q.r.w.b.z.v.t.l.m.d.b.d.d.k.t.d.s.f.p.w.s.v.l" }, { "input": "RIIIUaAIYJOiuYIUWFPOOAIuaUEZeIooyUEUEAoIyIHYOEAlVAAIiLUAUAeiUIEiUMuuOiAgEUOIAoOUYYEYFEoOIIVeOOAOIIEg", "output": ".r.j.w.f.p.z.h.l.v.l.m.g.f.v.g" }, { "input": "VBKQCFBMQHDMGNSGBQVJTGQCNHHRJMNKGKDPPSQRRVQTZNKBZGSXBPBRXPMVFTXCHZMSJVBRNFNTHBHGJLMDZJSVPZZBCCZNVLMQ", "output": ".v.b.k.q.c.f.b.m.q.h.d.m.g.n.s.g.b.q.v.j.t.g.q.c.n.h.h.r.j.m.n.k.g.k.d.p.p.s.q.r.r.v.q.t.z.n.k.b.z.g.s.x.b.p.b.r.x.p.m.v.f.t.x.c.h.z.m.s.j.v.b.r.n.f.n.t.h.b.h.g.j.l.m.d.z.j.s.v.p.z.z.b.c.c.z.n.v.l.m.q" }, { "input": "iioyoaayeuyoolyiyoeuouiayiiuyTueyiaoiueyioiouyuauouayyiaeoeiiigmioiououeieeeyuyyaYyioiiooaiuouyoeoeg", "output": ".l.t.g.m.g" }, { "input": "ueyiuiauuyyeueykeioouiiauzoyoeyeuyiaoaiiaaoaueyaeydaoauexuueafouiyioueeaaeyoeuaueiyiuiaeeayaioeouiuy", "output": ".k.z.d.x.f" }, { "input": "FSNRBXLFQHZXGVMKLQDVHWLDSLKGKFMDRQWMWSSKPKKQBNDZRSCBLRSKCKKFFKRDMZFZGCNSMXNPMZVDLKXGNXGZQCLRTTDXLMXQ", "output": ".f.s.n.r.b.x.l.f.q.h.z.x.g.v.m.k.l.q.d.v.h.w.l.d.s.l.k.g.k.f.m.d.r.q.w.m.w.s.s.k.p.k.k.q.b.n.d.z.r.s.c.b.l.r.s.k.c.k.k.f.f.k.r.d.m.z.f.z.g.c.n.s.m.x.n.p.m.z.v.d.l.k.x.g.n.x.g.z.q.c.l.r.t.t.d.x.l.m.x.q" }, { "input": "EYAYAYIOIOYOOAUOEUEUOUUYIYUUMOEOIIIAOIUOAAOIYOIOEUIERCEYYAOIOIGYUIAOYUEOEUAEAYPOYEYUUAUOAOEIYIEYUEEY", "output": ".m.r.c.g.p" }, { "input": "jvvzcdcxjstbbksmqjsngxkgtttdxrljjxtwptgwwqzpvqchvgrkqlzxmptzblxhhsmrkmzzmgdfskhtmmnqzzflpmqdctvrfgtx", "output": ".j.v.v.z.c.d.c.x.j.s.t.b.b.k.s.m.q.j.s.n.g.x.k.g.t.t.t.d.x.r.l.j.j.x.t.w.p.t.g.w.w.q.z.p.v.q.c.h.v.g.r.k.q.l.z.x.m.p.t.z.b.l.x.h.h.s.m.r.k.m.z.z.m.g.d.f.s.k.h.t.m.m.n.q.z.z.f.l.p.m.q.d.c.t.v.r.f.g.t.x" }, { "input": "YB", "output": ".b" }, { "input": "fly", "output": ".f.l" }, { "input": "YyyYYYyyYxdwdawdDAWDdaddYYYY", "output": ".x.d.w.d.w.d.d.w.d.d.d.d" } ]

1,695,719,220

2,147,483,647

Python 3

WRONG_ANSWER

TESTS

0

60

0

#2300012302张惠雯 a=input() a=a.lower() list1=[] vowel=['a','e','i','o','u','y'] consonant=['b','c','d','f','g','h','j','k','l','m','n','p','q','r','s','t','v','w','x','z'] for x in a: list1.append(x) for element in list1: for x in range(len(vowel)): if vowel[x]==element: list1.remove(element) continue print(list1) n=len(list1) for num in range(0,2*(n-1)): list1.insert(2*num,'.') str='' print(str.join(list1))

Title: String Task Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it: - deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones. Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string. Help Petya cope with this easy task. Input Specification: The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive. Output Specification: Print the resulting string. It is guaranteed that this string is not empty. Demo Input: ['tour\n', 'Codeforces\n', 'aBAcAba\n'] Demo Output: ['.t.r\n', '.c.d.f.r.c.s\n', '.b.c.b\n'] Note: none

```python #2300012302张惠雯 a=input() a=a.lower() list1=[] vowel=['a','e','i','o','u','y'] consonant=['b','c','d','f','g','h','j','k','l','m','n','p','q','r','s','t','v','w','x','z'] for x in a: list1.append(x) for element in list1: for x in range(len(vowel)): if vowel[x]==element: list1.remove(element) continue print(list1) n=len(list1) for num in range(0,2*(n-1)): list1.insert(2*num,'.') str='' print(str.join(list1)) ```

0

711

C

Coloring Trees

PROGRAMMING

1,700

[ "dp" ]

null

ZS the Coder and Chris the Baboon has arrived at Udayland! They walked in the park where *n* trees grow. They decided to be naughty and color the trees in the park. The trees are numbered with integers from 1 to *n* from left to right. Initially, tree *i* has color *c**i*. ZS the Coder and Chris the Baboon recognizes only *m* different colors, so 0<=≤<=*c**i*<=≤<=*m*, where *c**i*<==<=0 means that tree *i* is uncolored. ZS the Coder and Chris the Baboon decides to color only the uncolored trees, i.e. the trees with *c**i*<==<=0. They can color each of them them in any of the *m* colors from 1 to *m*. Coloring the *i*-th tree with color *j* requires exactly *p**i*,<=*j* litres of paint. The two friends define the beauty of a coloring of the trees as the minimum number of contiguous groups (each group contains some subsegment of trees) you can split all the *n* trees into so that each group contains trees of the same color. For example, if the colors of the trees from left to right are 2,<=1,<=1,<=1,<=3,<=2,<=2,<=3,<=1,<=3, the beauty of the coloring is 7, since we can partition the trees into 7 contiguous groups of the same color : {2},<={1,<=1,<=1},<={3},<={2,<=2},<={3},<={1},<={3}. ZS the Coder and Chris the Baboon wants to color all uncolored trees so that the beauty of the coloring is exactly *k*. They need your help to determine the minimum amount of paint (in litres) needed to finish the job. Please note that the friends can't color the trees that are already colored.

The first line contains three integers, *n*, *m* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=100, 1<=≤<=*m*<=≤<=100) — the number of trees, number of colors and beauty of the resulting coloring respectively. The second line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (0<=≤<=*c**i*<=≤<=*m*), the initial colors of the trees. *c**i* equals to 0 if the tree number *i* is uncolored, otherwise the *i*-th tree has color *c**i*. Then *n* lines follow. Each of them contains *m* integers. The *j*-th number on the *i*-th of them line denotes *p**i*,<=*j* (1<=≤<=*p**i*,<=*j*<=≤<=109) — the amount of litres the friends need to color *i*-th tree with color *j*. *p**i*,<=*j*'s are specified even for the initially colored trees, but such trees still can't be colored.

Print a single integer, the minimum amount of paint needed to color the trees. If there are no valid tree colorings of beauty *k*, print <=-<=1.

[ "3 2 2\n0 0 0\n1 2\n3 4\n5 6\n", "3 2 2\n2 1 2\n1 3\n2 4\n3 5\n", "3 2 2\n2 0 0\n1 3\n2 4\n3 5\n", "3 2 3\n2 1 2\n1 3\n2 4\n3 5\n" ]

[ "10", "-1", "5", "0" ]

In the first sample case, coloring the trees with colors 2, 1, 1 minimizes the amount of paint used, which equals to 2 + 3 + 5 = 10. Note that 1, 1, 1 would not be valid because the beauty of such coloring equals to 1 ({1, 1, 1} is a way to group the trees into a single group of the same color). In the second sample case, all the trees are colored, but the beauty of the coloring is 3, so there is no valid coloring, and the answer is - 1. In the last sample case, all the trees are colored and the beauty of the coloring matches *k*, so no paint is used and the answer is 0.

1,500

[ { "input": "3 2 2\n0 0 0\n1 2\n3 4\n5 6", "output": "10" }, { "input": "3 2 2\n2 1 2\n1 3\n2 4\n3 5", "output": "-1" }, { "input": "3 2 2\n2 0 0\n1 3\n2 4\n3 5", "output": "5" }, { "input": "3 2 3\n2 1 2\n1 3\n2 4\n3 5", "output": "0" }, { "input": "3 2 3\n0 0 0\n10 30000\n20000 1000000000\n1000000000 50000", "output": "100000" }, { "input": "4 2 1\n0 0 0 0\n10 30000\n20000 1000000000\n1000000000 50000\n55 55", "output": "1000020065" }, { "input": "4 2 1\n0 0 0 2\n10 30000\n20000 1000000000\n1000000000 50000\n55 55", "output": "1000080000" }, { "input": "1 1 1\n0\n5", "output": "5" }, { "input": "1 10 1\n0\n1 2 20 1000000000 41 23 39 55 44 1234567", "output": "1" }, { "input": "1 1 1\n1\n5", "output": "0" }, { "input": "8 6 6\n0 0 0 0 0 0 0 0\n709812879 751993522 552838834 932579085 381597201 889756688\n77223016 35398130 932703875 852137134 124534767 472656085\n828677108 158247840 540181954 573979204 389860841 490718346\n666733838 404533406 50010075 311518758 460372535 69832342\n591244215 400838850 867732307 113910196 445904988 184328895\n564004525 89903316 756707872 628355859 689211716 85839524\n272478028 286740424 178709321 86780970 947181211 809721979\n813772965 663391037 731882431 804451037 31893872 744734983", "output": "1014096507" }, { "input": "4 4 3\n4 3 2 1\n608531991 110838465 78523745 621397088\n923748933 697335134 350140891 422577481\n907779022 895436439 216021587 50630582\n120114007 984106338 70847223 755445813", "output": "-1" }, { "input": "1 3 1\n0\n3 2 1", "output": "1" } ]

1,629,733,807

2,147,483,647

PyPy 3

OK

TESTS

143

1,606

57,651,200

import sys input = sys.stdin.readline MAX = int(1e18) n,m,b = list(map(int,input().split())) c = list(map(int,input().split())) p = [0]*n d = [[[0 for _ in range(0,107)] for _ in range(0,107)] for _ in range(0,107)] for i in range(0,n): p[i] = list(map(int,input().split())) for i in range(1,n+1): for j in range(1,m+1): for k in range(0,b+1): if (k==0) or (k > (i)): d[i][j][k] = MAX elif k <= (i): if c[i-1]!=0 and c[i-1]!=j: d[i][j][k] = MAX else: mn = MAX for l in range(1,m+1): if(l!=j): mn = min(mn,d[i-1][l][k-1]) d[i][j][k] = min(mn,d[i-1][j][k]) + (c[i-1]==0)*(p[i-1][j-1]) ans = MAX for i in range(1,m+1): ans = min(ans,d[n][i][b]) print(-1 if ans==MAX else ans)

Title: Coloring Trees Time Limit: None seconds Memory Limit: None megabytes Problem Description: ZS the Coder and Chris the Baboon has arrived at Udayland! They walked in the park where *n* trees grow. They decided to be naughty and color the trees in the park. The trees are numbered with integers from 1 to *n* from left to right. Initially, tree *i* has color *c**i*. ZS the Coder and Chris the Baboon recognizes only *m* different colors, so 0<=≤<=*c**i*<=≤<=*m*, where *c**i*<==<=0 means that tree *i* is uncolored. ZS the Coder and Chris the Baboon decides to color only the uncolored trees, i.e. the trees with *c**i*<==<=0. They can color each of them them in any of the *m* colors from 1 to *m*. Coloring the *i*-th tree with color *j* requires exactly *p**i*,<=*j* litres of paint. The two friends define the beauty of a coloring of the trees as the minimum number of contiguous groups (each group contains some subsegment of trees) you can split all the *n* trees into so that each group contains trees of the same color. For example, if the colors of the trees from left to right are 2,<=1,<=1,<=1,<=3,<=2,<=2,<=3,<=1,<=3, the beauty of the coloring is 7, since we can partition the trees into 7 contiguous groups of the same color : {2},<={1,<=1,<=1},<={3},<={2,<=2},<={3},<={1},<={3}. ZS the Coder and Chris the Baboon wants to color all uncolored trees so that the beauty of the coloring is exactly *k*. They need your help to determine the minimum amount of paint (in litres) needed to finish the job. Please note that the friends can't color the trees that are already colored. Input Specification: The first line contains three integers, *n*, *m* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=100, 1<=≤<=*m*<=≤<=100) — the number of trees, number of colors and beauty of the resulting coloring respectively. The second line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (0<=≤<=*c**i*<=≤<=*m*), the initial colors of the trees. *c**i* equals to 0 if the tree number *i* is uncolored, otherwise the *i*-th tree has color *c**i*. Then *n* lines follow. Each of them contains *m* integers. The *j*-th number on the *i*-th of them line denotes *p**i*,<=*j* (1<=≤<=*p**i*,<=*j*<=≤<=109) — the amount of litres the friends need to color *i*-th tree with color *j*. *p**i*,<=*j*'s are specified even for the initially colored trees, but such trees still can't be colored. Output Specification: Print a single integer, the minimum amount of paint needed to color the trees. If there are no valid tree colorings of beauty *k*, print <=-<=1. Demo Input: ['3 2 2\n0 0 0\n1 2\n3 4\n5 6\n', '3 2 2\n2 1 2\n1 3\n2 4\n3 5\n', '3 2 2\n2 0 0\n1 3\n2 4\n3 5\n', '3 2 3\n2 1 2\n1 3\n2 4\n3 5\n'] Demo Output: ['10', '-1', '5', '0'] Note: In the first sample case, coloring the trees with colors 2, 1, 1 minimizes the amount of paint used, which equals to 2 + 3 + 5 = 10. Note that 1, 1, 1 would not be valid because the beauty of such coloring equals to 1 ({1, 1, 1} is a way to group the trees into a single group of the same color). In the second sample case, all the trees are colored, but the beauty of the coloring is 3, so there is no valid coloring, and the answer is - 1. In the last sample case, all the trees are colored and the beauty of the coloring matches *k*, so no paint is used and the answer is 0.

```python import sys input = sys.stdin.readline MAX = int(1e18) n,m,b = list(map(int,input().split())) c = list(map(int,input().split())) p = [0]*n d = [[[0 for _ in range(0,107)] for _ in range(0,107)] for _ in range(0,107)] for i in range(0,n): p[i] = list(map(int,input().split())) for i in range(1,n+1): for j in range(1,m+1): for k in range(0,b+1): if (k==0) or (k > (i)): d[i][j][k] = MAX elif k <= (i): if c[i-1]!=0 and c[i-1]!=j: d[i][j][k] = MAX else: mn = MAX for l in range(1,m+1): if(l!=j): mn = min(mn,d[i-1][l][k-1]) d[i][j][k] = min(mn,d[i-1][j][k]) + (c[i-1]==0)*(p[i-1][j-1]) ans = MAX for i in range(1,m+1): ans = min(ans,d[n][i][b]) print(-1 if ans==MAX else ans) ```

3