contestId
int64
0
1.01k
index
stringclasses
57 values
name
stringlengths
2
58
type
stringclasses
2 values
rating
int64
0
3.5k
tags
listlengths
0
11
title
stringclasses
522 values
time-limit
stringclasses
8 values
memory-limit
stringclasses
8 values
problem-description
stringlengths
0
7.15k
input-specification
stringlengths
0
2.05k
output-specification
stringlengths
0
1.5k
demo-input
listlengths
0
7
demo-output
listlengths
0
7
note
stringlengths
0
5.24k
points
float64
0
425k
test_cases
listlengths
0
402
creationTimeSeconds
int64
1.37B
1.7B
relativeTimeSeconds
int64
8
2.15B
programmingLanguage
stringclasses
3 values
verdict
stringclasses
14 values
testset
stringclasses
12 values
passedTestCount
int64
0
1k
timeConsumedMillis
int64
0
15k
memoryConsumedBytes
int64
0
805M
code
stringlengths
3
65.5k
prompt
stringlengths
262
8.2k
response
stringlengths
17
65.5k
score
float64
-1
3.99
10
A
Power Consumption Calculation
PROGRAMMING
900
[ "implementation" ]
A. Power Consumption Calculation
1
256
Tom is interested in power consumption of his favourite laptop. His laptop has three modes. In normal mode laptop consumes *P*1 watt per minute. *T*1 minutes after Tom moved the mouse or touched the keyboard for the last time, a screensaver starts and power consumption changes to *P*2 watt per minute. Finally, after *T*2 minutes from the start of the screensaver, laptop switches to the "sleep" mode and consumes *P*3 watt per minute. If Tom moves the mouse or touches the keyboard when the laptop is in the second or in the third mode, it switches to the first (normal) mode. Tom's work with the laptop can be divided into *n* time periods [*l*1,<=*r*1],<=[*l*2,<=*r*2],<=...,<=[*l**n*,<=*r**n*]. During each interval Tom continuously moves the mouse and presses buttons on the keyboard. Between the periods Tom stays away from the laptop. Find out the total amount of power consumed by the laptop during the period [*l*1,<=*r**n*].
The first line contains 6 integer numbers *n*, *P*1, *P*2, *P*3, *T*1, *T*2 (1<=≤<=*n*<=≤<=100,<=0<=≤<=*P*1,<=*P*2,<=*P*3<=≤<=100,<=1<=≤<=*T*1,<=*T*2<=≤<=60). The following *n* lines contain description of Tom's work. Each *i*-th of these lines contains two space-separated integers *l**i* and *r**i* (0<=≤<=*l**i*<=&lt;<=*r**i*<=≤<=1440, *r**i*<=&lt;<=*l**i*<=+<=1 for *i*<=&lt;<=*n*), which stand for the start and the end of the *i*-th period of work.
Output the answer to the problem.
[ "1 3 2 1 5 10\n0 10\n", "2 8 4 2 5 10\n20 30\n50 100\n" ]
[ "30", "570" ]
none
0
[ { "input": "1 3 2 1 5 10\n0 10", "output": "30" }, { "input": "2 8 4 2 5 10\n20 30\n50 100", "output": "570" }, { "input": "3 15 9 95 39 19\n873 989\n1003 1137\n1172 1436", "output": "8445" }, { "input": "4 73 2 53 58 16\n51 52\n209 242\n281 407\n904 945", "output": "52870" }, { "input": "5 41 20 33 43 4\n46 465\n598 875\n967 980\n1135 1151\n1194 1245", "output": "46995" }, { "input": "6 88 28 100 53 36\n440 445\n525 614\n644 844\n1238 1261\n1305 1307\n1425 1434", "output": "85540" }, { "input": "7 46 61 55 28 59\n24 26\n31 61\n66 133\n161 612\n741 746\n771 849\n1345 1357", "output": "67147" }, { "input": "8 83 18 30 28 5\n196 249\n313 544\n585 630\n718 843\n1040 1194\n1207 1246\n1268 1370\n1414 1422", "output": "85876" }, { "input": "9 31 65 27 53 54\n164 176\n194 210\n485 538\n617 690\n875 886\n888 902\n955 957\n1020 1200\n1205 1282", "output": "38570" }, { "input": "30 3 1 58 44 7\n11 13\n14 32\n37 50\n70 74\n101 106\n113 129\n184 195\n197 205\n213 228\n370 394\n443 446\n457 460\n461 492\n499 585\n602 627\n709 776\n812 818\n859 864\n910 913\n918 964\n1000 1010\n1051 1056\n1063 1075\n1106 1145\n1152 1189\n1211 1212\n1251 1259\n1272 1375\n1412 1417\n1430 1431", "output": "11134" }, { "input": "30 42 3 76 28 26\n38 44\n55 66\n80 81\n84 283\n298 314\n331 345\n491 531\n569 579\n597 606\n612 617\n623 701\n723 740\n747 752\n766 791\n801 827\n842 846\n853 891\n915 934\n945 949\n955 964\n991 1026\n1051 1059\n1067 1179\n1181 1191\n1214 1226\n1228 1233\n1294 1306\n1321 1340\n1371 1374\n1375 1424", "output": "59043" }, { "input": "30 46 5 93 20 46\n12 34\n40 41\n54 58\n100 121\n162 182\n220 349\n358 383\n390 398\n401 403\n408 409\n431 444\n466 470\n471 535\n556 568\n641 671\n699 709\n767 777\n786 859\n862 885\n912 978\n985 997\n1013 1017\n1032 1038\n1047 1048\n1062 1080\n1094 1097\n1102 1113\n1122 1181\n1239 1280\n1320 1369", "output": "53608" }, { "input": "30 50 74 77 4 57\n17 23\n24 61\n67 68\n79 87\n93 101\n104 123\n150 192\n375 377\n398 414\n461 566\n600 633\n642 646\n657 701\n771 808\n812 819\n823 826\n827 833\n862 875\n880 891\n919 920\n928 959\n970 1038\n1057 1072\n1074 1130\n1165 1169\n1171 1230\n1265 1276\n1279 1302\n1313 1353\n1354 1438", "output": "84067" }, { "input": "30 54 76 95 48 16\n9 11\n23 97\n112 116\n126 185\n214 223\n224 271\n278 282\n283 348\n359 368\n373 376\n452 463\n488 512\n532 552\n646 665\n681 685\n699 718\n735 736\n750 777\n791 810\n828 838\n841 858\n874 1079\n1136 1171\n1197 1203\n1210 1219\n1230 1248\n1280 1292\n1324 1374\n1397 1435\n1438 1439", "output": "79844" }, { "input": "30 58 78 12 41 28\n20 26\n27 31\n35 36\n38 99\n103 104\n106 112\n133 143\n181 246\n248 251\n265 323\n350 357\n378 426\n430 443\n466 476\n510 515\n517 540\n542 554\n562 603\n664 810\n819 823\n826 845\n869 895\n921 973\n1002 1023\n1102 1136\n1143 1148\n1155 1288\n1316 1388\n1394 1403\n1434 1437", "output": "82686" }, { "input": "30 62 80 97 25 47\n19 20\n43 75\n185 188\n199 242\n252 258\n277 310\n316 322\n336 357\n398 399\n404 436\n443 520\n549 617\n637 649\n679 694\n705 715\n725 730\n731 756\n768 793\n806 833\n834 967\n1003 1079\n1088 1097\n1100 1104\n1108 1121\n1127 1164\n1240 1263\n1274 1307\n1367 1407\n1419 1425\n1433 1437", "output": "92356" }, { "input": "30 100 48 14 9 7\n26 55\n75 107\n145 146\n158 167\n197 199\n201 213\n222 238\n257 265\n271 338\n357 439\n454 462\n463 562\n633 660\n670 691\n696 829\n844 864\n880 888\n891 894\n895 900\n950 973\n1004 1007\n1018 1021\n1045 1049\n1062 1073\n1138 1184\n1240 1272\n1278 1315\n1403 1410\n1412 1418\n1426 1434", "output": "107490" }, { "input": "30 3 50 32 1 18\n46 60\n66 94\n99 141\n162 239\n309 334\n400 550\n594 630\n659 663\n664 701\n735 736\n741 755\n756 801\n823 854\n865 915\n937 964\n984 986\n990 1007\n1008 1031\n1052 1064\n1073 1080\n1190 1191\n1192 1254\n1265 1266\n1272 1273\n1274 1277\n1284 1302\n1308 1312\n1358 1383\n1388 1389\n1390 1401", "output": "25258" }, { "input": "30 7 52 49 46 37\n2 73\n129 130\n131 140\n143 150\n187 190\n217 238\n248 271\n375 426\n465 470\n475 503\n506 541\n569 571\n578 585\n680 683\n690 738\n742 761\n868 877\n890 892\n904 915\n935 961\n1076 1100\n1103 1114\n1232 1244\n1246 1247\n1257 1261\n1271 1276\n1280 1298\n1346 1360\n1373 1382\n1407 1419", "output": "23992" } ]
1,572,695,690
2,147,483,647
Python 3
OK
TESTS
30
248
0
X = list(map(int, input().split())) First = list(map(int, input().split())) Sum, Last = (First[1] - First[0]) * X[1], First[1] for i in range(1, X[0]): Temp = list(map(int, input().split())) Sum += (Temp[1] - Temp[0]) * X[1] + min(X[-2], Temp[0] - Last) * X[1] + max( min(X[-1], (Temp[0] - Last) - X[-2]), 0) * X[2] + max((Temp[0] - Last) - (X[-2] + X[-1]), 0) * X[3] Last = Temp[1] print(Sum)
Title: Power Consumption Calculation Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Tom is interested in power consumption of his favourite laptop. His laptop has three modes. In normal mode laptop consumes *P*1 watt per minute. *T*1 minutes after Tom moved the mouse or touched the keyboard for the last time, a screensaver starts and power consumption changes to *P*2 watt per minute. Finally, after *T*2 minutes from the start of the screensaver, laptop switches to the "sleep" mode and consumes *P*3 watt per minute. If Tom moves the mouse or touches the keyboard when the laptop is in the second or in the third mode, it switches to the first (normal) mode. Tom's work with the laptop can be divided into *n* time periods [*l*1,<=*r*1],<=[*l*2,<=*r*2],<=...,<=[*l**n*,<=*r**n*]. During each interval Tom continuously moves the mouse and presses buttons on the keyboard. Between the periods Tom stays away from the laptop. Find out the total amount of power consumed by the laptop during the period [*l*1,<=*r**n*]. Input Specification: The first line contains 6 integer numbers *n*, *P*1, *P*2, *P*3, *T*1, *T*2 (1<=≤<=*n*<=≤<=100,<=0<=≤<=*P*1,<=*P*2,<=*P*3<=≤<=100,<=1<=≤<=*T*1,<=*T*2<=≤<=60). The following *n* lines contain description of Tom's work. Each *i*-th of these lines contains two space-separated integers *l**i* and *r**i* (0<=≤<=*l**i*<=&lt;<=*r**i*<=≤<=1440, *r**i*<=&lt;<=*l**i*<=+<=1 for *i*<=&lt;<=*n*), which stand for the start and the end of the *i*-th period of work. Output Specification: Output the answer to the problem. Demo Input: ['1 3 2 1 5 10\n0 10\n', '2 8 4 2 5 10\n20 30\n50 100\n'] Demo Output: ['30', '570'] Note: none
```python X = list(map(int, input().split())) First = list(map(int, input().split())) Sum, Last = (First[1] - First[0]) * X[1], First[1] for i in range(1, X[0]): Temp = list(map(int, input().split())) Sum += (Temp[1] - Temp[0]) * X[1] + min(X[-2], Temp[0] - Last) * X[1] + max( min(X[-1], (Temp[0] - Last) - X[-2]), 0) * X[2] + max((Temp[0] - Last) - (X[-2] + X[-1]), 0) * X[3] Last = Temp[1] print(Sum) ```
3.876
814
C
An impassioned circulation of affection
PROGRAMMING
1,600
[ "brute force", "dp", "strings", "two pointers" ]
null
null
Nadeko's birthday is approaching! As she decorated the room for the party, a long garland of Dianthus-shaped paper pieces was placed on a prominent part of the wall. Brother Koyomi will like it! Still unsatisfied with the garland, Nadeko decided to polish it again. The garland has *n* pieces numbered from 1 to *n* from left to right, and the *i*-th piece has a colour *s**i*, denoted by a lowercase English letter. Nadeko will repaint at most *m* of the pieces to give each of them an arbitrary new colour (still denoted by a lowercase English letter). After this work, she finds out all subsegments of the garland containing pieces of only colour *c* — Brother Koyomi's favourite one, and takes the length of the longest among them to be the Koyomity of the garland. For instance, let's say the garland is represented by "kooomo", and Brother Koyomi's favourite colour is "o". Among all subsegments containing pieces of "o" only, "ooo" is the longest, with a length of 3. Thus the Koyomity of this garland equals 3. But problem arises as Nadeko is unsure about Brother Koyomi's favourite colour, and has swaying ideas on the amount of work to do. She has *q* plans on this, each of which can be expressed as a pair of an integer *m**i* and a lowercase letter *c**i*, meanings of which are explained above. You are to find out the maximum Koyomity achievable after repainting the garland according to each plan.
The first line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=1<=500) — the length of the garland. The second line contains *n* lowercase English letters *s*1*s*2... *s**n* as a string — the initial colours of paper pieces on the garland. The third line contains a positive integer *q* (1<=≤<=*q*<=≤<=200<=000) — the number of plans Nadeko has. The next *q* lines describe one plan each: the *i*-th among them contains an integer *m**i* (1<=≤<=*m**i*<=≤<=*n*) — the maximum amount of pieces to repaint, followed by a space, then by a lowercase English letter *c**i* — Koyomi's possible favourite colour.
Output *q* lines: for each work plan, output one line containing an integer — the largest Koyomity achievable after repainting the garland according to it.
[ "6\nkoyomi\n3\n1 o\n4 o\n4 m\n", "15\nyamatonadeshiko\n10\n1 a\n2 a\n3 a\n4 a\n5 a\n1 b\n2 b\n3 b\n4 b\n5 b\n", "10\naaaaaaaaaa\n2\n10 b\n10 z\n" ]
[ "3\n6\n5\n", "3\n4\n5\n7\n8\n1\n2\n3\n4\n5\n", "10\n10\n" ]
In the first sample, there are three plans: - In the first plan, at most 1 piece can be repainted. Repainting the "y" piece to become "o" results in "kooomi", whose Koyomity of 3 is the best achievable; - In the second plan, at most 4 pieces can be repainted, and "oooooo" results in a Koyomity of 6; - In the third plan, at most 4 pieces can be repainted, and "mmmmmi" and "kmmmmm" both result in a Koyomity of 5.
1,750
[ { "input": "6\nkoyomi\n3\n1 o\n4 o\n4 m", "output": "3\n6\n5" }, { "input": "15\nyamatonadeshiko\n10\n1 a\n2 a\n3 a\n4 a\n5 a\n1 b\n2 b\n3 b\n4 b\n5 b", "output": "3\n4\n5\n7\n8\n1\n2\n3\n4\n5" }, { "input": "10\naaaaaaaaaa\n2\n10 b\n10 z", "output": "10\n10" }, { "input": "1\nc\n4\n1 x\n1 a\n1 e\n1 t", "output": "1\n1\n1\n1" }, { "input": "20\naaaaaaaaaaaaaaaaaaaa\n1\n11 a", "output": "20" }, { "input": "4\ncbcc\n12\n4 b\n4 c\n1 b\n2 a\n3 b\n2 c\n4 a\n1 a\n2 b\n3 a\n1 c\n3 c", "output": "4\n4\n2\n2\n4\n4\n4\n1\n3\n3\n4\n4" }, { "input": "4\nddbb\n16\n3 c\n3 b\n1 a\n1 b\n4 d\n4 a\n3 d\n2 a\n2 d\n4 c\n3 a\n2 c\n4 b\n1 c\n2 b\n1 d", "output": "3\n4\n1\n3\n4\n4\n4\n2\n4\n4\n3\n2\n4\n1\n4\n3" }, { "input": "4\nabcc\n24\n1 c\n4 d\n3 c\n1 d\n1 c\n1 b\n3 b\n2 c\n3 d\n3 d\n4 c\n2 a\n4 d\n1 a\n1 b\n4 a\n4 d\n3 b\n4 b\n3 c\n3 a\n2 d\n1 a\n2 b", "output": "3\n4\n4\n1\n3\n2\n4\n4\n3\n3\n4\n3\n4\n2\n2\n4\n4\n4\n4\n4\n4\n2\n2\n3" }, { "input": "40\ncbbcbcccccacccccbbacbaabccbbabbaaaaacccc\n10\n40 a\n28 c\n25 c\n21 a\n18 c\n27 a\n9 c\n37 c\n15 a\n18 b", "output": "40\n40\n40\n31\n35\n37\n23\n40\n24\n27" }, { "input": "100\ndddddccccdddddaaaaabbbbbbbbbbbbbaaacdcabbacccacccccbdbbadddbbddddbdaaccacdddbbbaddddbbbbdcbbbdddddda\n50\n54 b\n48 d\n45 b\n52 c\n52 a\n48 a\n54 b\n45 a\n47 d\n50 d\n53 a\n34 a\n51 b\n48 d\n47 d\n47 a\n48 d\n53 b\n52 d\n54 d\n46 a\n38 a\n52 b\n49 a\n49 b\n46 c\n54 a\n45 b\n35 c\n55 c\n51 c\n46 d\n54 d\n50 a\n33 c\n46 a\n50 b\n50 a\n54 a\n32 b\n55 b\n49 c\n53 d\n49 a\n46 b\n48 c\n47 b\n47 b\n47 a\n46 b", "output": "85\n72\n76\n69\n68\n63\n85\n60\n71\n74\n69\n46\n82\n72\n71\n62\n72\n84\n76\n78\n61\n50\n83\n64\n80\n60\n70\n76\n49\n72\n68\n70\n78\n66\n47\n61\n81\n66\n70\n53\n86\n63\n77\n64\n77\n62\n78\n78\n62\n77" }, { "input": "200\nddeecdbbbeeeeebbbbbaaaaaaaaaaaaaaaaaaaaaaabbcaacccbeeeeddddddddddddccccccdffeeeeecccccbbbbaaaaedfffffaadeeeeeeeedddddaaaaaaaaaaaaaabbbbbcaadddeefffbbbbcccccccccccbbbbbbeeeeeeeffffffdffffffffffffaaaaab\n10\n43 f\n118 d\n165 f\n72 f\n48 f\n2 a\n61 e\n94 d\n109 f\n16 a", "output": "64\n144\n193\n98\n69\n25\n79\n117\n137\n41" }, { "input": "5\naaaaa\n1\n1 b", "output": "1" } ]
1,684,960,399
2,147,483,647
PyPy 3-64
OK
TESTS
37
592
11,571,200
import sys, functools, bisect, collections, string, math from math import gcd input = sys.stdin.readline rs = lambda: input().strip() ri = lambda: int(input()) rmi = lambda: map(int, input().split()) ra = lambda: [int(x) for x in input().split()] INF = 10**18 MOD = 10**9+7 N = 1502 dp = [[0]*N for _ in range(26)] test_case = 1 for _ in range(test_case): n = ri() s = rs() q = ri() for chr in range(26): for i in range(n): cnt = 0 for j in range(i,n): cnt += int(ord(s[j]) - ord('a') != chr) dp[chr][cnt] = max(dp[chr][cnt], j - i + 1) for k in range(1,N): dp[chr][k] = max(dp[chr][k], dp[chr][k-1]) for _ in range(q): x, c = input().split() x = int(x) print(dp[ord(c) - ord('a')][x])
Title: An impassioned circulation of affection Time Limit: None seconds Memory Limit: None megabytes Problem Description: Nadeko's birthday is approaching! As she decorated the room for the party, a long garland of Dianthus-shaped paper pieces was placed on a prominent part of the wall. Brother Koyomi will like it! Still unsatisfied with the garland, Nadeko decided to polish it again. The garland has *n* pieces numbered from 1 to *n* from left to right, and the *i*-th piece has a colour *s**i*, denoted by a lowercase English letter. Nadeko will repaint at most *m* of the pieces to give each of them an arbitrary new colour (still denoted by a lowercase English letter). After this work, she finds out all subsegments of the garland containing pieces of only colour *c* — Brother Koyomi's favourite one, and takes the length of the longest among them to be the Koyomity of the garland. For instance, let's say the garland is represented by "kooomo", and Brother Koyomi's favourite colour is "o". Among all subsegments containing pieces of "o" only, "ooo" is the longest, with a length of 3. Thus the Koyomity of this garland equals 3. But problem arises as Nadeko is unsure about Brother Koyomi's favourite colour, and has swaying ideas on the amount of work to do. She has *q* plans on this, each of which can be expressed as a pair of an integer *m**i* and a lowercase letter *c**i*, meanings of which are explained above. You are to find out the maximum Koyomity achievable after repainting the garland according to each plan. Input Specification: The first line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=1<=500) — the length of the garland. The second line contains *n* lowercase English letters *s*1*s*2... *s**n* as a string — the initial colours of paper pieces on the garland. The third line contains a positive integer *q* (1<=≤<=*q*<=≤<=200<=000) — the number of plans Nadeko has. The next *q* lines describe one plan each: the *i*-th among them contains an integer *m**i* (1<=≤<=*m**i*<=≤<=*n*) — the maximum amount of pieces to repaint, followed by a space, then by a lowercase English letter *c**i* — Koyomi's possible favourite colour. Output Specification: Output *q* lines: for each work plan, output one line containing an integer — the largest Koyomity achievable after repainting the garland according to it. Demo Input: ['6\nkoyomi\n3\n1 o\n4 o\n4 m\n', '15\nyamatonadeshiko\n10\n1 a\n2 a\n3 a\n4 a\n5 a\n1 b\n2 b\n3 b\n4 b\n5 b\n', '10\naaaaaaaaaa\n2\n10 b\n10 z\n'] Demo Output: ['3\n6\n5\n', '3\n4\n5\n7\n8\n1\n2\n3\n4\n5\n', '10\n10\n'] Note: In the first sample, there are three plans: - In the first plan, at most 1 piece can be repainted. Repainting the "y" piece to become "o" results in "kooomi", whose Koyomity of 3 is the best achievable; - In the second plan, at most 4 pieces can be repainted, and "oooooo" results in a Koyomity of 6; - In the third plan, at most 4 pieces can be repainted, and "mmmmmi" and "kmmmmm" both result in a Koyomity of 5.
```python import sys, functools, bisect, collections, string, math from math import gcd input = sys.stdin.readline rs = lambda: input().strip() ri = lambda: int(input()) rmi = lambda: map(int, input().split()) ra = lambda: [int(x) for x in input().split()] INF = 10**18 MOD = 10**9+7 N = 1502 dp = [[0]*N for _ in range(26)] test_case = 1 for _ in range(test_case): n = ri() s = rs() q = ri() for chr in range(26): for i in range(n): cnt = 0 for j in range(i,n): cnt += int(ord(s[j]) - ord('a') != chr) dp[chr][cnt] = max(dp[chr][cnt], j - i + 1) for k in range(1,N): dp[chr][k] = max(dp[chr][k], dp[chr][k-1]) for _ in range(q): x, c = input().split() x = int(x) print(dp[ord(c) - ord('a')][x]) ```
3
492
B
Vanya and Lanterns
PROGRAMMING
1,200
[ "binary search", "implementation", "math", "sortings" ]
null
null
Vanya walks late at night along a straight street of length *l*, lit by *n* lanterns. Consider the coordinate system with the beginning of the street corresponding to the point 0, and its end corresponding to the point *l*. Then the *i*-th lantern is at the point *a**i*. The lantern lights all points of the street that are at the distance of at most *d* from it, where *d* is some positive number, common for all lanterns. Vanya wonders: what is the minimum light radius *d* should the lanterns have to light the whole street?
The first line contains two integers *n*, *l* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*l*<=≤<=109) — the number of lanterns and the length of the street respectively. The next line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=*l*). Multiple lanterns can be located at the same point. The lanterns may be located at the ends of the street.
Print the minimum light radius *d*, needed to light the whole street. The answer will be considered correct if its absolute or relative error doesn't exceed 10<=-<=9.
[ "7 15\n15 5 3 7 9 14 0\n", "2 5\n2 5\n" ]
[ "2.5000000000\n", "2.0000000000\n" ]
Consider the second sample. At *d* = 2 the first lantern will light the segment [0, 4] of the street, and the second lantern will light segment [3, 5]. Thus, the whole street will be lit.
1,000
[ { "input": "7 15\n15 5 3 7 9 14 0", "output": "2.5000000000" }, { "input": "2 5\n2 5", "output": "2.0000000000" }, { "input": "46 615683844\n431749087 271781274 274974690 324606253 480870261 401650581 13285442 478090364 266585394 425024433 588791449 492057200 391293435 563090494 317950 173675329 473068378 356306865 311731938 192959832 321180686 141984626 578985584 512026637 175885185 590844074 47103801 212211134 330150 509886963 565955809 315640375 612907074 500474373 524310737 568681652 315339618 478782781 518873818 271322031 74600969 539099112 85129347 222068995 106014720 77282307", "output": "22258199.5000000000" }, { "input": "2 1000000000\n0 1000000000", "output": "500000000.0000000000" }, { "input": "2 555\n200 300", "output": "255.0000000000" }, { "input": "1 1\n1", "output": "1.0000000000" }, { "input": "1 1\n0", "output": "1.0000000000" }, { "input": "1 1000000000\n0", "output": "1000000000.0000000000" }, { "input": "1 1000000000\n1000000000", "output": "1000000000.0000000000" }, { "input": "1 999999999\n499999999", "output": "500000000.0000000000" }, { "input": "4 700\n0 250 475 700", "output": "125.0000000000" }, { "input": "4 700\n0 225 450 700", "output": "125.0000000000" }, { "input": "5 1000\n0 250 500 750 1000", "output": "125.0000000000" }, { "input": "5 2000\n1001 1001 1001 1001 1001", "output": "1001.0000000000" }, { "input": "1 999\n501", "output": "501.0000000000" }, { "input": "2 1000\n400 600", "output": "400.0000000000" }, { "input": "4 15\n1 3 9 11", "output": "4.0000000000" }, { "input": "1 5\n2", "output": "3.0000000000" } ]
1,689,948,585
2,147,483,647
Python 3
OK
TESTS
32
46
0
inp = input().split() sSize = inp[0] l = int(inp[1]) s = list(map(int,input().split())) s.sort() ledge = s[0] redge = l - s[len(s) - 1] maxdis = 0 if (len(s) == 1): print(max(ledge, redge)) exit(0) i = 1 while i < len(s): maxdis = max(maxdis, s[i] - s[i - 1]) i += 1 print(max(float(redge), float(ledge), (maxdis / 2)))
Title: Vanya and Lanterns Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vanya walks late at night along a straight street of length *l*, lit by *n* lanterns. Consider the coordinate system with the beginning of the street corresponding to the point 0, and its end corresponding to the point *l*. Then the *i*-th lantern is at the point *a**i*. The lantern lights all points of the street that are at the distance of at most *d* from it, where *d* is some positive number, common for all lanterns. Vanya wonders: what is the minimum light radius *d* should the lanterns have to light the whole street? Input Specification: The first line contains two integers *n*, *l* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*l*<=≤<=109) — the number of lanterns and the length of the street respectively. The next line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=*l*). Multiple lanterns can be located at the same point. The lanterns may be located at the ends of the street. Output Specification: Print the minimum light radius *d*, needed to light the whole street. The answer will be considered correct if its absolute or relative error doesn't exceed 10<=-<=9. Demo Input: ['7 15\n15 5 3 7 9 14 0\n', '2 5\n2 5\n'] Demo Output: ['2.5000000000\n', '2.0000000000\n'] Note: Consider the second sample. At *d* = 2 the first lantern will light the segment [0, 4] of the street, and the second lantern will light segment [3, 5]. Thus, the whole street will be lit.
```python inp = input().split() sSize = inp[0] l = int(inp[1]) s = list(map(int,input().split())) s.sort() ledge = s[0] redge = l - s[len(s) - 1] maxdis = 0 if (len(s) == 1): print(max(ledge, redge)) exit(0) i = 1 while i < len(s): maxdis = max(maxdis, s[i] - s[i - 1]) i += 1 print(max(float(redge), float(ledge), (maxdis / 2))) ```
3
257
B
Playing Cubes
PROGRAMMING
1,300
[ "games", "greedy", "implementation" ]
null
null
Petya and Vasya decided to play a little. They found *n* red cubes and *m* blue cubes. The game goes like that: the players take turns to choose a cube of some color (red or blue) and put it in a line from left to right (overall the line will have *n*<=+<=*m* cubes). Petya moves first. Petya's task is to get as many pairs of neighbouring cubes of the same color as possible. Vasya's task is to get as many pairs of neighbouring cubes of different colors as possible. The number of Petya's points in the game is the number of pairs of neighboring cubes of the same color in the line, the number of Vasya's points in the game is the number of neighbouring cubes of the different color in the line. Your task is to calculate the score at the end of the game (Petya's and Vasya's points, correspondingly), if both boys are playing optimally well. To "play optimally well" first of all means to maximize the number of one's points, and second — to minimize the number of the opponent's points.
The only line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105) — the number of red and blue cubes, correspondingly.
On a single line print two space-separated integers — the number of Petya's and Vasya's points correspondingly provided that both players play optimally well.
[ "3 1\n", "2 4\n" ]
[ "2 1\n", "3 2\n" ]
In the first test sample the optimal strategy for Petya is to put the blue cube in the line. After that there will be only red cubes left, so by the end of the game the line of cubes from left to right will look as [blue, red, red, red]. So, Petya gets 2 points and Vasya gets 1 point. If Petya would choose the red cube during his first move, then, provided that both boys play optimally well, Petya would get 1 point and Vasya would get 2 points.
500
[ { "input": "3 1", "output": "2 1" }, { "input": "2 4", "output": "3 2" }, { "input": "1 1", "output": "0 1" }, { "input": "2 1", "output": "1 1" }, { "input": "4 4", "output": "3 4" }, { "input": "10 7", "output": "9 7" }, { "input": "5 13", "output": "12 5" }, { "input": "7 11", "output": "10 7" }, { "input": "1 2", "output": "1 1" }, { "input": "10 10", "output": "9 10" }, { "input": "50 30", "output": "49 30" }, { "input": "80 120", "output": "119 80" }, { "input": "304 122", "output": "303 122" }, { "input": "500 800", "output": "799 500" }, { "input": "900 1000", "output": "999 900" }, { "input": "1 1000", "output": "999 1" }, { "input": "997 9", "output": "996 9" }, { "input": "341 678", "output": "677 341" }, { "input": "784 913", "output": "912 784" }, { "input": "57 888", "output": "887 57" }, { "input": "100000 100000", "output": "99999 100000" }, { "input": "10000 100000", "output": "99999 10000" }, { "input": "9999 99999", "output": "99998 9999" }, { "input": "12 100000", "output": "99999 12" }, { "input": "9999 31411", "output": "31410 9999" }, { "input": "12930 98391", "output": "98390 12930" }, { "input": "98813 893", "output": "98812 893" }, { "input": "99801 38179", "output": "99800 38179" }, { "input": "831 69318", "output": "69317 831" }, { "input": "99999 99997", "output": "99998 99997" }, { "input": "74 99", "output": "98 74" }, { "input": "159 259", "output": "258 159" }, { "input": "245 317", "output": "316 245" }, { "input": "947 883", "output": "946 883" }, { "input": "7131 3165", "output": "7130 3165" }, { "input": "11536 12192", "output": "12191 11536" }, { "input": "25938 40897", "output": "40896 25938" }, { "input": "81314 31958", "output": "81313 31958" }, { "input": "294 83621", "output": "83620 294" }, { "input": "64896 18105", "output": "64895 18105" } ]
1,626,325,852
2,147,483,647
PyPy 3
OK
TESTS
40
248
20,172,800
# import sys # sys.stdin = open('input.txt', 'r') # sys.stdout = open('output.txt', 'w') def read_line(): return [int(x) for x in input().split()] def read_int(): return int(input()) def solve(): n, m = read_line() print(max(n, m)-1, min(n, m)) # t = read_int() t = 1 while t > 0: solve() t -= 1
Title: Playing Cubes Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petya and Vasya decided to play a little. They found *n* red cubes and *m* blue cubes. The game goes like that: the players take turns to choose a cube of some color (red or blue) and put it in a line from left to right (overall the line will have *n*<=+<=*m* cubes). Petya moves first. Petya's task is to get as many pairs of neighbouring cubes of the same color as possible. Vasya's task is to get as many pairs of neighbouring cubes of different colors as possible. The number of Petya's points in the game is the number of pairs of neighboring cubes of the same color in the line, the number of Vasya's points in the game is the number of neighbouring cubes of the different color in the line. Your task is to calculate the score at the end of the game (Petya's and Vasya's points, correspondingly), if both boys are playing optimally well. To "play optimally well" first of all means to maximize the number of one's points, and second — to minimize the number of the opponent's points. Input Specification: The only line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105) — the number of red and blue cubes, correspondingly. Output Specification: On a single line print two space-separated integers — the number of Petya's and Vasya's points correspondingly provided that both players play optimally well. Demo Input: ['3 1\n', '2 4\n'] Demo Output: ['2 1\n', '3 2\n'] Note: In the first test sample the optimal strategy for Petya is to put the blue cube in the line. After that there will be only red cubes left, so by the end of the game the line of cubes from left to right will look as [blue, red, red, red]. So, Petya gets 2 points and Vasya gets 1 point. If Petya would choose the red cube during his first move, then, provided that both boys play optimally well, Petya would get 1 point and Vasya would get 2 points.
```python # import sys # sys.stdin = open('input.txt', 'r') # sys.stdout = open('output.txt', 'w') def read_line(): return [int(x) for x in input().split()] def read_int(): return int(input()) def solve(): n, m = read_line() print(max(n, m)-1, min(n, m)) # t = read_int() t = 1 while t > 0: solve() t -= 1 ```
3
348
A
Mafia
PROGRAMMING
1,600
[ "binary search", "math", "sortings" ]
null
null
One day *n* friends gathered together to play "Mafia". During each round of the game some player must be the supervisor and other *n*<=-<=1 people take part in the game. For each person we know in how many rounds he wants to be a player, not the supervisor: the *i*-th person wants to play *a**i* rounds. What is the minimum number of rounds of the "Mafia" game they need to play to let each person play at least as many rounds as they want?
The first line contains integer *n* (3<=≤<=*n*<=≤<=105). The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the *i*-th number in the list is the number of rounds the *i*-th person wants to play.
In a single line print a single integer — the minimum number of game rounds the friends need to let the *i*-th person play at least *a**i* rounds. Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
[ "3\n3 2 2\n", "4\n2 2 2 2\n" ]
[ "4\n", "3\n" ]
You don't need to know the rules of "Mafia" to solve this problem. If you're curious, it's a game Russia got from the Soviet times: http://en.wikipedia.org/wiki/Mafia_(party_game).
500
[ { "input": "3\n3 2 2", "output": "4" }, { "input": "4\n2 2 2 2", "output": "3" }, { "input": "7\n9 7 7 8 8 7 8", "output": "9" }, { "input": "10\n13 12 10 13 13 14 10 10 12 12", "output": "14" }, { "input": "10\n94 96 91 95 99 94 96 92 95 99", "output": "106" }, { "input": "100\n1 555 876 444 262 234 231 598 416 261 206 165 181 988 469 123 602 592 533 97 864 716 831 156 962 341 207 377 892 51 866 96 757 317 832 476 549 472 770 1000 887 145 956 515 992 653 972 677 973 527 984 559 280 346 580 30 372 547 209 929 492 520 446 726 47 170 699 560 814 206 688 955 308 287 26 102 77 430 262 71 415 586 532 562 419 615 732 658 108 315 268 574 86 12 23 429 640 995 342 305", "output": "1000" }, { "input": "3\n1 1 1", "output": "2" }, { "input": "30\n94 93 90 94 90 91 93 91 93 94 93 90 100 94 97 94 94 95 94 96 94 98 97 95 97 91 91 95 98 96", "output": "100" }, { "input": "5\n1000000000 5 5 4 4", "output": "1000000000" }, { "input": "3\n1 2 1", "output": "2" }, { "input": "3\n2 1 1", "output": "2" }, { "input": "4\n1 2 3 4", "output": "4" }, { "input": "3\n1000000000 1000000000 10000000", "output": "1005000000" }, { "input": "3\n677876423 834056477 553175531", "output": "1032554216" }, { "input": "5\n1000000000 1 1 1 1", "output": "1000000000" }, { "input": "4\n1000000000 1000000000 1000000000 1000000000", "output": "1333333334" }, { "input": "3\n4 10 11", "output": "13" }, { "input": "5\n1000000000 1000000000 1000000000 1000000000 1000000000", "output": "1250000000" } ]
1,628,086,523
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
5
186
20,172,800
n=int(input()) array=list(map(int,input().split())) s=sum(array) if s%(n-1)==0: print(s // (n - 1)) else: print((s//(n-1))+1)
Title: Mafia Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day *n* friends gathered together to play "Mafia". During each round of the game some player must be the supervisor and other *n*<=-<=1 people take part in the game. For each person we know in how many rounds he wants to be a player, not the supervisor: the *i*-th person wants to play *a**i* rounds. What is the minimum number of rounds of the "Mafia" game they need to play to let each person play at least as many rounds as they want? Input Specification: The first line contains integer *n* (3<=≤<=*n*<=≤<=105). The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the *i*-th number in the list is the number of rounds the *i*-th person wants to play. Output Specification: In a single line print a single integer — the minimum number of game rounds the friends need to let the *i*-th person play at least *a**i* rounds. Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier. Demo Input: ['3\n3 2 2\n', '4\n2 2 2 2\n'] Demo Output: ['4\n', '3\n'] Note: You don't need to know the rules of "Mafia" to solve this problem. If you're curious, it's a game Russia got from the Soviet times: http://en.wikipedia.org/wiki/Mafia_(party_game).
```python n=int(input()) array=list(map(int,input().split())) s=sum(array) if s%(n-1)==0: print(s // (n - 1)) else: print((s//(n-1))+1) ```
0
987
A
Infinity Gauntlet
PROGRAMMING
800
[ "implementation" ]
null
null
You took a peek on Thanos wearing Infinity Gauntlet. In the Gauntlet there is a place for six Infinity Gems: - the Power Gem of purple color, - the Time Gem of green color, - the Space Gem of blue color, - the Soul Gem of orange color, - the Reality Gem of red color, - the Mind Gem of yellow color. Using colors of Gems you saw in the Gauntlet determine the names of absent Gems.
In the first line of input there is one integer $n$ ($0 \le n \le 6$) — the number of Gems in Infinity Gauntlet. In next $n$ lines there are colors of Gems you saw. Words used for colors are: purple, green, blue, orange, red, yellow. It is guaranteed that all the colors are distinct. All colors are given in lowercase English letters.
In the first line output one integer $m$ ($0 \le m \le 6$) — the number of absent Gems. Then in $m$ lines print the names of absent Gems, each on its own line. Words used for names are: Power, Time, Space, Soul, Reality, Mind. Names can be printed in any order. Keep the first letter uppercase, others lowercase.
[ "4\nred\npurple\nyellow\norange\n", "0\n" ]
[ "2\nSpace\nTime\n", "6\nTime\nMind\nSoul\nPower\nReality\nSpace\n" ]
In the first sample Thanos already has Reality, Power, Mind and Soul Gems, so he needs two more: Time and Space. In the second sample Thanos doesn't have any Gems, so he needs all six.
500
[ { "input": "4\nred\npurple\nyellow\norange", "output": "2\nSpace\nTime" }, { "input": "0", "output": "6\nMind\nSpace\nPower\nTime\nReality\nSoul" }, { "input": "6\npurple\nblue\nyellow\nred\ngreen\norange", "output": "0" }, { "input": "1\npurple", "output": "5\nTime\nReality\nSoul\nSpace\nMind" }, { "input": "3\nblue\norange\npurple", "output": "3\nTime\nReality\nMind" }, { "input": "2\nyellow\nred", "output": "4\nPower\nSoul\nSpace\nTime" }, { "input": "1\ngreen", "output": "5\nReality\nSpace\nPower\nSoul\nMind" }, { "input": "2\npurple\ngreen", "output": "4\nReality\nMind\nSpace\nSoul" }, { "input": "1\nblue", "output": "5\nPower\nReality\nSoul\nTime\nMind" }, { "input": "2\npurple\nblue", "output": "4\nMind\nSoul\nTime\nReality" }, { "input": "2\ngreen\nblue", "output": "4\nReality\nMind\nPower\nSoul" }, { "input": "3\npurple\ngreen\nblue", "output": "3\nMind\nReality\nSoul" }, { "input": "1\norange", "output": "5\nReality\nTime\nPower\nSpace\nMind" }, { "input": "2\npurple\norange", "output": "4\nReality\nMind\nTime\nSpace" }, { "input": "2\norange\ngreen", "output": "4\nSpace\nMind\nReality\nPower" }, { "input": "3\norange\npurple\ngreen", "output": "3\nReality\nSpace\nMind" }, { "input": "2\norange\nblue", "output": "4\nTime\nMind\nReality\nPower" }, { "input": "3\nblue\ngreen\norange", "output": "3\nPower\nMind\nReality" }, { "input": "4\nblue\norange\ngreen\npurple", "output": "2\nMind\nReality" }, { "input": "1\nred", "output": "5\nTime\nSoul\nMind\nPower\nSpace" }, { "input": "2\nred\npurple", "output": "4\nMind\nSpace\nTime\nSoul" }, { "input": "2\nred\ngreen", "output": "4\nMind\nSpace\nPower\nSoul" }, { "input": "3\nred\npurple\ngreen", "output": "3\nSoul\nSpace\nMind" }, { "input": "2\nblue\nred", "output": "4\nMind\nTime\nPower\nSoul" }, { "input": "3\nred\nblue\npurple", "output": "3\nTime\nMind\nSoul" }, { "input": "3\nred\nblue\ngreen", "output": "3\nSoul\nPower\nMind" }, { "input": "4\npurple\nblue\ngreen\nred", "output": "2\nMind\nSoul" }, { "input": "2\norange\nred", "output": "4\nPower\nMind\nTime\nSpace" }, { "input": "3\nred\norange\npurple", "output": "3\nMind\nSpace\nTime" }, { "input": "3\nred\norange\ngreen", "output": "3\nMind\nSpace\nPower" }, { "input": "4\nred\norange\ngreen\npurple", "output": "2\nSpace\nMind" }, { "input": "3\nblue\norange\nred", "output": "3\nPower\nMind\nTime" }, { "input": "4\norange\nblue\npurple\nred", "output": "2\nTime\nMind" }, { "input": "4\ngreen\norange\nred\nblue", "output": "2\nMind\nPower" }, { "input": "5\npurple\norange\nblue\nred\ngreen", "output": "1\nMind" }, { "input": "1\nyellow", "output": "5\nPower\nSoul\nReality\nSpace\nTime" }, { "input": "2\npurple\nyellow", "output": "4\nTime\nReality\nSpace\nSoul" }, { "input": "2\ngreen\nyellow", "output": "4\nSpace\nReality\nPower\nSoul" }, { "input": "3\npurple\nyellow\ngreen", "output": "3\nSoul\nReality\nSpace" }, { "input": "2\nblue\nyellow", "output": "4\nTime\nReality\nPower\nSoul" }, { "input": "3\nyellow\nblue\npurple", "output": "3\nSoul\nReality\nTime" }, { "input": "3\ngreen\nyellow\nblue", "output": "3\nSoul\nReality\nPower" }, { "input": "4\nyellow\nblue\ngreen\npurple", "output": "2\nReality\nSoul" }, { "input": "2\nyellow\norange", "output": "4\nTime\nSpace\nReality\nPower" }, { "input": "3\nyellow\npurple\norange", "output": "3\nSpace\nReality\nTime" }, { "input": "3\norange\nyellow\ngreen", "output": "3\nSpace\nReality\nPower" }, { "input": "4\ngreen\nyellow\norange\npurple", "output": "2\nSpace\nReality" }, { "input": "3\nyellow\nblue\norange", "output": "3\nTime\nReality\nPower" }, { "input": "4\norange\npurple\nblue\nyellow", "output": "2\nReality\nTime" }, { "input": "4\nblue\norange\nyellow\ngreen", "output": "2\nReality\nPower" }, { "input": "5\ngreen\nyellow\norange\nblue\npurple", "output": "1\nReality" }, { "input": "3\nyellow\npurple\nred", "output": "3\nTime\nSoul\nSpace" }, { "input": "3\nred\ngreen\nyellow", "output": "3\nPower\nSoul\nSpace" }, { "input": "4\nred\npurple\ngreen\nyellow", "output": "2\nSpace\nSoul" }, { "input": "3\nred\nyellow\nblue", "output": "3\nPower\nSoul\nTime" }, { "input": "4\nblue\nyellow\nred\npurple", "output": "2\nTime\nSoul" }, { "input": "4\nblue\nyellow\nred\ngreen", "output": "2\nSoul\nPower" }, { "input": "5\nred\nyellow\ngreen\nblue\npurple", "output": "1\nSoul" }, { "input": "3\nred\nyellow\norange", "output": "3\nPower\nSpace\nTime" }, { "input": "4\norange\ngreen\nyellow\nred", "output": "2\nPower\nSpace" }, { "input": "5\norange\nred\ngreen\nyellow\npurple", "output": "1\nSpace" }, { "input": "4\nyellow\nred\norange\nblue", "output": "2\nTime\nPower" }, { "input": "5\npurple\nblue\norange\nyellow\nred", "output": "1\nTime" }, { "input": "5\norange\nblue\nyellow\nred\ngreen", "output": "1\nPower" } ]
1,612,264,875
2,147,483,647
Python 3
OK
TESTS
64
77
307,200
n=int(input()) l=[] for i in range(n): s=str(input()) l.append(s) print(6-n) if "purple" not in l: print("Power") if "green" not in l: print("Time") if "red" not in l: print("Reality") if "blue" not in l: print("Space") if "orange" not in l: print("Soul") if "yellow" not in l: print("Mind")
Title: Infinity Gauntlet Time Limit: None seconds Memory Limit: None megabytes Problem Description: You took a peek on Thanos wearing Infinity Gauntlet. In the Gauntlet there is a place for six Infinity Gems: - the Power Gem of purple color, - the Time Gem of green color, - the Space Gem of blue color, - the Soul Gem of orange color, - the Reality Gem of red color, - the Mind Gem of yellow color. Using colors of Gems you saw in the Gauntlet determine the names of absent Gems. Input Specification: In the first line of input there is one integer $n$ ($0 \le n \le 6$) — the number of Gems in Infinity Gauntlet. In next $n$ lines there are colors of Gems you saw. Words used for colors are: purple, green, blue, orange, red, yellow. It is guaranteed that all the colors are distinct. All colors are given in lowercase English letters. Output Specification: In the first line output one integer $m$ ($0 \le m \le 6$) — the number of absent Gems. Then in $m$ lines print the names of absent Gems, each on its own line. Words used for names are: Power, Time, Space, Soul, Reality, Mind. Names can be printed in any order. Keep the first letter uppercase, others lowercase. Demo Input: ['4\nred\npurple\nyellow\norange\n', '0\n'] Demo Output: ['2\nSpace\nTime\n', '6\nTime\nMind\nSoul\nPower\nReality\nSpace\n'] Note: In the first sample Thanos already has Reality, Power, Mind and Soul Gems, so he needs two more: Time and Space. In the second sample Thanos doesn't have any Gems, so he needs all six.
```python n=int(input()) l=[] for i in range(n): s=str(input()) l.append(s) print(6-n) if "purple" not in l: print("Power") if "green" not in l: print("Time") if "red" not in l: print("Reality") if "blue" not in l: print("Space") if "orange" not in l: print("Soul") if "yellow" not in l: print("Mind") ```
3
379
A
New Year Candles
PROGRAMMING
1,000
[ "implementation" ]
null
null
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles. Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle. Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000).
Print a single integer — the number of hours Vasily can light up the room for.
[ "4 2\n", "6 3\n" ]
[ "7\n", "8\n" ]
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
500
[ { "input": "4 2", "output": "7" }, { "input": "6 3", "output": "8" }, { "input": "1000 1000", "output": "1001" }, { "input": "123 5", "output": "153" }, { "input": "1000 2", "output": "1999" }, { "input": "1 2", "output": "1" }, { "input": "1 3", "output": "1" }, { "input": "1 4", "output": "1" }, { "input": "2 2", "output": "3" }, { "input": "3 2", "output": "5" }, { "input": "3 3", "output": "4" }, { "input": "999 2", "output": "1997" }, { "input": "1000 3", "output": "1499" }, { "input": "1000 4", "output": "1333" }, { "input": "1 1000", "output": "1" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "10 4", "output": "13" }, { "input": "4 3", "output": "5" }, { "input": "91 5", "output": "113" }, { "input": "777 17", "output": "825" }, { "input": "100 4", "output": "133" }, { "input": "5 3", "output": "7" }, { "input": "6 4", "output": "7" }, { "input": "26 8", "output": "29" }, { "input": "9 4", "output": "11" }, { "input": "20 3", "output": "29" }, { "input": "17 3", "output": "25" } ]
1,682,251,383
2,147,483,647
Python 3
OK
TESTS
32
62
0
from math import ceil candels , replace = map(int ,input().split()) counter = candels while candels >= replace : c = int(candels / replace) counter += c candels = c + candels % replace print(counter)
Title: New Year Candles Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles. Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle. Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number. Input Specification: The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000). Output Specification: Print a single integer — the number of hours Vasily can light up the room for. Demo Input: ['4 2\n', '6 3\n'] Demo Output: ['7\n', '8\n'] Note: Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
```python from math import ceil candels , replace = map(int ,input().split()) counter = candels while candels >= replace : c = int(candels / replace) counter += c candels = c + candels % replace print(counter) ```
3
680
B
Bear and Finding Criminals
PROGRAMMING
1,000
[ "constructive algorithms", "implementation" ]
null
null
There are *n* cities in Bearland, numbered 1 through *n*. Cities are arranged in one long row. The distance between cities *i* and *j* is equal to |*i*<=-<=*j*|. Limak is a police officer. He lives in a city *a*. His job is to catch criminals. It's hard because he doesn't know in which cities criminals are. Though, he knows that there is at most one criminal in each city. Limak is going to use a BCD (Bear Criminal Detector). The BCD will tell Limak how many criminals there are for every distance from a city *a*. After that, Limak can catch a criminal in each city for which he is sure that there must be a criminal. You know in which cities criminals are. Count the number of criminals Limak will catch, after he uses the BCD.
The first line of the input contains two integers *n* and *a* (1<=≤<=*a*<=≤<=*n*<=≤<=100) — the number of cities and the index of city where Limak lives. The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (0<=≤<=*t**i*<=≤<=1). There are *t**i* criminals in the *i*-th city.
Print the number of criminals Limak will catch.
[ "6 3\n1 1 1 0 1 0\n", "5 2\n0 0 0 1 0\n" ]
[ "3\n", "1\n" ]
In the first sample, there are six cities and Limak lives in the third one (blue arrow below). Criminals are in cities marked red. Using the BCD gives Limak the following information: - There is one criminal at distance 0 from the third city — Limak is sure that this criminal is exactly in the third city. - There is one criminal at distance 1 from the third city — Limak doesn't know if a criminal is in the second or fourth city. - There are two criminals at distance 2 from the third city — Limak is sure that there is one criminal in the first city and one in the fifth city. - There are zero criminals for every greater distance. So, Limak will catch criminals in cities 1, 3 and 5, that is 3 criminals in total. In the second sample (drawing below), the BCD gives Limak the information that there is one criminal at distance 2 from Limak's city. There is only one city at distance 2 so Limak is sure where a criminal is.
1,000
[ { "input": "6 3\n1 1 1 0 1 0", "output": "3" }, { "input": "5 2\n0 0 0 1 0", "output": "1" }, { "input": "1 1\n1", "output": "1" }, { "input": "1 1\n0", "output": "0" }, { "input": "9 3\n1 1 1 1 1 1 1 1 0", "output": "8" }, { "input": "9 5\n1 0 1 0 1 0 1 0 1", "output": "5" }, { "input": "20 17\n1 1 0 1 1 1 1 0 1 0 1 1 1 0 1 1 0 0 0 0", "output": "10" }, { "input": "100 60\n1 1 1 1 1 1 0 1 0 0 1 1 0 1 1 1 1 1 0 0 1 1 0 0 0 0 0 1 0 1 1 0 1 0 1 0 1 0 1 1 0 0 0 0 0 1 1 1 0 1 1 0 0 0 1 0 0 0 1 1 1 0 1 0 0 1 1 1 0 1 1 1 0 0 1 1 0 1 0 0 0 1 0 0 0 0 0 0 1 1 1 0 0 1 1 1 0 1 0 0", "output": "27" }, { "input": "8 1\n1 0 1 1 0 0 1 0", "output": "4" }, { "input": "11 11\n0 1 0 0 1 1 1 0 0 0 0", "output": "4" }, { "input": "19 10\n0 1 1 0 1 0 0 1 1 0 0 1 0 1 0 0 1 0 1", "output": "4" }, { "input": "100 38\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "100 38\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "1" }, { "input": "100 38\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "3" }, { "input": "99 38\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "25" }, { "input": "99 38\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "24" }, { "input": "99 38\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "24" }, { "input": "98 70\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "41" }, { "input": "99 70\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "9" }, { "input": "99 60\n0 0 0 1 1 0 1 1 0 0 1 0 0 0 0 0 1 0 1 0 0 0 1 0 1 1 1 0 1 1 1 1 0 0 1 1 1 0 1 1 1 1 1 0 1 1 0 0 0 0 0 1 0 0 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 0 1 0 0 1 0 0 1 1 1 0 0 0 0 1 1 0 1 1 1 1 0 0 0 0 0 0 1 1 1", "output": "34" }, { "input": "98 24\n0 0 0 1 1 0 1 1 0 0 0 0 1 0 0 1 0 0 1 1 1 0 0 1 0 0 1 0 1 0 0 1 1 0 1 1 1 0 1 0 0 1 0 0 0 1 1 1 1 0 1 1 1 0 1 1 1 1 0 0 1 0 0 0 1 0 1 1 0 1 0 1 1 1 0 0 1 0 0 0 1 1 0 0 1 1 1 1 1 1 0 1 0 1 0 0 1 1", "output": "39" }, { "input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "100" }, { "input": "100 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "2 1\n0 1", "output": "1" } ]
1,631,651,982
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
5
62
6,963,200
n = list(map(int, input().split())) x = list(map(int, input().split())) out = 0 dist = [] ind = n[1] - 1 if x[ind] == 1: out += 1 for i in range(0, ind): if x[i] == 1: d = ind - i right = ind + d if right < n[0] - 1: if x[right] == 1: out += 2 else: out += 1 new_ind = 2 * ind if new_ind < n[0] - 1: for j in range(new_ind+1, n[0]-1): if x[j] == 1: out += 1 print(out)
Title: Bear and Finding Criminals Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are *n* cities in Bearland, numbered 1 through *n*. Cities are arranged in one long row. The distance between cities *i* and *j* is equal to |*i*<=-<=*j*|. Limak is a police officer. He lives in a city *a*. His job is to catch criminals. It's hard because he doesn't know in which cities criminals are. Though, he knows that there is at most one criminal in each city. Limak is going to use a BCD (Bear Criminal Detector). The BCD will tell Limak how many criminals there are for every distance from a city *a*. After that, Limak can catch a criminal in each city for which he is sure that there must be a criminal. You know in which cities criminals are. Count the number of criminals Limak will catch, after he uses the BCD. Input Specification: The first line of the input contains two integers *n* and *a* (1<=≤<=*a*<=≤<=*n*<=≤<=100) — the number of cities and the index of city where Limak lives. The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (0<=≤<=*t**i*<=≤<=1). There are *t**i* criminals in the *i*-th city. Output Specification: Print the number of criminals Limak will catch. Demo Input: ['6 3\n1 1 1 0 1 0\n', '5 2\n0 0 0 1 0\n'] Demo Output: ['3\n', '1\n'] Note: In the first sample, there are six cities and Limak lives in the third one (blue arrow below). Criminals are in cities marked red. Using the BCD gives Limak the following information: - There is one criminal at distance 0 from the third city — Limak is sure that this criminal is exactly in the third city. - There is one criminal at distance 1 from the third city — Limak doesn't know if a criminal is in the second or fourth city. - There are two criminals at distance 2 from the third city — Limak is sure that there is one criminal in the first city and one in the fifth city. - There are zero criminals for every greater distance. So, Limak will catch criminals in cities 1, 3 and 5, that is 3 criminals in total. In the second sample (drawing below), the BCD gives Limak the information that there is one criminal at distance 2 from Limak's city. There is only one city at distance 2 so Limak is sure where a criminal is.
```python n = list(map(int, input().split())) x = list(map(int, input().split())) out = 0 dist = [] ind = n[1] - 1 if x[ind] == 1: out += 1 for i in range(0, ind): if x[i] == 1: d = ind - i right = ind + d if right < n[0] - 1: if x[right] == 1: out += 2 else: out += 1 new_ind = 2 * ind if new_ind < n[0] - 1: for j in range(new_ind+1, n[0]-1): if x[j] == 1: out += 1 print(out) ```
0
886
B
Vlad and Cafes
PROGRAMMING
1,000
[]
null
null
Vlad likes to eat in cafes very much. During his life, he has visited cafes *n* times. Unfortunately, Vlad started to feel that his last visits are not any different from each other. To fix that Vlad had a small research. First of all, Vlad assigned individual indices to all cafes. Then, he wrote down indices of cafes he visited in a row, in order of visiting them. Now, Vlad wants to find such a cafe that his last visit to that cafe was before his last visits to every other cafe. In other words, he wants to find such a cafe that he hasn't been there for as long as possible. Help Vlad to find that cafe.
In first line there is one integer *n* (1<=≤<=*n*<=≤<=2·105) — number of cafes indices written by Vlad. In second line, *n* numbers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=2·105) are written — indices of cafes in order of being visited by Vlad. Vlad could visit some cafes more than once. Note that in numeration, some indices could be omitted.
Print one integer — index of the cafe that Vlad hasn't visited for as long as possible.
[ "5\n1 3 2 1 2\n", "6\n2 1 2 2 4 1\n" ]
[ "3\n", "2\n" ]
In first test, there are three cafes, and the last visits to cafes with indices 1 and 2 were after the last visit to cafe with index 3; so this cafe is the answer. In second test case, there are also three cafes, but with indices 1, 2 and 4. Cafes with indices 1 and 4 were visited after the last visit of cafe with index 2, so the answer is 2. Note that Vlad could omit some numbers while numerating the cafes.
1,000
[ { "input": "5\n1 3 2 1 2", "output": "3" }, { "input": "6\n2 1 2 2 4 1", "output": "2" }, { "input": "1\n0", "output": "0" }, { "input": "1\n200000", "output": "200000" }, { "input": "2\n2018 2017", "output": "2018" }, { "input": "5\n100 1000 1000 1000 1000", "output": "100" }, { "input": "8\n200000 1 200000 1 200000 1 200000 2", "output": "1" }, { "input": "5\n20000 1 2 3 4", "output": "20000" }, { "input": "2\n200000 1", "output": "200000" }, { "input": "3\n2 100 2", "output": "100" }, { "input": "2\n10 1", "output": "10" }, { "input": "11\n1 1 1 1 1 1 1 1 1 1 1", "output": "1" }, { "input": "3\n5 5 5", "output": "5" }, { "input": "2\n5 1", "output": "5" } ]
1,514,079,645
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
4
2,000
19,865,600
n=int(input()) a=list(map(int,input().split())) b=[] for i in range(n-1,-1,-1): if a[i] not in b: b.append(a[i]) print(b[-1])
Title: Vlad and Cafes Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vlad likes to eat in cafes very much. During his life, he has visited cafes *n* times. Unfortunately, Vlad started to feel that his last visits are not any different from each other. To fix that Vlad had a small research. First of all, Vlad assigned individual indices to all cafes. Then, he wrote down indices of cafes he visited in a row, in order of visiting them. Now, Vlad wants to find such a cafe that his last visit to that cafe was before his last visits to every other cafe. In other words, he wants to find such a cafe that he hasn't been there for as long as possible. Help Vlad to find that cafe. Input Specification: In first line there is one integer *n* (1<=≤<=*n*<=≤<=2·105) — number of cafes indices written by Vlad. In second line, *n* numbers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=2·105) are written — indices of cafes in order of being visited by Vlad. Vlad could visit some cafes more than once. Note that in numeration, some indices could be omitted. Output Specification: Print one integer — index of the cafe that Vlad hasn't visited for as long as possible. Demo Input: ['5\n1 3 2 1 2\n', '6\n2 1 2 2 4 1\n'] Demo Output: ['3\n', '2\n'] Note: In first test, there are three cafes, and the last visits to cafes with indices 1 and 2 were after the last visit to cafe with index 3; so this cafe is the answer. In second test case, there are also three cafes, but with indices 1, 2 and 4. Cafes with indices 1 and 4 were visited after the last visit of cafe with index 2, so the answer is 2. Note that Vlad could omit some numbers while numerating the cafes.
```python n=int(input()) a=list(map(int,input().split())) b=[] for i in range(n-1,-1,-1): if a[i] not in b: b.append(a[i]) print(b[-1]) ```
0
189
A
Cut Ribbon
PROGRAMMING
1,300
[ "brute force", "dp" ]
null
null
Polycarpus has a ribbon, its length is *n*. He wants to cut the ribbon in a way that fulfils the following two conditions: - After the cutting each ribbon piece should have length *a*, *b* or *c*. - After the cutting the number of ribbon pieces should be maximum. Help Polycarpus and find the number of ribbon pieces after the required cutting.
The first line contains four space-separated integers *n*, *a*, *b* and *c* (1<=≤<=*n*,<=*a*,<=*b*,<=*c*<=≤<=4000) — the length of the original ribbon and the acceptable lengths of the ribbon pieces after the cutting, correspondingly. The numbers *a*, *b* and *c* can coincide.
Print a single number — the maximum possible number of ribbon pieces. It is guaranteed that at least one correct ribbon cutting exists.
[ "5 5 3 2\n", "7 5 5 2\n" ]
[ "2\n", "2\n" ]
In the first example Polycarpus can cut the ribbon in such way: the first piece has length 2, the second piece has length 3. In the second example Polycarpus can cut the ribbon in such way: the first piece has length 5, the second piece has length 2.
500
[ { "input": "5 5 3 2", "output": "2" }, { "input": "7 5 5 2", "output": "2" }, { "input": "4 4 4 4", "output": "1" }, { "input": "1 1 1 1", "output": "1" }, { "input": "4000 1 2 3", "output": "4000" }, { "input": "4000 3 4 5", "output": "1333" }, { "input": "10 3 4 5", "output": "3" }, { "input": "100 23 15 50", "output": "2" }, { "input": "3119 3515 1021 7", "output": "11" }, { "input": "918 102 1327 1733", "output": "9" }, { "input": "3164 42 430 1309", "output": "15" }, { "input": "3043 317 1141 2438", "output": "7" }, { "input": "26 1 772 2683", "output": "26" }, { "input": "370 2 1 15", "output": "370" }, { "input": "734 12 6 2", "output": "367" }, { "input": "418 18 14 17", "output": "29" }, { "input": "18 16 28 9", "output": "2" }, { "input": "14 6 2 17", "output": "7" }, { "input": "29 27 18 2", "output": "2" }, { "input": "29 12 7 10", "output": "3" }, { "input": "27 23 4 3", "output": "9" }, { "input": "5 14 5 2", "output": "1" }, { "input": "5 17 26 5", "output": "1" }, { "input": "9 1 10 3", "output": "9" }, { "input": "2 19 15 1", "output": "2" }, { "input": "4 6 4 9", "output": "1" }, { "input": "10 6 2 9", "output": "5" }, { "input": "2 2 9 6", "output": "1" }, { "input": "6 2 4 1", "output": "6" }, { "input": "27 24 5 27", "output": "1" }, { "input": "2683 83 26 2709", "output": "101" }, { "input": "728 412 789 158", "output": "3" }, { "input": "3964 4 2916 176", "output": "991" }, { "input": "3399 2035 2 3334", "output": "683" }, { "input": "3455 244 3301 3", "output": "991" }, { "input": "595 2263 3625 1", "output": "595" }, { "input": "4000 1 1 1", "output": "4000" }, { "input": "3999 2 2 3999", "output": "1" }, { "input": "25 6 8 11", "output": "3" }, { "input": "4000 500 1000 2000", "output": "8" }, { "input": "53 10 11 23", "output": "5" }, { "input": "100 100 1 1", "output": "100" }, { "input": "17 3 4 10", "output": "5" }, { "input": "413 101 102 105", "output": "4" }, { "input": "490 4 49 50", "output": "111" }, { "input": "3999 2 3 3", "output": "1999" }, { "input": "8 3 8 4", "output": "2" }, { "input": "5 1 3 3", "output": "5" }, { "input": "100 3 17 22", "output": "27" }, { "input": "4000 2 3 4", "output": "2000" }, { "input": "4000 3 3 5", "output": "1332" }, { "input": "13 4 6 7", "output": "2" }, { "input": "4000 5 2 2", "output": "2000" }, { "input": "3999 2 2 3", "output": "1999" }, { "input": "4000 33 7 3333", "output": "564" }, { "input": "60 33 20 9", "output": "4" }, { "input": "100 9 11 99", "output": "10" }, { "input": "2009 6 8 9", "output": "334" } ]
1,692,684,992
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
4
46
0
#https://codeforces.com/problemset/problem/189/A n=list(map(int,input().split())) abc=sorted(n[1:]) sum=0 for i in range(3): sum+=abc[i] if sum==n[0]: print(i+1) break
Title: Cut Ribbon Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarpus has a ribbon, its length is *n*. He wants to cut the ribbon in a way that fulfils the following two conditions: - After the cutting each ribbon piece should have length *a*, *b* or *c*. - After the cutting the number of ribbon pieces should be maximum. Help Polycarpus and find the number of ribbon pieces after the required cutting. Input Specification: The first line contains four space-separated integers *n*, *a*, *b* and *c* (1<=≤<=*n*,<=*a*,<=*b*,<=*c*<=≤<=4000) — the length of the original ribbon and the acceptable lengths of the ribbon pieces after the cutting, correspondingly. The numbers *a*, *b* and *c* can coincide. Output Specification: Print a single number — the maximum possible number of ribbon pieces. It is guaranteed that at least one correct ribbon cutting exists. Demo Input: ['5 5 3 2\n', '7 5 5 2\n'] Demo Output: ['2\n', '2\n'] Note: In the first example Polycarpus can cut the ribbon in such way: the first piece has length 2, the second piece has length 3. In the second example Polycarpus can cut the ribbon in such way: the first piece has length 5, the second piece has length 2.
```python #https://codeforces.com/problemset/problem/189/A n=list(map(int,input().split())) abc=sorted(n[1:]) sum=0 for i in range(3): sum+=abc[i] if sum==n[0]: print(i+1) break ```
0
967
A
Mind the Gap
PROGRAMMING
1,100
[ "implementation" ]
null
null
These days Arkady works as an air traffic controller at a large airport. He controls a runway which is usually used for landings only. Thus, he has a schedule of planes that are landing in the nearest future, each landing lasts $1$ minute. He was asked to insert one takeoff in the schedule. The takeoff takes $1$ minute itself, but for safety reasons there should be a time space between the takeoff and any landing of at least $s$ minutes from both sides. Find the earliest time when Arkady can insert the takeoff.
The first line of input contains two integers $n$ and $s$ ($1 \le n \le 100$, $1 \le s \le 60$) — the number of landings on the schedule and the minimum allowed time (in minutes) between a landing and a takeoff. Each of next $n$ lines contains two integers $h$ and $m$ ($0 \le h \le 23$, $0 \le m \le 59$) — the time, in hours and minutes, when a plane will land, starting from current moment (i. e. the current time is $0$ $0$). These times are given in increasing order.
Print two integers $h$ and $m$ — the hour and the minute from the current moment of the earliest time Arkady can insert the takeoff.
[ "6 60\n0 0\n1 20\n3 21\n5 0\n19 30\n23 40\n", "16 50\n0 30\n1 20\n3 0\n4 30\n6 10\n7 50\n9 30\n11 10\n12 50\n14 30\n16 10\n17 50\n19 30\n21 10\n22 50\n23 59\n", "3 17\n0 30\n1 0\n12 0\n" ]
[ "6 1\n", "24 50\n", "0 0\n" ]
In the first example note that there is not enough time between 1:20 and 3:21, because each landing and the takeoff take one minute. In the second example there is no gaps in the schedule, so Arkady can only add takeoff after all landings. Note that it is possible that one should wait more than $24$ hours to insert the takeoff. In the third example Arkady can insert the takeoff even between the first landing.
500
[ { "input": "6 60\n0 0\n1 20\n3 21\n5 0\n19 30\n23 40", "output": "6 1" }, { "input": "16 50\n0 30\n1 20\n3 0\n4 30\n6 10\n7 50\n9 30\n11 10\n12 50\n14 30\n16 10\n17 50\n19 30\n21 10\n22 50\n23 59", "output": "24 50" }, { "input": "3 17\n0 30\n1 0\n12 0", "output": "0 0" }, { "input": "24 60\n0 21\n2 21\n2 46\n3 17\n4 15\n5 43\n6 41\n7 50\n8 21\n9 8\n10 31\n10 45\n12 30\n14 8\n14 29\n14 32\n14 52\n15 16\n16 7\n16 52\n18 44\n20 25\n21 13\n22 7", "output": "23 8" }, { "input": "20 60\n0 9\n0 19\n0 57\n2 42\n3 46\n3 47\n5 46\n8 1\n9 28\n9 41\n10 54\n12 52\n13 0\n14 49\n17 28\n17 39\n19 34\n20 52\n21 35\n23 22", "output": "6 47" }, { "input": "57 20\n0 2\n0 31\n1 9\n1 42\n1 58\n2 4\n2 35\n2 49\n3 20\n3 46\n4 23\n4 52\n5 5\n5 39\n6 7\n6 48\n6 59\n7 8\n7 35\n8 10\n8 46\n8 53\n9 19\n9 33\n9 43\n10 18\n10 42\n11 0\n11 26\n12 3\n12 5\n12 30\n13 1\n13 38\n14 13\n14 54\n15 31\n16 5\n16 44\n17 18\n17 30\n17 58\n18 10\n18 34\n19 13\n19 49\n19 50\n19 59\n20 17\n20 23\n20 40\n21 18\n21 57\n22 31\n22 42\n22 56\n23 37", "output": "23 58" }, { "input": "66 20\n0 16\n0 45\n0 58\n1 6\n1 19\n2 7\n2 9\n3 9\n3 25\n3 57\n4 38\n4 58\n5 21\n5 40\n6 16\n6 19\n6 58\n7 6\n7 26\n7 51\n8 13\n8 36\n8 55\n9 1\n9 15\n9 33\n10 12\n10 37\n11 15\n11 34\n12 8\n12 37\n12 55\n13 26\n14 0\n14 34\n14 36\n14 48\n15 23\n15 29\n15 43\n16 8\n16 41\n16 45\n17 5\n17 7\n17 15\n17 29\n17 46\n18 12\n18 19\n18 38\n18 57\n19 32\n19 58\n20 5\n20 40\n20 44\n20 50\n21 18\n21 49\n22 18\n22 47\n23 1\n23 38\n23 50", "output": "1 40" }, { "input": "1 1\n0 0", "output": "0 2" }, { "input": "10 1\n0 2\n0 4\n0 5\n0 8\n0 9\n0 11\n0 13\n0 16\n0 19\n0 21", "output": "0 0" }, { "input": "10 1\n0 2\n0 5\n0 8\n0 11\n0 15\n0 17\n0 25\n0 28\n0 29\n0 32", "output": "0 0" }, { "input": "15 20\n0 47\n2 24\n4 19\n4 34\n5 46\n8 15\n9 8\n10 28\n17 47\n17 52\n18 32\n19 50\n20 46\n20 50\n23 21", "output": "0 0" }, { "input": "1 5\n1 0", "output": "0 0" }, { "input": "24 60\n1 0\n2 0\n3 0\n4 0\n5 0\n6 0\n7 0\n8 0\n9 0\n10 0\n11 0\n12 0\n13 0\n14 0\n15 0\n16 0\n17 0\n18 0\n19 0\n20 0\n21 0\n22 0\n23 0\n23 59", "output": "25 0" }, { "input": "1 30\n0 29", "output": "1 0" }, { "input": "1 2\n3 0", "output": "0 0" }, { "input": "16 60\n0 30\n1 20\n3 0\n4 30\n6 10\n7 50\n9 30\n11 10\n12 50\n14 30\n16 10\n17 50\n19 30\n21 10\n22 50\n23 59", "output": "25 0" }, { "input": "1 5\n0 6", "output": "0 0" }, { "input": "2 60\n0 59\n23 59", "output": "2 0" }, { "input": "1 58\n0 1", "output": "1 0" }, { "input": "25 60\n0 0\n1 0\n2 0\n3 0\n4 0\n5 0\n6 0\n7 0\n8 0\n9 0\n10 0\n11 0\n12 0\n13 0\n14 0\n15 0\n16 0\n17 0\n18 0\n19 0\n20 0\n21 0\n22 0\n23 0\n23 59", "output": "25 0" }, { "input": "2 3\n0 3\n0 30", "output": "0 7" }, { "input": "16 50\n0 30\n1 20\n3 0\n4 30\n6 10\n7 50\n9 30\n11 10\n12 50\n14 30\n16 10\n17 50\n19 30\n21 10\n22 50\n23 9", "output": "24 0" }, { "input": "1 60\n2 0", "output": "0 0" }, { "input": "2 60\n0 0\n5 0", "output": "1 1" }, { "input": "1 30\n0 31", "output": "0 0" }, { "input": "2 60\n0 59\n3 1", "output": "2 0" }, { "input": "2 60\n0 59\n5 0", "output": "2 0" }, { "input": "1 59\n0 0", "output": "1 0" }, { "input": "3 25\n0 0\n1 0\n2 0", "output": "0 26" }, { "input": "1 2\n2 3", "output": "0 0" } ]
1,525,008,687
987
Python 3
CHALLENGED
CHALLENGES
6
78
7,065,600
n, s = map(int, input().split()) q = 0 for i in range(n): a, b = map(int, input().split()) p = a * 60 + b if i == 0 and p > s + 1: rec = 0 break if p - q > s * 2 + 1: rec = q + s + 1 break q = p rec = q + s + 1 h, m = rec // 60, rec % 60 print(h, m)
Title: Mind the Gap Time Limit: None seconds Memory Limit: None megabytes Problem Description: These days Arkady works as an air traffic controller at a large airport. He controls a runway which is usually used for landings only. Thus, he has a schedule of planes that are landing in the nearest future, each landing lasts $1$ minute. He was asked to insert one takeoff in the schedule. The takeoff takes $1$ minute itself, but for safety reasons there should be a time space between the takeoff and any landing of at least $s$ minutes from both sides. Find the earliest time when Arkady can insert the takeoff. Input Specification: The first line of input contains two integers $n$ and $s$ ($1 \le n \le 100$, $1 \le s \le 60$) — the number of landings on the schedule and the minimum allowed time (in minutes) between a landing and a takeoff. Each of next $n$ lines contains two integers $h$ and $m$ ($0 \le h \le 23$, $0 \le m \le 59$) — the time, in hours and minutes, when a plane will land, starting from current moment (i. e. the current time is $0$ $0$). These times are given in increasing order. Output Specification: Print two integers $h$ and $m$ — the hour and the minute from the current moment of the earliest time Arkady can insert the takeoff. Demo Input: ['6 60\n0 0\n1 20\n3 21\n5 0\n19 30\n23 40\n', '16 50\n0 30\n1 20\n3 0\n4 30\n6 10\n7 50\n9 30\n11 10\n12 50\n14 30\n16 10\n17 50\n19 30\n21 10\n22 50\n23 59\n', '3 17\n0 30\n1 0\n12 0\n'] Demo Output: ['6 1\n', '24 50\n', '0 0\n'] Note: In the first example note that there is not enough time between 1:20 and 3:21, because each landing and the takeoff take one minute. In the second example there is no gaps in the schedule, so Arkady can only add takeoff after all landings. Note that it is possible that one should wait more than $24$ hours to insert the takeoff. In the third example Arkady can insert the takeoff even between the first landing.
```python n, s = map(int, input().split()) q = 0 for i in range(n): a, b = map(int, input().split()) p = a * 60 + b if i == 0 and p > s + 1: rec = 0 break if p - q > s * 2 + 1: rec = q + s + 1 break q = p rec = q + s + 1 h, m = rec // 60, rec % 60 print(h, m) ```
-1
75
C
Modified GCD
PROGRAMMING
1,600
[ "binary search", "number theory" ]
C. Modified GCD
2
256
Well, here is another math class task. In mathematics, GCD is the greatest common divisor, and it's an easy task to calculate the GCD between two positive integers. A common divisor for two positive numbers is a number which both numbers are divisible by. But your teacher wants to give you a harder task, in this task you have to find the greatest common divisor *d* between two integers *a* and *b* that is in a given range from *low* to *high* (inclusive), i.e. *low*<=≤<=*d*<=≤<=*high*. It is possible that there is no common divisor in the given range. You will be given the two integers *a* and *b*, then *n* queries. Each query is a range from *low* to *high* and you have to answer each query.
The first line contains two integers *a* and *b*, the two integers as described above (1<=≤<=*a*,<=*b*<=≤<=109). The second line contains one integer *n*, the number of queries (1<=≤<=*n*<=≤<=104). Then *n* lines follow, each line contains one query consisting of two integers, *low* and *high* (1<=≤<=*low*<=≤<=*high*<=≤<=109).
Print *n* lines. The *i*-th of them should contain the result of the *i*-th query in the input. If there is no common divisor in the given range for any query, you should print -1 as a result for this query.
[ "9 27\n3\n1 5\n10 11\n9 11\n" ]
[ "3\n-1\n9\n" ]
none
1,500
[ { "input": "9 27\n3\n1 5\n10 11\n9 11", "output": "3\n-1\n9" }, { "input": "48 72\n2\n8 29\n29 37", "output": "24\n-1" }, { "input": "90 100\n10\n51 61\n6 72\n1 84\n33 63\n37 69\n18 21\n9 54\n49 90\n14 87\n37 90", "output": "-1\n10\n10\n-1\n-1\n-1\n10\n-1\n-1\n-1" }, { "input": "84 36\n1\n18 32", "output": "-1" }, { "input": "90 36\n16\n13 15\n5 28\n11 30\n26 35\n2 8\n19 36\n3 17\n5 14\n4 26\n22 33\n16 33\n18 27\n4 17\n1 2\n29 31\n18 36", "output": "-1\n18\n18\n-1\n6\n-1\n9\n9\n18\n-1\n18\n18\n9\n2\n-1\n18" }, { "input": "84 90\n18\n10 75\n2 40\n30 56\n49 62\n19 33\n5 79\n61 83\n13 56\n73 78\n1 18\n23 35\n14 72\n22 33\n1 21\n8 38\n54 82\n6 80\n57 75", "output": "-1\n6\n-1\n-1\n-1\n6\n-1\n-1\n-1\n6\n-1\n-1\n-1\n6\n-1\n-1\n6\n-1" }, { "input": "84 100\n16\n10 64\n3 61\n19 51\n42 67\n51 68\n12 40\n10 47\n52 53\n37 67\n2 26\n23 47\n17 75\n49 52\n3 83\n63 81\n8 43", "output": "-1\n4\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n4\n-1\n-1\n-1\n4\n-1\n-1" }, { "input": "36 60\n2\n17 25\n16 20", "output": "-1\n-1" }, { "input": "90 100\n8\n55 75\n46 68\n44 60\n32 71\n43 75\n23 79\n47 86\n11 57", "output": "-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1" }, { "input": "90 36\n8\n1 19\n10 12\n14 28\n21 24\n8 8\n33 34\n10 26\n15 21", "output": "18\n-1\n18\n-1\n-1\n-1\n18\n18" }, { "input": "48 80\n19\n1 1\n16 16\n1 16\n16 48\n16 80\n16 1000000000\n1000000000 1000000000\n1 1000000000\n500000000 1000000000\n15 17\n17 17\n15 15\n8 8\n8 15\n8 16\n8 17\n7 17\n7 15\n9 15", "output": "1\n16\n16\n16\n16\n16\n-1\n16\n-1\n16\n-1\n-1\n8\n8\n16\n16\n16\n8\n-1" }, { "input": "31607 999002449\n18\n31607 31607\n31606 31608\n31607 31608\n31606 31607\n31606 31606\n31608 31608\n1 31607\n1 31606\n1 31608\n1 1000000000\n31607 1000000000\n31606 1000000000\n31608 1000000000\n1000000000 1000000000\n1 1\n2 31606\n2 31607\n2 31608", "output": "31607\n31607\n31607\n31607\n-1\n-1\n31607\n1\n31607\n31607\n31607\n31607\n-1\n-1\n1\n-1\n31607\n31607" }, { "input": "999999937 999999929\n12\n999999929 999999937\n1 1\n1 1000000000\n2 1000000000\n1 2\n999999937 999999937\n999999929 999999929\n2 2\n3 3\n1 100\n1 999999937\n1 999999929", "output": "-1\n1\n1\n-1\n1\n-1\n-1\n-1\n-1\n1\n1\n1" } ]
1,585,048,164
2,147,483,647
PyPy 3
OK
TESTS
60
778
5,222,400
from math import gcd a,b = list(map(int, input().split())) cd = gcd(a,b) ar =[] for i in range(1,int(cd**0.5)+1): if cd % i == 0: ar.append(i) if(i*i != cd): ar.append(cd//i) for _ in range(int(input())): l,h = list(map(int, input().split())) res = -1 for i in ar: if(i >= l and i <= h): res = max(res, i) print(res)
Title: Modified GCD Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Well, here is another math class task. In mathematics, GCD is the greatest common divisor, and it's an easy task to calculate the GCD between two positive integers. A common divisor for two positive numbers is a number which both numbers are divisible by. But your teacher wants to give you a harder task, in this task you have to find the greatest common divisor *d* between two integers *a* and *b* that is in a given range from *low* to *high* (inclusive), i.e. *low*<=≤<=*d*<=≤<=*high*. It is possible that there is no common divisor in the given range. You will be given the two integers *a* and *b*, then *n* queries. Each query is a range from *low* to *high* and you have to answer each query. Input Specification: The first line contains two integers *a* and *b*, the two integers as described above (1<=≤<=*a*,<=*b*<=≤<=109). The second line contains one integer *n*, the number of queries (1<=≤<=*n*<=≤<=104). Then *n* lines follow, each line contains one query consisting of two integers, *low* and *high* (1<=≤<=*low*<=≤<=*high*<=≤<=109). Output Specification: Print *n* lines. The *i*-th of them should contain the result of the *i*-th query in the input. If there is no common divisor in the given range for any query, you should print -1 as a result for this query. Demo Input: ['9 27\n3\n1 5\n10 11\n9 11\n'] Demo Output: ['3\n-1\n9\n'] Note: none
```python from math import gcd a,b = list(map(int, input().split())) cd = gcd(a,b) ar =[] for i in range(1,int(cd**0.5)+1): if cd % i == 0: ar.append(i) if(i*i != cd): ar.append(cd//i) for _ in range(int(input())): l,h = list(map(int, input().split())) res = -1 for i in ar: if(i >= l and i <= h): res = max(res, i) print(res) ```
3.795773
474
A
Keyboard
PROGRAMMING
900
[ "implementation" ]
null
null
Our good friend Mole is trying to code a big message. He is typing on an unusual keyboard with characters arranged in following way: Unfortunately Mole is blind, so sometimes it is problem for him to put his hands accurately. He accidentally moved both his hands with one position to the left or to the right. That means that now he presses not a button he wants, but one neighboring button (left or right, as specified in input). We have a sequence of characters he has typed and we want to find the original message.
First line of the input contains one letter describing direction of shifting ('L' or 'R' respectively for left or right). Second line contains a sequence of characters written by Mole. The size of this sequence will be no more than 100. Sequence contains only symbols that appear on Mole's keyboard. It doesn't contain spaces as there is no space on Mole's keyboard. It is guaranteed that even though Mole hands are moved, he is still pressing buttons on keyboard and not hitting outside it.
Print a line that contains the original message.
[ "R\ns;;upimrrfod;pbr\n" ]
[ "allyouneedislove\n" ]
none
500
[ { "input": "R\ns;;upimrrfod;pbr", "output": "allyouneedislove" }, { "input": "R\nwertyuiop;lkjhgfdsxcvbnm,.", "output": "qwertyuiolkjhgfdsazxcvbnm," }, { "input": "L\nzxcvbnm,kjhgfdsaqwertyuio", "output": "xcvbnm,.lkjhgfdswertyuiop" }, { "input": "R\nbubbuduppudup", "output": "vyvvysyooysyo" }, { "input": "L\ngggggggggggggggggggggggggggggggggggggggggg", "output": "hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh" }, { "input": "R\ngggggggggggggggggggggggggggggggggggggggggg", "output": "ffffffffffffffffffffffffffffffffffffffffff" }, { "input": "L\nggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggg", "output": "hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh" }, { "input": "R\nggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggg", "output": "fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff" }, { "input": "L\nxgwurenkxkiau,c,vonei.zltazmnkhqtwuogkgvgckvja,z.rhanuy.ybebmzcfwozkwvuuiolaqlgvvvewnbuinrncgjwjdsfw", "output": "cheitrmlclosi.v.bpmro/x;ysx,mljwyeiphlhbhvlbks.x/tjsmiu/unrn,xvgepxlebiiop;sw;hbbbremniomtmvhkekfdge" }, { "input": "L\nuoz.vmks,wxrb,nwcvdzh.m,hwsios.lvu,ktes,,ythddhm.sh,d,c,cfj.wqam,bowofbyx,jathqayhreqvixvbmgdokofmym", "output": "ipx/b,ld.ectn.mevbfxj/,.jedopd/;bi.lyrd..uyjffj,/dj.f.v.vgk/ews,.npepgnuc.ksyjwsujtrwbocbn,hfplpg,u," }, { "input": "R\noedjyrvuw/rn.v.hdwndbiposiewgsn.pnyf;/tsdohp,hrtd/mx,;coj./billd..mwbneohcikrdes/ucjr,wspthleyp,..f,", "output": "iwshtecyq.eb,c,gsqbsvuoiauwqfab,obtdl.rasigomgers.nzmlxih,.vukks,,nqvbwigxujeswa.yxhemqaorgkwtom,,dm" }, { "input": "R\nvgj;o;ijrtfyck,dthccioltcx,crub;oceooognsuvfx/kgo.fbsudv,yod.erdrxhbeiyltxhnrobbb;ydrgroefcr/f;uvdjd", "output": "cfhliluherdtxjmsrgxxuikrxzmxeyvlixwiiifbaycdz.jfi,dvayscmtis,wesezgvwutkrzgbeivvvltsefeiwdxe.dlycshs" }, { "input": "L\nqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq", "output": "wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww" }, { "input": "L\noooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo", "output": "pppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppp" }, { "input": "L\n,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,", "output": "...................................................................................................." }, { "input": "L\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz", "output": "xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx" }, { "input": "R\noooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo", "output": "iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii" }, { "input": "R\nwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww", "output": "qqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq" }, { "input": "R\nxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx", "output": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz" }, { "input": "L\nq", "output": "w" }, { "input": "L\no", "output": "p" }, { "input": "L\n,", "output": "." }, { "input": "L\nz", "output": "x" }, { "input": "R\n.", "output": "," }, { "input": "R\no", "output": "i" }, { "input": "R\nw", "output": "q" }, { "input": "R\nx", "output": "z" }, { "input": "R\n,./", "output": "m,." }, { "input": "R\nwertuk;;/", "output": "qweryjll." }, { "input": "L\n..", "output": "//" } ]
1,671,606,919
2,147,483,647
Python 3
OK
TESTS
31
46
0
s='qwertyuiopasdfghjkl;zxcvbnm,./' lr = input() de = input() if lr=='L': l=[s[s.index(i)+1] for i in de] print(''.join(map(str,l))) else: l=[s[s.index(i)-1] for i in de] print(''.join(map(str,l)))
Title: Keyboard Time Limit: None seconds Memory Limit: None megabytes Problem Description: Our good friend Mole is trying to code a big message. He is typing on an unusual keyboard with characters arranged in following way: Unfortunately Mole is blind, so sometimes it is problem for him to put his hands accurately. He accidentally moved both his hands with one position to the left or to the right. That means that now he presses not a button he wants, but one neighboring button (left or right, as specified in input). We have a sequence of characters he has typed and we want to find the original message. Input Specification: First line of the input contains one letter describing direction of shifting ('L' or 'R' respectively for left or right). Second line contains a sequence of characters written by Mole. The size of this sequence will be no more than 100. Sequence contains only symbols that appear on Mole's keyboard. It doesn't contain spaces as there is no space on Mole's keyboard. It is guaranteed that even though Mole hands are moved, he is still pressing buttons on keyboard and not hitting outside it. Output Specification: Print a line that contains the original message. Demo Input: ['R\ns;;upimrrfod;pbr\n'] Demo Output: ['allyouneedislove\n'] Note: none
```python s='qwertyuiopasdfghjkl;zxcvbnm,./' lr = input() de = input() if lr=='L': l=[s[s.index(i)+1] for i in de] print(''.join(map(str,l))) else: l=[s[s.index(i)-1] for i in de] print(''.join(map(str,l))) ```
3
82
A
Double Cola
PROGRAMMING
1,100
[ "implementation", "math" ]
A. Double Cola
1
256
Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum. For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny. Write a program that will print the name of a man who will drink the *n*-th can. Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon.
The input data consist of a single integer *n* (1<=≤<=*n*<=≤<=109). It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers.
Print the single line — the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially.
[ "1\n", "6\n", "1802\n" ]
[ "Sheldon\n", "Sheldon\n", "Penny\n" ]
none
500
[ { "input": "1", "output": "Sheldon" }, { "input": "6", "output": "Sheldon" }, { "input": "1802", "output": "Penny" }, { "input": "1", "output": "Sheldon" }, { "input": "2", "output": "Leonard" }, { "input": "3", "output": "Penny" }, { "input": "4", "output": "Rajesh" }, { "input": "5", "output": "Howard" }, { "input": "10", "output": "Penny" }, { "input": "534", "output": "Rajesh" }, { "input": "5033", "output": "Howard" }, { "input": "10010", "output": "Howard" }, { "input": "500000000", "output": "Penny" }, { "input": "63", "output": "Rajesh" }, { "input": "841", "output": "Leonard" }, { "input": "3667", "output": "Penny" }, { "input": "38614", "output": "Howard" }, { "input": "282798", "output": "Rajesh" }, { "input": "9266286", "output": "Rajesh" }, { "input": "27385966", "output": "Leonard" }, { "input": "121580142", "output": "Penny" }, { "input": "5", "output": "Howard" }, { "input": "300", "output": "Howard" }, { "input": "1745", "output": "Leonard" }, { "input": "8302", "output": "Rajesh" }, { "input": "184518", "output": "Sheldon" }, { "input": "1154414", "output": "Rajesh" }, { "input": "28643950", "output": "Leonard" }, { "input": "159222638", "output": "Howard" }, { "input": "24", "output": "Penny" }, { "input": "505", "output": "Penny" }, { "input": "4425", "output": "Rajesh" }, { "input": "12079", "output": "Sheldon" }, { "input": "469726", "output": "Penny" }, { "input": "3961838", "output": "Penny" }, { "input": "57710446", "output": "Leonard" }, { "input": "80719470", "output": "Howard" }, { "input": "1000000000", "output": "Penny" }, { "input": "999999999", "output": "Penny" }, { "input": "999999998", "output": "Penny" }, { "input": "5", "output": "Howard" } ]
1,539,930,246
2,147,483,647
Python 3
OK
TESTS
41
109
0
# -*- coding: utf-8 -*- """ Created on Fri Oct 19 13:52:28 2018 @author: Quaint Sun """ ''' n=int(input()) queue=['Sheldon', 'Leonard', 'Penny', 'Rajesh', 'Howard'] t=0 while t<n: queue.append(queue[0]) queue.append(queue[0]) del queue[0] t=t+1 print(queue[-1])''' n=int(input()) queue=['Sheldon', 'Leonard', 'Penny', 'Rajesh', 'Howard'] num=0 for i in range(n): if n>num: num=num+5*(2**i) else: break if n<6: print(queue[n-1]) else: numpast=num-5*(2**(i-1)) name=(n-numpast)//(2**(i-1)) print(queue[name])
Title: Double Cola Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum. For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny. Write a program that will print the name of a man who will drink the *n*-th can. Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon. Input Specification: The input data consist of a single integer *n* (1<=≤<=*n*<=≤<=109). It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers. Output Specification: Print the single line — the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially. Demo Input: ['1\n', '6\n', '1802\n'] Demo Output: ['Sheldon\n', 'Sheldon\n', 'Penny\n'] Note: none
```python # -*- coding: utf-8 -*- """ Created on Fri Oct 19 13:52:28 2018 @author: Quaint Sun """ ''' n=int(input()) queue=['Sheldon', 'Leonard', 'Penny', 'Rajesh', 'Howard'] t=0 while t<n: queue.append(queue[0]) queue.append(queue[0]) del queue[0] t=t+1 print(queue[-1])''' n=int(input()) queue=['Sheldon', 'Leonard', 'Penny', 'Rajesh', 'Howard'] num=0 for i in range(n): if n>num: num=num+5*(2**i) else: break if n<6: print(queue[n-1]) else: numpast=num-5*(2**(i-1)) name=(n-numpast)//(2**(i-1)) print(queue[name]) ```
3.9455
574
B
Bear and Three Musketeers
PROGRAMMING
1,500
[ "brute force", "dfs and similar", "graphs", "hashing" ]
null
null
Do you know a story about the three musketeers? Anyway, you will learn about its origins now. Richelimakieu is a cardinal in the city of Bearis. He is tired of dealing with crime by himself. He needs three brave warriors to help him to fight against bad guys. There are *n* warriors. Richelimakieu wants to choose three of them to become musketeers but it's not that easy. The most important condition is that musketeers must know each other to cooperate efficiently. And they shouldn't be too well known because they could be betrayed by old friends. For each musketeer his recognition is the number of warriors he knows, excluding other two musketeers. Help Richelimakieu! Find if it is possible to choose three musketeers knowing each other, and what is minimum possible sum of their recognitions.
The first line contains two space-separated integers, *n* and *m* (3<=≤<=*n*<=≤<=4000, 0<=≤<=*m*<=≤<=4000) — respectively number of warriors and number of pairs of warriors knowing each other. *i*-th of the following *m* lines contains two space-separated integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*). Warriors *a**i* and *b**i* know each other. Each pair of warriors will be listed at most once.
If Richelimakieu can choose three musketeers, print the minimum possible sum of their recognitions. Otherwise, print "-1" (without the quotes).
[ "5 6\n1 2\n1 3\n2 3\n2 4\n3 4\n4 5\n", "7 4\n2 1\n3 6\n5 1\n1 7\n" ]
[ "2\n", "-1\n" ]
In the first sample Richelimakieu should choose a triple 1, 2, 3. The first musketeer doesn't know anyone except other two musketeers so his recognition is 0. The second musketeer has recognition 1 because he knows warrior number 4. The third musketeer also has recognition 1 because he knows warrior 4. Sum of recognitions is 0 + 1 + 1 = 2. The other possible triple is 2, 3, 4 but it has greater sum of recognitions, equal to 1 + 1 + 1 = 3. In the second sample there is no triple of warriors knowing each other.
1,000
[ { "input": "5 6\n1 2\n1 3\n2 3\n2 4\n3 4\n4 5", "output": "2" }, { "input": "7 4\n2 1\n3 6\n5 1\n1 7", "output": "-1" }, { "input": "5 0", "output": "-1" }, { "input": "7 14\n3 6\n2 3\n5 2\n5 6\n7 5\n7 4\n6 2\n3 5\n7 1\n4 1\n6 1\n7 6\n6 4\n5 4", "output": "5" }, { "input": "15 15\n4 15\n12 1\n15 6\n11 6\n15 7\n6 8\n15 10\n6 12\n12 8\n15 8\n15 3\n11 9\n7 3\n6 4\n12 11", "output": "4" }, { "input": "12 66\n9 12\n1 4\n8 4\n5 3\n10 5\n12 2\n3 2\n2 7\n1 7\n3 7\n6 2\n4 2\n6 10\n8 10\n4 6\n8 5\n12 6\n11 9\n7 12\n5 4\n11 7\n9 4\n10 4\n6 3\n1 6\n9 7\n3 8\n6 11\n10 9\n3 11\n11 1\n5 12\n8 2\n2 1\n3 1\n12 4\n3 9\n10 12\n8 11\n7 10\n11 5\n9 5\n8 7\n11 4\n8 1\n2 11\n5 1\n3 4\n8 12\n9 2\n10 11\n9 1\n5 7\n10 3\n11 12\n7 4\n2 10\n12 3\n6 8\n7 6\n2 5\n1 10\n12 1\n9 6\n8 9\n6 5", "output": "27" }, { "input": "3 0", "output": "-1" }, { "input": "3 2\n2 3\n2 1", "output": "-1" }, { "input": "3 3\n3 1\n3 2\n2 1", "output": "0" }, { "input": "4 6\n3 4\n1 3\n4 1\n3 2\n2 1\n4 2", "output": "3" }, { "input": "8 10\n1 5\n4 1\n1 2\n2 8\n2 7\n6 3\n5 8\n3 5\n7 8\n1 6", "output": "2" }, { "input": "15 17\n1 3\n7 10\n7 9\n8 13\n6 15\n8 2\n13 6\n10 5\n15 3\n4 15\n4 6\n5 11\n13 9\n12 2\n11 14\n4 12\n14 1", "output": "3" }, { "input": "25 10\n19 11\n19 13\n13 11\n13 22\n19 23\n19 20\n13 17\n19 14\n13 15\n19 4", "output": "7" }, { "input": "987 50\n221 959\n221 553\n959 695\n553 959\n819 437\n371 295\n695 553\n959 347\n595 699\n652 628\n553 347\n868 589\n695 221\n282 714\n351 703\n104 665\n755 436\n556 511\n695 347\n221 347\n243 874\n695 847\n863 501\n583 145\n786 221\n38 286\n72 397\n808 658\n724 437\n911 548\n405 759\n681 316\n648 328\n327 199\n772 139\n932 609\n859 576\n915 507\n379 316\n381 348\n918 871\n261 450\n443 389\n549 246\n901 515\n930 923\n336 545\n179 225\n213 677\n458 204", "output": "6" }, { "input": "4000 0", "output": "-1" } ]
1,442,602,886
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
6
2,000
512,000
if __name__=='__main__': inf = 100000005 memo = {} degree = [] n,m=map(int,input().split()) for i in range(n): degree.append(0) memo[i]=[] for i in range(0,m): x,y=map(int,input().split()) memo[x-1].append(y-1) memo[y-1].append(x-1) degree[x-1] += 1 degree[y-1] += 1 result = inf for i in range(0,n): for j in range(i+1,n): if i in memo[j] or j in memo[i]: for k in range(j+1,n): if i in memo[k] and j in memo[k]: result = min(result,degree[i]+degree[j]+degree[k]) if result == inf: print("-1") else: print(result-6)
Title: Bear and Three Musketeers Time Limit: None seconds Memory Limit: None megabytes Problem Description: Do you know a story about the three musketeers? Anyway, you will learn about its origins now. Richelimakieu is a cardinal in the city of Bearis. He is tired of dealing with crime by himself. He needs three brave warriors to help him to fight against bad guys. There are *n* warriors. Richelimakieu wants to choose three of them to become musketeers but it's not that easy. The most important condition is that musketeers must know each other to cooperate efficiently. And they shouldn't be too well known because they could be betrayed by old friends. For each musketeer his recognition is the number of warriors he knows, excluding other two musketeers. Help Richelimakieu! Find if it is possible to choose three musketeers knowing each other, and what is minimum possible sum of their recognitions. Input Specification: The first line contains two space-separated integers, *n* and *m* (3<=≤<=*n*<=≤<=4000, 0<=≤<=*m*<=≤<=4000) — respectively number of warriors and number of pairs of warriors knowing each other. *i*-th of the following *m* lines contains two space-separated integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*). Warriors *a**i* and *b**i* know each other. Each pair of warriors will be listed at most once. Output Specification: If Richelimakieu can choose three musketeers, print the minimum possible sum of their recognitions. Otherwise, print "-1" (without the quotes). Demo Input: ['5 6\n1 2\n1 3\n2 3\n2 4\n3 4\n4 5\n', '7 4\n2 1\n3 6\n5 1\n1 7\n'] Demo Output: ['2\n', '-1\n'] Note: In the first sample Richelimakieu should choose a triple 1, 2, 3. The first musketeer doesn't know anyone except other two musketeers so his recognition is 0. The second musketeer has recognition 1 because he knows warrior number 4. The third musketeer also has recognition 1 because he knows warrior 4. Sum of recognitions is 0 + 1 + 1 = 2. The other possible triple is 2, 3, 4 but it has greater sum of recognitions, equal to 1 + 1 + 1 = 3. In the second sample there is no triple of warriors knowing each other.
```python if __name__=='__main__': inf = 100000005 memo = {} degree = [] n,m=map(int,input().split()) for i in range(n): degree.append(0) memo[i]=[] for i in range(0,m): x,y=map(int,input().split()) memo[x-1].append(y-1) memo[y-1].append(x-1) degree[x-1] += 1 degree[y-1] += 1 result = inf for i in range(0,n): for j in range(i+1,n): if i in memo[j] or j in memo[i]: for k in range(j+1,n): if i in memo[k] and j in memo[k]: result = min(result,degree[i]+degree[j]+degree[k]) if result == inf: print("-1") else: print(result-6) ```
0
760
A
Petr and a calendar
PROGRAMMING
800
[ "implementation", "math" ]
null
null
Petr wants to make a calendar for current month. For this purpose he draws a table in which columns correspond to weeks (a week is seven consequent days from Monday to Sunday), rows correspond to weekdays, and cells contain dates. For example, a calendar for January 2017 should look like on the picture: Petr wants to know how many columns his table should have given the month and the weekday of the first date of that month? Assume that the year is non-leap.
The only line contain two integers *m* and *d* (1<=≤<=*m*<=≤<=12, 1<=≤<=*d*<=≤<=7) — the number of month (January is the first month, December is the twelfth) and the weekday of the first date of this month (1 is Monday, 7 is Sunday).
Print single integer: the number of columns the table should have.
[ "1 7\n", "1 1\n", "11 6\n" ]
[ "6\n", "5\n", "5\n" ]
The first example corresponds to the January 2017 shown on the picture in the statements. In the second example 1-st January is Monday, so the whole month fits into 5 columns. In the third example 1-st November is Saturday and 5 columns is enough.
500
[ { "input": "1 7", "output": "6" }, { "input": "1 1", "output": "5" }, { "input": "11 6", "output": "5" }, { "input": "2 7", "output": "5" }, { "input": "2 1", "output": "4" }, { "input": "8 6", "output": "6" }, { "input": "1 1", "output": "5" }, { "input": "1 2", "output": "5" }, { "input": "1 3", "output": "5" }, { "input": "1 4", "output": "5" }, { "input": "1 5", "output": "5" }, { "input": "1 6", "output": "6" }, { "input": "1 7", "output": "6" }, { "input": "2 1", "output": "4" }, { "input": "2 2", "output": "5" }, { "input": "2 3", "output": "5" }, { "input": "2 4", "output": "5" }, { "input": "2 5", "output": "5" }, { "input": "2 6", "output": "5" }, { "input": "2 7", "output": "5" }, { "input": "3 1", "output": "5" }, { "input": "3 2", "output": "5" }, { "input": "3 3", "output": "5" }, { "input": "3 4", "output": "5" }, { "input": "3 5", "output": "5" }, { "input": "3 6", "output": "6" }, { "input": "3 7", "output": "6" }, { "input": "4 1", "output": "5" }, { "input": "4 2", "output": "5" }, { "input": "4 3", "output": "5" }, { "input": "4 4", "output": "5" }, { "input": "4 5", "output": "5" }, { "input": "4 6", "output": "5" }, { "input": "4 7", "output": "6" }, { "input": "5 1", "output": "5" }, { "input": "5 2", "output": "5" }, { "input": "5 3", "output": "5" }, { "input": "5 4", "output": "5" }, { "input": "5 5", "output": "5" }, { "input": "5 6", "output": "6" }, { "input": "5 7", "output": "6" }, { "input": "6 1", "output": "5" }, { "input": "6 2", "output": "5" }, { "input": "6 3", "output": "5" }, { "input": "6 4", "output": "5" }, { "input": "6 5", "output": "5" }, { "input": "6 6", "output": "5" }, { "input": "6 7", "output": "6" }, { "input": "7 1", "output": "5" }, { "input": "7 2", "output": "5" }, { "input": "7 3", "output": "5" }, { "input": "7 4", "output": "5" }, { "input": "7 5", "output": "5" }, { "input": "7 6", "output": "6" }, { "input": "7 7", "output": "6" }, { "input": "8 1", "output": "5" }, { "input": "8 2", "output": "5" }, { "input": "8 3", "output": "5" }, { "input": "8 4", "output": "5" }, { "input": "8 5", "output": "5" }, { "input": "8 6", "output": "6" }, { "input": "8 7", "output": "6" }, { "input": "9 1", "output": "5" }, { "input": "9 2", "output": "5" }, { "input": "9 3", "output": "5" }, { "input": "9 4", "output": "5" }, { "input": "9 5", "output": "5" }, { "input": "9 6", "output": "5" }, { "input": "9 7", "output": "6" }, { "input": "10 1", "output": "5" }, { "input": "10 2", "output": "5" }, { "input": "10 3", "output": "5" }, { "input": "10 4", "output": "5" }, { "input": "10 5", "output": "5" }, { "input": "10 6", "output": "6" }, { "input": "10 7", "output": "6" }, { "input": "11 1", "output": "5" }, { "input": "11 2", "output": "5" }, { "input": "11 3", "output": "5" }, { "input": "11 4", "output": "5" }, { "input": "11 5", "output": "5" }, { "input": "11 6", "output": "5" }, { "input": "11 7", "output": "6" }, { "input": "12 1", "output": "5" }, { "input": "12 2", "output": "5" }, { "input": "12 3", "output": "5" }, { "input": "12 4", "output": "5" }, { "input": "12 5", "output": "5" }, { "input": "12 6", "output": "6" }, { "input": "12 7", "output": "6" }, { "input": "1 4", "output": "5" }, { "input": "1 5", "output": "5" }, { "input": "9 7", "output": "6" }, { "input": "2 6", "output": "5" }, { "input": "1 6", "output": "6" }, { "input": "2 2", "output": "5" }, { "input": "4 7", "output": "6" }, { "input": "12 6", "output": "6" }, { "input": "12 3", "output": "5" }, { "input": "3 6", "output": "6" }, { "input": "9 6", "output": "5" }, { "input": "7 6", "output": "6" }, { "input": "11 7", "output": "6" }, { "input": "6 6", "output": "5" } ]
1,485,109,144
244
Python 3
OK
TESTS
104
92
4,710,400
def main(): m, d = map(int, input().split()) a = [31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31] num = a[m - 1] ans = 1 num -= (8 - d) ans += ((num + 7 - 1) // 7) print(ans) main()
Title: Petr and a calendar Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petr wants to make a calendar for current month. For this purpose he draws a table in which columns correspond to weeks (a week is seven consequent days from Monday to Sunday), rows correspond to weekdays, and cells contain dates. For example, a calendar for January 2017 should look like on the picture: Petr wants to know how many columns his table should have given the month and the weekday of the first date of that month? Assume that the year is non-leap. Input Specification: The only line contain two integers *m* and *d* (1<=≤<=*m*<=≤<=12, 1<=≤<=*d*<=≤<=7) — the number of month (January is the first month, December is the twelfth) and the weekday of the first date of this month (1 is Monday, 7 is Sunday). Output Specification: Print single integer: the number of columns the table should have. Demo Input: ['1 7\n', '1 1\n', '11 6\n'] Demo Output: ['6\n', '5\n', '5\n'] Note: The first example corresponds to the January 2017 shown on the picture in the statements. In the second example 1-st January is Monday, so the whole month fits into 5 columns. In the third example 1-st November is Saturday and 5 columns is enough.
```python def main(): m, d = map(int, input().split()) a = [31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31] num = a[m - 1] ans = 1 num -= (8 - d) ans += ((num + 7 - 1) // 7) print(ans) main() ```
3
792
B
Counting-out Rhyme
PROGRAMMING
1,300
[ "implementation" ]
null
null
*n* children are standing in a circle and playing the counting-out game. Children are numbered clockwise from 1 to *n*. In the beginning, the first child is considered the leader. The game is played in *k* steps. In the *i*-th step the leader counts out *a**i* people in clockwise order, starting from the next person. The last one to be pointed at by the leader is eliminated, and the next player after him becomes the new leader. For example, if there are children with numbers [8,<=10,<=13,<=14,<=16] currently in the circle, the leader is child 13 and *a**i*<==<=12, then counting-out rhyme ends on child 16, who is eliminated. Child 8 becomes the leader. You have to write a program which prints the number of the child to be eliminated on every step.
The first line contains two integer numbers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=*n*<=-<=1). The next line contains *k* integer numbers *a*1,<=*a*2,<=...,<=*a**k* (1<=≤<=*a**i*<=≤<=109).
Print *k* numbers, the *i*-th one corresponds to the number of child to be eliminated at the *i*-th step.
[ "7 5\n10 4 11 4 1\n", "3 2\n2 5\n" ]
[ "4 2 5 6 1 \n", "3 2 \n" ]
Let's consider first example: - In the first step child 4 is eliminated, child 5 becomes the leader. - In the second step child 2 is eliminated, child 3 becomes the leader. - In the third step child 5 is eliminated, child 6 becomes the leader. - In the fourth step child 6 is eliminated, child 7 becomes the leader. - In the final step child 1 is eliminated, child 3 becomes the leader.
0
[ { "input": "7 5\n10 4 11 4 1", "output": "4 2 5 6 1 " }, { "input": "3 2\n2 5", "output": "3 2 " }, { "input": "2 1\n1", "output": "2 " }, { "input": "2 1\n2", "output": "1 " }, { "input": "2 1\n3", "output": "2 " }, { "input": "10 7\n5 10 4 3 8 10 6", "output": "6 8 3 9 2 4 10 " }, { "input": "10 8\n12 6 12 15 20 8 17 12", "output": "3 10 6 8 2 9 4 5 " }, { "input": "12 10\n76 58 82 54 97 46 17 40 36 15", "output": "5 9 12 1 3 10 8 11 2 4 " }, { "input": "12 6\n76 61 94 15 66 26", "output": "5 12 6 2 7 3 " }, { "input": "90 10\n1045 8705 6077 3282 1459 9809 383 6206 2674 7274", "output": "56 39 45 20 17 55 14 85 51 33 " }, { "input": "100 30\n601771 913885 829106 91674 465657 367068 142461 873149 294276 916519 720701 370006 551782 321506 68525 570684 81178 724855 564907 661130 10112 983124 799801 100639 766045 862312 513021 232094 979480 408554", "output": "72 89 16 26 85 73 29 99 63 30 8 46 70 19 100 93 36 54 65 77 17 79 62 64 21 69 42 82 68 1 " }, { "input": "3 2\n20148340 81473314", "output": "2 3 " }, { "input": "3 2\n301633543 643389490", "output": "2 3 " }, { "input": "6 5\n532623340 628883728 583960589 690950241 488468353", "output": "5 3 6 1 4 " }, { "input": "6 2\n458995521 294343587", "output": "4 1 " }, { "input": "68 1\n5", "output": "6 " } ]
1,490,626,576
1,276
Python 3
RUNTIME_ERROR
TESTS
7
62
4,608,000
n, k = map(int, input().split()) a = list(map(int, input().split())) cur = 0 x = [] for i in range(n): x.append(i + 1) for i in range(k): v = cur f = a[i] % n for j in range(f): v += 1 if v >= n: v = v - n print(x[v], end=' ') x.pop(v) n -= 1 cur = v
Title: Counting-out Rhyme Time Limit: None seconds Memory Limit: None megabytes Problem Description: *n* children are standing in a circle and playing the counting-out game. Children are numbered clockwise from 1 to *n*. In the beginning, the first child is considered the leader. The game is played in *k* steps. In the *i*-th step the leader counts out *a**i* people in clockwise order, starting from the next person. The last one to be pointed at by the leader is eliminated, and the next player after him becomes the new leader. For example, if there are children with numbers [8,<=10,<=13,<=14,<=16] currently in the circle, the leader is child 13 and *a**i*<==<=12, then counting-out rhyme ends on child 16, who is eliminated. Child 8 becomes the leader. You have to write a program which prints the number of the child to be eliminated on every step. Input Specification: The first line contains two integer numbers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=*n*<=-<=1). The next line contains *k* integer numbers *a*1,<=*a*2,<=...,<=*a**k* (1<=≤<=*a**i*<=≤<=109). Output Specification: Print *k* numbers, the *i*-th one corresponds to the number of child to be eliminated at the *i*-th step. Demo Input: ['7 5\n10 4 11 4 1\n', '3 2\n2 5\n'] Demo Output: ['4 2 5 6 1 \n', '3 2 \n'] Note: Let's consider first example: - In the first step child 4 is eliminated, child 5 becomes the leader. - In the second step child 2 is eliminated, child 3 becomes the leader. - In the third step child 5 is eliminated, child 6 becomes the leader. - In the fourth step child 6 is eliminated, child 7 becomes the leader. - In the final step child 1 is eliminated, child 3 becomes the leader.
```python n, k = map(int, input().split()) a = list(map(int, input().split())) cur = 0 x = [] for i in range(n): x.append(i + 1) for i in range(k): v = cur f = a[i] % n for j in range(f): v += 1 if v >= n: v = v - n print(x[v], end=' ') x.pop(v) n -= 1 cur = v ```
-1
331
C1
The Great Julya Calendar
PROGRAMMING
1,100
[ "dp" ]
null
null
Yet another Armageddon is coming! This time the culprit is the Julya tribe calendar. The beavers in this tribe knew math very well. Smart Beaver, an archaeologist, got a sacred plate with a magic integer on it. The translation from Old Beaverish is as follows: "May the Great Beaver bless you! May your chacres open and may your third eye never turn blind from beholding the Truth! Take the magic number, subtract a digit from it (the digit must occur in the number) and get a new magic number. Repeat this operation until a magic number equals zero. The Earth will stand on Three Beavers for the time, equal to the number of subtractions you perform!" Distinct subtraction sequences can obviously get you different number of operations. But the Smart Beaver is ready to face the worst and is asking you to count the minimum number of operations he needs to reduce the magic number to zero.
The single line contains the magic integer *n*, 0<=≤<=*n*. - to get 20 points, you need to solve the problem with constraints: *n*<=≤<=106 (subproblem C1); - to get 40 points, you need to solve the problem with constraints: *n*<=≤<=1012 (subproblems C1+C2); - to get 100 points, you need to solve the problem with constraints: *n*<=≤<=1018 (subproblems C1+C2+C3).
Print a single integer — the minimum number of subtractions that turns the magic number to a zero.
[ "24\n" ]
[ "5" ]
In the first test sample the minimum number of operations can be reached by the following sequence of subtractions:
20
[ { "input": "24", "output": "5" }, { "input": "0", "output": "0" }, { "input": "3", "output": "1" }, { "input": "8", "output": "1" }, { "input": "9", "output": "1" }, { "input": "10", "output": "2" }, { "input": "31", "output": "6" }, { "input": "701", "output": "116" }, { "input": "222", "output": "39" }, { "input": "156", "output": "28" }, { "input": "12343", "output": "1778" }, { "input": "7984", "output": "1178" }, { "input": "1000000", "output": "128207" }, { "input": "1", "output": "1" }, { "input": "3", "output": "1" }, { "input": "5", "output": "1" }, { "input": "11", "output": "3" }, { "input": "77", "output": "14" }, { "input": "216", "output": "37" }, { "input": "1468", "output": "233" }, { "input": "1995", "output": "305" }, { "input": "11010", "output": "1568" }, { "input": "47320", "output": "6746" }, { "input": "258634", "output": "35024" } ]
1,665,905,042
2,147,483,647
Python 3
OK
TESTS1
24
622
0
n = int(input()) count = 0 while n > 0: ns = list(str(n)) ni = [int(x) for x in ns] n -= max(ni) count += 1 print(count)
Title: The Great Julya Calendar Time Limit: None seconds Memory Limit: None megabytes Problem Description: Yet another Armageddon is coming! This time the culprit is the Julya tribe calendar. The beavers in this tribe knew math very well. Smart Beaver, an archaeologist, got a sacred plate with a magic integer on it. The translation from Old Beaverish is as follows: "May the Great Beaver bless you! May your chacres open and may your third eye never turn blind from beholding the Truth! Take the magic number, subtract a digit from it (the digit must occur in the number) and get a new magic number. Repeat this operation until a magic number equals zero. The Earth will stand on Three Beavers for the time, equal to the number of subtractions you perform!" Distinct subtraction sequences can obviously get you different number of operations. But the Smart Beaver is ready to face the worst and is asking you to count the minimum number of operations he needs to reduce the magic number to zero. Input Specification: The single line contains the magic integer *n*, 0<=≤<=*n*. - to get 20 points, you need to solve the problem with constraints: *n*<=≤<=106 (subproblem C1); - to get 40 points, you need to solve the problem with constraints: *n*<=≤<=1012 (subproblems C1+C2); - to get 100 points, you need to solve the problem with constraints: *n*<=≤<=1018 (subproblems C1+C2+C3). Output Specification: Print a single integer — the minimum number of subtractions that turns the magic number to a zero. Demo Input: ['24\n'] Demo Output: ['5'] Note: In the first test sample the minimum number of operations can be reached by the following sequence of subtractions:
```python n = int(input()) count = 0 while n > 0: ns = list(str(n)) ni = [int(x) for x in ns] n -= max(ni) count += 1 print(count) ```
3
427
A
Police Recruits
PROGRAMMING
800
[ "implementation" ]
null
null
The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups. Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime. If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated. Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated.
The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers. If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time.
Print a single integer, the number of crimes which will go untreated.
[ "3\n-1 -1 1\n", "8\n1 -1 1 -1 -1 1 1 1\n", "11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n" ]
[ "2\n", "1\n", "8\n" ]
Lets consider the second example: 1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired. The answer is one, as one crime (on step 5) will go untreated.
500
[ { "input": "3\n-1 -1 1", "output": "2" }, { "input": "8\n1 -1 1 -1 -1 1 1 1", "output": "1" }, { "input": "11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1", "output": "8" }, { "input": "7\n-1 -1 1 1 -1 -1 1", "output": "2" }, { "input": "21\n-1 -1 -1 -1 -1 3 2 -1 6 -1 -1 2 1 -1 2 2 1 6 5 -1 5", "output": "5" }, { "input": "98\n-1 -1 1 -1 -1 -1 -1 1 -1 -1 1 -1 -1 1 -1 1 1 1 -1 1 1 1 1 1 -1 1 -1 -1 -1 -1 1 -1 -1 1 1 -1 1 1 1 -1 -1 -1 -1 -1 -1 1 -1 -1 -1 1 -1 1 -1 1 -1 1 1 1 1 1 1 1 -1 -1 1 1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 1 -1 1 1 1 -1 1 1 -1 -1 -1 1 1 1 -1 -1 -1 1 -1 1 1", "output": "13" }, { "input": "3\n-1 5 4", "output": "1" }, { "input": "146\n4 -1 -1 -1 -1 -1 -1 -1 -1 -1 4 -1 3 -1 3 -1 -1 1 4 -1 2 -1 -1 3 -1 -1 -1 4 1 -1 -1 -1 4 -1 -1 -1 -1 -1 -1 3 2 -1 3 2 4 5 2 4 1 5 -1 -1 2 -1 -1 1 -1 5 3 -1 1 2 2 3 5 3 -1 -1 3 -1 -1 3 5 5 -1 -1 5 -1 4 4 1 -1 -1 -1 2 1 -1 -1 -1 2 5 3 -1 -1 -1 3 -1 5 4 -1 1 -1 -1 3 -1 -1 3 1 1 2 -1 -1 -1 1 3 1 -1 2 -1 -1 5 5 -1 -1 3 4 5 1 -1 2 -1 -1 -1 3 -1 5 3 2 -1 2 -1 -1 5 -1 3 -1", "output": "5" }, { "input": "1\n2", "output": "0" }, { "input": "1\n-1", "output": "1" }, { "input": "2\n1 -1", "output": "0" }, { "input": "2\n-1 1", "output": "1" }, { "input": "2\n1 1", "output": "0" }, { "input": "2\n-1 -1", "output": "2" }, { "input": "4\n10 -1 -1 -1", "output": "0" }, { "input": "1\n1", "output": "0" }, { "input": "4\n-1 -1 1 1", "output": "2" } ]
1,696,595,492
2,147,483,647
Python 3
OK
TESTS
63
77
9,113,600
number_of_events = int(input()) events = input().split() officer_counter = 0 crime_counter = 0 events_list = [int(event) for event in events] for event in events_list: if event > 0: officer_counter += event if event < 0: if officer_counter > 0: officer_counter += event else: crime_counter += event print(abs(crime_counter))
Title: Police Recruits Time Limit: None seconds Memory Limit: None megabytes Problem Description: The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups. Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime. If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated. Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated. Input Specification: The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers. If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time. Output Specification: Print a single integer, the number of crimes which will go untreated. Demo Input: ['3\n-1 -1 1\n', '8\n1 -1 1 -1 -1 1 1 1\n', '11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n'] Demo Output: ['2\n', '1\n', '8\n'] Note: Lets consider the second example: 1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired. The answer is one, as one crime (on step 5) will go untreated.
```python number_of_events = int(input()) events = input().split() officer_counter = 0 crime_counter = 0 events_list = [int(event) for event in events] for event in events_list: if event > 0: officer_counter += event if event < 0: if officer_counter > 0: officer_counter += event else: crime_counter += event print(abs(crime_counter)) ```
3
777
A
Shell Game
PROGRAMMING
1,000
[ "constructive algorithms", "implementation", "math" ]
null
null
Bomboslav likes to look out of the window in his room and watch lads outside playing famous shell game. The game is played by two persons: operator and player. Operator takes three similar opaque shells and places a ball beneath one of them. Then he shuffles the shells by swapping some pairs and the player has to guess the current position of the ball. Bomboslav noticed that guys are not very inventive, so the operator always swaps the left shell with the middle one during odd moves (first, third, fifth, etc.) and always swaps the middle shell with the right one during even moves (second, fourth, etc.). Let's number shells from 0 to 2 from left to right. Thus the left shell is assigned number 0, the middle shell is 1 and the right shell is 2. Bomboslav has missed the moment when the ball was placed beneath the shell, but he knows that exactly *n* movements were made by the operator and the ball was under shell *x* at the end. Now he wonders, what was the initial position of the ball?
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=2·109) — the number of movements made by the operator. The second line contains a single integer *x* (0<=≤<=*x*<=≤<=2) — the index of the shell where the ball was found after *n* movements.
Print one integer from 0 to 2 — the index of the shell where the ball was initially placed.
[ "4\n2\n", "1\n1\n" ]
[ "1\n", "0\n" ]
In the first sample, the ball was initially placed beneath the middle shell and the operator completed four movements. 1. During the first move operator swapped the left shell and the middle shell. The ball is now under the left shell. 1. During the second move operator swapped the middle shell and the right one. The ball is still under the left shell. 1. During the third move operator swapped the left shell and the middle shell again. The ball is again in the middle. 1. Finally, the operators swapped the middle shell and the right shell. The ball is now beneath the right shell.
500
[ { "input": "4\n2", "output": "1" }, { "input": "1\n1", "output": "0" }, { "input": "2\n2", "output": "0" }, { "input": "3\n1", "output": "1" }, { "input": "3\n2", "output": "0" }, { "input": "3\n0", "output": "2" }, { "input": "2000000000\n0", "output": "1" }, { "input": "2\n0", "output": "1" }, { "input": "2\n1", "output": "2" }, { "input": "4\n0", "output": "2" }, { "input": "4\n1", "output": "0" }, { "input": "5\n0", "output": "0" }, { "input": "5\n1", "output": "2" }, { "input": "5\n2", "output": "1" }, { "input": "6\n0", "output": "0" }, { "input": "6\n1", "output": "1" }, { "input": "6\n2", "output": "2" }, { "input": "7\n0", "output": "1" }, { "input": "7\n1", "output": "0" }, { "input": "7\n2", "output": "2" }, { "input": "100000\n0", "output": "2" }, { "input": "100000\n1", "output": "0" }, { "input": "100000\n2", "output": "1" }, { "input": "99999\n1", "output": "1" }, { "input": "99998\n1", "output": "2" }, { "input": "99997\n1", "output": "0" }, { "input": "99996\n1", "output": "1" }, { "input": "99995\n1", "output": "2" }, { "input": "1999999995\n0", "output": "2" }, { "input": "1999999995\n1", "output": "1" }, { "input": "1999999995\n2", "output": "0" }, { "input": "1999999996\n0", "output": "2" }, { "input": "1999999996\n1", "output": "0" }, { "input": "1999999996\n2", "output": "1" }, { "input": "1999999997\n0", "output": "0" }, { "input": "1999999997\n1", "output": "2" }, { "input": "1999999997\n2", "output": "1" }, { "input": "1999999998\n0", "output": "0" }, { "input": "1999999998\n1", "output": "1" }, { "input": "1999999998\n2", "output": "2" }, { "input": "1999999999\n0", "output": "1" }, { "input": "1999999999\n1", "output": "0" }, { "input": "1999999999\n2", "output": "2" }, { "input": "2000000000\n1", "output": "2" }, { "input": "2000000000\n2", "output": "0" }, { "input": "1234567890\n0", "output": "0" }, { "input": "1234567890\n1", "output": "1" }, { "input": "1234567890\n2", "output": "2" }, { "input": "123456789\n0", "output": "2" }, { "input": "123456789\n1", "output": "1" }, { "input": "123456789\n2", "output": "0" }, { "input": "123456790\n0", "output": "2" }, { "input": "12\n2", "output": "2" }, { "input": "32\n1", "output": "2" }, { "input": "20\n2", "output": "0" }, { "input": "10\n1", "output": "0" }, { "input": "1\n0", "output": "1" }, { "input": "76994383\n1", "output": "0" }, { "input": "25\n2", "output": "2" }, { "input": "1\n2", "output": "2" }, { "input": "12\n0", "output": "0" }, { "input": "150\n2", "output": "2" }, { "input": "15\n0", "output": "2" }, { "input": "21\n2", "output": "0" }, { "input": "18\n2", "output": "2" }, { "input": "8\n2", "output": "0" }, { "input": "10\n0", "output": "2" }, { "input": "16\n0", "output": "2" } ]
1,505,723,089
2,147,483,647
Python 3
OK
TESTS
68
62
4,608,000
#!/usr/bin/env python # -*- coding: utf-8 -*- # # @Filename : 401_DIV2_A # @Date : 2017-09-18 16:08 # @Author : LunaFire # @Mail : [email protected] if __name__ == "__main__": ret_map = [ [0, 1, 2], [1, 0, 2], [1, 2, 0], [2, 1, 0], [2, 0, 1], [0, 2, 1] ] n = int(input()) x = int(input()) print(ret_map[n % 6][x])
Title: Shell Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Bomboslav likes to look out of the window in his room and watch lads outside playing famous shell game. The game is played by two persons: operator and player. Operator takes three similar opaque shells and places a ball beneath one of them. Then he shuffles the shells by swapping some pairs and the player has to guess the current position of the ball. Bomboslav noticed that guys are not very inventive, so the operator always swaps the left shell with the middle one during odd moves (first, third, fifth, etc.) and always swaps the middle shell with the right one during even moves (second, fourth, etc.). Let's number shells from 0 to 2 from left to right. Thus the left shell is assigned number 0, the middle shell is 1 and the right shell is 2. Bomboslav has missed the moment when the ball was placed beneath the shell, but he knows that exactly *n* movements were made by the operator and the ball was under shell *x* at the end. Now he wonders, what was the initial position of the ball? Input Specification: The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=2·109) — the number of movements made by the operator. The second line contains a single integer *x* (0<=≤<=*x*<=≤<=2) — the index of the shell where the ball was found after *n* movements. Output Specification: Print one integer from 0 to 2 — the index of the shell where the ball was initially placed. Demo Input: ['4\n2\n', '1\n1\n'] Demo Output: ['1\n', '0\n'] Note: In the first sample, the ball was initially placed beneath the middle shell and the operator completed four movements. 1. During the first move operator swapped the left shell and the middle shell. The ball is now under the left shell. 1. During the second move operator swapped the middle shell and the right one. The ball is still under the left shell. 1. During the third move operator swapped the left shell and the middle shell again. The ball is again in the middle. 1. Finally, the operators swapped the middle shell and the right shell. The ball is now beneath the right shell.
```python #!/usr/bin/env python # -*- coding: utf-8 -*- # # @Filename : 401_DIV2_A # @Date : 2017-09-18 16:08 # @Author : LunaFire # @Mail : [email protected] if __name__ == "__main__": ret_map = [ [0, 1, 2], [1, 0, 2], [1, 2, 0], [2, 1, 0], [2, 0, 1], [0, 2, 1] ] n = int(input()) x = int(input()) print(ret_map[n % 6][x]) ```
3
598
D
Igor In the Museum
PROGRAMMING
1,700
[ "dfs and similar", "graphs", "shortest paths" ]
null
null
Igor is in the museum and he wants to see as many pictures as possible. Museum can be represented as a rectangular field of *n*<=×<=*m* cells. Each cell is either empty or impassable. Empty cells are marked with '.', impassable cells are marked with '*'. Every two adjacent cells of different types (one empty and one impassable) are divided by a wall containing one picture. At the beginning Igor is in some empty cell. At every moment he can move to any empty cell that share a side with the current one. For several starting positions you should calculate the maximum number of pictures that Igor can see. Igor is able to see the picture only if he is in the cell adjacent to the wall with this picture. Igor have a lot of time, so he will examine every picture he can see.
First line of the input contains three integers *n*, *m* and *k* (3<=≤<=*n*,<=*m*<=≤<=1000,<=1<=≤<=*k*<=≤<=*min*(*n*·*m*,<=100<=000)) — the museum dimensions and the number of starting positions to process. Each of the next *n* lines contains *m* symbols '.', '*' — the description of the museum. It is guaranteed that all border cells are impassable, so Igor can't go out from the museum. Each of the last *k* lines contains two integers *x* and *y* (1<=≤<=*x*<=≤<=*n*,<=1<=≤<=*y*<=≤<=*m*) — the row and the column of one of Igor's starting positions respectively. Rows are numbered from top to bottom, columns — from left to right. It is guaranteed that all starting positions are empty cells.
Print *k* integers — the maximum number of pictures, that Igor can see if he starts in corresponding position.
[ "5 6 3\n******\n*..*.*\n******\n*....*\n******\n2 2\n2 5\n4 3\n", "4 4 1\n****\n*..*\n*.**\n****\n3 2\n" ]
[ "6\n4\n10\n", "8\n" ]
none
0
[ { "input": "5 6 3\n******\n*..*.*\n******\n*....*\n******\n2 2\n2 5\n4 3", "output": "6\n4\n10" }, { "input": "4 4 1\n****\n*..*\n*.**\n****\n3 2", "output": "8" }, { "input": "3 3 1\n***\n*.*\n***\n2 2", "output": "4" }, { "input": "5 5 10\n*****\n*...*\n*..**\n*.***\n*****\n2 4\n4 2\n2 2\n2 3\n2 2\n2 2\n2 4\n3 2\n2 2\n2 2", "output": "12\n12\n12\n12\n12\n12\n12\n12\n12\n12" }, { "input": "10 3 10\n***\n*.*\n*.*\n***\n***\n*.*\n*.*\n*.*\n*.*\n***\n2 2\n2 2\n2 2\n2 2\n8 2\n2 2\n2 2\n7 2\n8 2\n6 2", "output": "6\n6\n6\n6\n10\n6\n6\n10\n10\n10" }, { "input": "3 10 10\n**********\n***.*.*..*\n**********\n2 6\n2 6\n2 9\n2 9\n2 4\n2 9\n2 6\n2 6\n2 4\n2 6", "output": "4\n4\n6\n6\n4\n6\n4\n4\n4\n4" }, { "input": "10 10 50\n**********\n*......***\n***..**..*\n***....***\n**..***..*\n**..**.*.*\n*****..***\n*.***..***\n*..****.**\n**********\n5 9\n5 9\n7 7\n6 4\n6 7\n8 7\n6 7\n9 2\n3 9\n9 2\n4 7\n4 6\n2 7\n9 2\n7 7\n5 8\n8 7\n8 6\n7 7\n5 9\n8 7\n3 8\n3 8\n5 9\n9 8\n9 3\n8 7\n5 9\n9 2\n9 8\n9 3\n3 8\n9 2\n8 6\n2 4\n6 9\n6 3\n9 8\n3 9\n9 8\n4 5\n8 6\n3 8\n5 9\n8 7\n5 8\n6 9\n8 2\n3 9\n3 9", "output": "8\n8\n10\n28\n10\n10\n10\n8\n6\n8\n28\n28\n28\n8\n10\n8\n10\n10\n10\n8\n10\n6\n6\n8\n4\n8\n10\n8\n8\n4\n8\n6\n8\n10\n28\n8\n28\n4\n6\n4\n28\n10\n6\n8\n10\n8\n8\n8\n6\n6" }, { "input": "5 5 21\n*****\n*.***\n*****\n*****\n*****\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2", "output": "4\n4\n4\n4\n4\n4\n4\n4\n4\n4\n4\n4\n4\n4\n4\n4\n4\n4\n4\n4\n4" } ]
1,682,796,563
2,147,483,647
PyPy 3-64
TIME_LIMIT_EXCEEDED
TESTS
9
1,000
42,188,800
from collections import deque WALL = "*" walked_steps = {} # {(2, 3): 12, } def input_line(): return map(int, input().split()) class MuseumWalk: def __init__(self, museum): self.pictures_count = 0 self.museum = museum self.walked_points = set() self.max_y = len(self.museum[0]) self.max_x = len(self.museum) self.visited_nodes = [[False] * self.max_y for _ in range(self.max_x)] def walk(self, node): queue = deque([node]) self.visited_nodes[node[0]][node[1]] = True while queue: x, y = queue.popleft() self.walked_points.add((x, y)) nodes_to_visit = [ (x + 1, y), (x - 1, y), (x, y + 1), (x, y - 1) ] for a, b in nodes_to_visit: if 0 <= a < self.max_x and 0 <= b < self.max_y: if not self.visited_nodes[a][b]: node_content = self.museum[a][b] if node_content == WALL: self.pictures_count += 1 self.visited_nodes[a][b] = True else: queue.append((a, b)) self.visited_nodes[a][b] = True elif self.museum[a][b] == WALL: self.pictures_count += 1 return (self.pictures_count, self.walked_points) n, m, k = input_line() matrix_museum = [list(input()) for _ in range(n)] started_positions = [] for _ in range(k): x, y = input_line() x -= 1 y -= 1 if (x, y) in walked_steps: print(walked_steps[(x, y)]) else: museum = MuseumWalk(matrix_museum) total_pictures, walked_points = museum.walk((x, y)) for (x, y) in walked_points: walked_steps[(x, y)] = total_pictures print(total_pictures)
Title: Igor In the Museum Time Limit: None seconds Memory Limit: None megabytes Problem Description: Igor is in the museum and he wants to see as many pictures as possible. Museum can be represented as a rectangular field of *n*<=×<=*m* cells. Each cell is either empty or impassable. Empty cells are marked with '.', impassable cells are marked with '*'. Every two adjacent cells of different types (one empty and one impassable) are divided by a wall containing one picture. At the beginning Igor is in some empty cell. At every moment he can move to any empty cell that share a side with the current one. For several starting positions you should calculate the maximum number of pictures that Igor can see. Igor is able to see the picture only if he is in the cell adjacent to the wall with this picture. Igor have a lot of time, so he will examine every picture he can see. Input Specification: First line of the input contains three integers *n*, *m* and *k* (3<=≤<=*n*,<=*m*<=≤<=1000,<=1<=≤<=*k*<=≤<=*min*(*n*·*m*,<=100<=000)) — the museum dimensions and the number of starting positions to process. Each of the next *n* lines contains *m* symbols '.', '*' — the description of the museum. It is guaranteed that all border cells are impassable, so Igor can't go out from the museum. Each of the last *k* lines contains two integers *x* and *y* (1<=≤<=*x*<=≤<=*n*,<=1<=≤<=*y*<=≤<=*m*) — the row and the column of one of Igor's starting positions respectively. Rows are numbered from top to bottom, columns — from left to right. It is guaranteed that all starting positions are empty cells. Output Specification: Print *k* integers — the maximum number of pictures, that Igor can see if he starts in corresponding position. Demo Input: ['5 6 3\n******\n*..*.*\n******\n*....*\n******\n2 2\n2 5\n4 3\n', '4 4 1\n****\n*..*\n*.**\n****\n3 2\n'] Demo Output: ['6\n4\n10\n', '8\n'] Note: none
```python from collections import deque WALL = "*" walked_steps = {} # {(2, 3): 12, } def input_line(): return map(int, input().split()) class MuseumWalk: def __init__(self, museum): self.pictures_count = 0 self.museum = museum self.walked_points = set() self.max_y = len(self.museum[0]) self.max_x = len(self.museum) self.visited_nodes = [[False] * self.max_y for _ in range(self.max_x)] def walk(self, node): queue = deque([node]) self.visited_nodes[node[0]][node[1]] = True while queue: x, y = queue.popleft() self.walked_points.add((x, y)) nodes_to_visit = [ (x + 1, y), (x - 1, y), (x, y + 1), (x, y - 1) ] for a, b in nodes_to_visit: if 0 <= a < self.max_x and 0 <= b < self.max_y: if not self.visited_nodes[a][b]: node_content = self.museum[a][b] if node_content == WALL: self.pictures_count += 1 self.visited_nodes[a][b] = True else: queue.append((a, b)) self.visited_nodes[a][b] = True elif self.museum[a][b] == WALL: self.pictures_count += 1 return (self.pictures_count, self.walked_points) n, m, k = input_line() matrix_museum = [list(input()) for _ in range(n)] started_positions = [] for _ in range(k): x, y = input_line() x -= 1 y -= 1 if (x, y) in walked_steps: print(walked_steps[(x, y)]) else: museum = MuseumWalk(matrix_museum) total_pictures, walked_points = museum.walk((x, y)) for (x, y) in walked_points: walked_steps[(x, y)] = total_pictures print(total_pictures) ```
0
281
A
Word Capitalization
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word. Note, that during capitalization all the letters except the first one remains unchanged.
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
Output the given word after capitalization.
[ "ApPLe\n", "konjac\n" ]
[ "ApPLe\n", "Konjac\n" ]
none
500
[ { "input": "ApPLe", "output": "ApPLe" }, { "input": "konjac", "output": "Konjac" }, { "input": "a", "output": "A" }, { "input": "A", "output": "A" }, { "input": "z", "output": "Z" }, { "input": "ABACABA", "output": "ABACABA" }, { "input": "xYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX", "output": "XYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX" }, { "input": "rZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO", "output": "RZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO" }, { "input": "hDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD", "output": "HDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD" }, { "input": "qUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW", "output": "QUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW" }, { "input": "kHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL", "output": "KHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL" }, { "input": "aHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC", "output": "AHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC" }, { "input": "sLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN", "output": "SLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN" }, { "input": "iRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE", "output": "IRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE" }, { "input": "cRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP", "output": "CRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP" }, { "input": "wVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG", "output": "WVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG" }, { "input": "kEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV", "output": "KEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV" }, { "input": "eIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI", "output": "EIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI" }, { "input": "uOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX", "output": "UOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX" }, { "input": "lZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ", "output": "LZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ" }, { "input": "P", "output": "P" }, { "input": "Xyzzy", "output": "Xyzzy" }, { "input": "Zzz", "output": "Zzz" }, { "input": "Zp", "output": "Zp" } ]
1,696,300,409
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
60
0
x = input() x[0].capitalize()+x[1:]
Title: Word Capitalization Time Limit: None seconds Memory Limit: None megabytes Problem Description: Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word. Note, that during capitalization all the letters except the first one remains unchanged. Input Specification: A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103. Output Specification: Output the given word after capitalization. Demo Input: ['ApPLe\n', 'konjac\n'] Demo Output: ['ApPLe\n', 'Konjac\n'] Note: none
```python x = input() x[0].capitalize()+x[1:] ```
0
535
B
Tavas and SaDDas
PROGRAMMING
1,100
[ "bitmasks", "brute force", "combinatorics", "implementation" ]
null
null
Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you." The problem is: You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. If we sort all lucky numbers in increasing order, what's the 1-based index of *n*? Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back.
The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109).
Print the index of *n* among all lucky numbers.
[ "4\n", "7\n", "77\n" ]
[ "1\n", "2\n", "6\n" ]
none
1,000
[ { "input": "4", "output": "1" }, { "input": "7", "output": "2" }, { "input": "77", "output": "6" }, { "input": "4", "output": "1" }, { "input": "474744", "output": "83" }, { "input": "777774", "output": "125" }, { "input": "447", "output": "8" }, { "input": "774", "output": "13" }, { "input": "4", "output": "1" }, { "input": "4447747", "output": "140" }, { "input": "7747474", "output": "233" }, { "input": "4444", "output": "15" }, { "input": "4447", "output": "16" }, { "input": "7", "output": "2" }, { "input": "4", "output": "1" }, { "input": "4447744", "output": "139" }, { "input": "77474", "output": "57" }, { "input": "7747", "output": "28" }, { "input": "444", "output": "7" }, { "input": "7", "output": "2" }, { "input": "7774477", "output": "242" }, { "input": "4477774", "output": "157" }, { "input": "7444", "output": "23" }, { "input": "7474747", "output": "212" }, { "input": "77", "output": "6" }, { "input": "774477", "output": "114" }, { "input": "7", "output": "2" }, { "input": "47", "output": "4" }, { "input": "747777", "output": "110" }, { "input": "444444444", "output": "511" }, { "input": "777777777", "output": "1022" }, { "input": "477477447", "output": "728" }, { "input": "777744747", "output": "996" } ]
1,628,686,221
2,147,483,647
Python 3
OK
TESTS
33
62
7,065,600
f=['4','7'] wave=['4','7'] for i in range(10): r=[] for j in wave: r.append(j+'4') r.append(j+'7') for j in r: f.append(j) wave=r*1 n=int(input()) print(f.index(str(n))+1)
Title: Tavas and SaDDas Time Limit: None seconds Memory Limit: None megabytes Problem Description: Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you." The problem is: You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. If we sort all lucky numbers in increasing order, what's the 1-based index of *n*? Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back. Input Specification: The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109). Output Specification: Print the index of *n* among all lucky numbers. Demo Input: ['4\n', '7\n', '77\n'] Demo Output: ['1\n', '2\n', '6\n'] Note: none
```python f=['4','7'] wave=['4','7'] for i in range(10): r=[] for j in wave: r.append(j+'4') r.append(j+'7') for j in r: f.append(j) wave=r*1 n=int(input()) print(f.index(str(n))+1) ```
3
312
B
Archer
PROGRAMMING
1,300
[ "math", "probabilities" ]
null
null
SmallR is an archer. SmallR is taking a match of archer with Zanoes. They try to shoot in the target in turns, and SmallR shoots first. The probability of shooting the target each time is for SmallR while for Zanoes. The one who shoots in the target first should be the winner. Output the probability that SmallR will win the match.
A single line contains four integers .
Print a single real number, the probability that SmallR will win the match. The answer will be considered correct if the absolute or relative error doesn't exceed 10<=-<=6.
[ "1 2 1 2\n" ]
[ "0.666666666667" ]
none
1,000
[ { "input": "1 2 1 2", "output": "0.666666666667" }, { "input": "1 3 1 3", "output": "0.600000000000" }, { "input": "1 3 2 3", "output": "0.428571428571" }, { "input": "3 4 3 4", "output": "0.800000000000" }, { "input": "1 2 10 11", "output": "0.523809523810" }, { "input": "4 5 4 5", "output": "0.833333333333" }, { "input": "466 701 95 721", "output": "0.937693791148" }, { "input": "268 470 444 885", "output": "0.725614009325" }, { "input": "632 916 713 821", "output": "0.719292895126" }, { "input": "269 656 918 992", "output": "0.428937461623" }, { "input": "71 657 187 695", "output": "0.310488463257" }, { "input": "435 852 973 978", "output": "0.511844133157" }, { "input": "518 816 243 359", "output": "0.719734031025" }, { "input": "882 962 311 811", "output": "0.966386645447" }, { "input": "684 774 580 736", "output": "0.906051574446" }, { "input": "486 868 929 999", "output": "0.577723252958" }, { "input": "132 359 996 998", "output": "0.368154532345" }, { "input": "933 977 266 450", "output": "0.972879407907" }, { "input": "298 833 615 872", "output": "0.441270817024" }, { "input": "34 554 14 958", "output": "0.817324099167" }, { "input": "836 934 800 905", "output": "0.906105535462" }, { "input": "482 815 69 509", "output": "0.914365577772" }, { "input": "284 423 137 521", "output": "0.885974839378" }, { "input": "648 881 486 703", "output": "0.800911421248" }, { "input": "450 885 755 836", "output": "0.533901011176" }, { "input": "533 773 823 998", "output": "0.729222130525" }, { "input": "897 957 92 898", "output": "0.993193806364" }, { "input": "699 925 441 928", "output": "0.866816866175" }, { "input": "64 704 148 603", "output": "0.289486317811" }, { "input": "719 735 626 990", "output": "0.986124079764" }, { "input": "1 1000 1 1000", "output": "0.500250125063" } ]
1,689,639,542
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
30
0
print("_RANDOM_GUESS_1689639542.0853002")# 1689639542.0853207
Title: Archer Time Limit: None seconds Memory Limit: None megabytes Problem Description: SmallR is an archer. SmallR is taking a match of archer with Zanoes. They try to shoot in the target in turns, and SmallR shoots first. The probability of shooting the target each time is for SmallR while for Zanoes. The one who shoots in the target first should be the winner. Output the probability that SmallR will win the match. Input Specification: A single line contains four integers . Output Specification: Print a single real number, the probability that SmallR will win the match. The answer will be considered correct if the absolute or relative error doesn't exceed 10<=-<=6. Demo Input: ['1 2 1 2\n'] Demo Output: ['0.666666666667'] Note: none
```python print("_RANDOM_GUESS_1689639542.0853002")# 1689639542.0853207 ```
0
9
A
Die Roll
PROGRAMMING
800
[ "math", "probabilities" ]
A. Die Roll
1
64
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place. But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams. Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania. It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
[ "4 2\n" ]
[ "1/2\n" ]
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
0
[ { "input": "4 2", "output": "1/2" }, { "input": "1 1", "output": "1/1" }, { "input": "1 2", "output": "5/6" }, { "input": "1 3", "output": "2/3" }, { "input": "1 4", "output": "1/2" }, { "input": "1 5", "output": "1/3" }, { "input": "1 6", "output": "1/6" }, { "input": "2 1", "output": "5/6" }, { "input": "2 2", "output": "5/6" }, { "input": "2 3", "output": "2/3" }, { "input": "2 4", "output": "1/2" }, { "input": "2 5", "output": "1/3" }, { "input": "2 6", "output": "1/6" }, { "input": "3 1", "output": "2/3" }, { "input": "3 2", "output": "2/3" }, { "input": "3 3", "output": "2/3" }, { "input": "3 4", "output": "1/2" }, { "input": "3 5", "output": "1/3" }, { "input": "3 6", "output": "1/6" }, { "input": "4 1", "output": "1/2" }, { "input": "4 3", "output": "1/2" }, { "input": "4 4", "output": "1/2" }, { "input": "4 5", "output": "1/3" }, { "input": "4 6", "output": "1/6" }, { "input": "5 1", "output": "1/3" }, { "input": "5 2", "output": "1/3" }, { "input": "5 3", "output": "1/3" }, { "input": "5 4", "output": "1/3" }, { "input": "5 5", "output": "1/3" }, { "input": "5 6", "output": "1/6" }, { "input": "6 1", "output": "1/6" }, { "input": "6 2", "output": "1/6" }, { "input": "6 3", "output": "1/6" }, { "input": "6 4", "output": "1/6" }, { "input": "6 5", "output": "1/6" }, { "input": "6 6", "output": "1/6" } ]
1,610,394,387
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
92
204,800
def gcd(a,b): if a == b: return a else: ma = 0 if a > b: return gcd(a-b,b) else: return gcd(b-a,a) a = int(input()) b = int(input()) ma = 0 if a > b: ma = a else: ma = b; num = (int)((7-ma)/(gcd(7-ma,6))) den = (int)(6/(gcd(7-ma,6))) print(num,end = "") print("/",end = "") print(den)
Title: Die Roll Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place. But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams. Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania. It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win. Input Specification: The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls. Output Specification: Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1». Demo Input: ['4 2\n'] Demo Output: ['1/2\n'] Note: Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
```python def gcd(a,b): if a == b: return a else: ma = 0 if a > b: return gcd(a-b,b) else: return gcd(b-a,a) a = int(input()) b = int(input()) ma = 0 if a > b: ma = a else: ma = b; num = (int)((7-ma)/(gcd(7-ma,6))) den = (int)(6/(gcd(7-ma,6))) print(num,end = "") print("/",end = "") print(den) ```
-1
757
A
Gotta Catch Em' All!
PROGRAMMING
1,000
[ "implementation" ]
null
null
Bash wants to become a Pokemon master one day. Although he liked a lot of Pokemon, he has always been fascinated by Bulbasaur the most. Soon, things started getting serious and his fascination turned into an obsession. Since he is too young to go out and catch Bulbasaur, he came up with his own way of catching a Bulbasaur. Each day, he takes the front page of the newspaper. He cuts out the letters one at a time, from anywhere on the front page of the newspaper to form the word "Bulbasaur" (without quotes) and sticks it on his wall. Bash is very particular about case — the first letter of "Bulbasaur" must be upper case and the rest must be lower case. By doing this he thinks he has caught one Bulbasaur. He then repeats this step on the left over part of the newspaper. He keeps doing this until it is not possible to form the word "Bulbasaur" from the newspaper. Given the text on the front page of the newspaper, can you tell how many Bulbasaurs he will catch today? Note: uppercase and lowercase letters are considered different.
Input contains a single line containing a string *s* (1<=<=≤<=<=|*s*|<=<=≤<=<=105) — the text on the front page of the newspaper without spaces and punctuation marks. |*s*| is the length of the string *s*. The string *s* contains lowercase and uppercase English letters, i.e. .
Output a single integer, the answer to the problem.
[ "Bulbbasaur\n", "F\n", "aBddulbasaurrgndgbualdBdsagaurrgndbb\n" ]
[ "1\n", "0\n", "2\n" ]
In the first case, you could pick: Bulbbasaur. In the second case, there is no way to pick even a single Bulbasaur. In the third case, you can rearrange the string to BulbasaurBulbasauraddrgndgddgargndbb to get two words "Bulbasaur".
500
[ { "input": "Bulbbasaur", "output": "1" }, { "input": "F", "output": "0" }, { "input": "aBddulbasaurrgndgbualdBdsagaurrgndbb", "output": "2" }, { "input": "BBBBBBBBBBbbbbbbbbbbuuuuuuuuuullllllllllssssssssssaaaaaaaaaarrrrrrrrrr", "output": "5" }, { "input": "BBBBBBBBBBbbbbbbbbbbbbbbbbbbbbuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuussssssssssssssssssssaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "0" }, { "input": "BBBBBBBBBBssssssssssssssssssssaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaarrrrrrrrrr", "output": "0" }, { "input": "BBBBBBBBBBbbbbbbbbbbbbbbbbbbbbuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuullllllllllllllllllllssssssssssssssssssssaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaarrrrrrrrrrrrrrrrrrrr", "output": "10" }, { "input": "BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBbbbbbbbbbbbbbbbbbbbbuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuullllllllllllllllllllssssssssssssssssssssaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaarrrrrrrrrrrrrrrrrrrrrrrrrrrrrr", "output": "20" }, { "input": "CeSlSwec", "output": "0" }, { "input": "PnMrWPBGzVcmRcO", "output": "0" }, { "input": "hHPWBQeEmCuhdCnzrqYtuFtwxokGhdGkFtsFICVqYfJeUrSBtSxEbzMCblOgqOvjXURhSKivPcseqgiNuUgIboEYMvVeRBbpzCGCfVydDvZNFGSFidwUtNbmPSfSYdMNmHgchIsiVswzFsGQewlMVEzicOagpWMdCWrCdPmexfnM", "output": "0" }, { "input": "BBBBBBBBBBbbbbbbbbbbbbuuuuuuuuuuuullllllllllllssssssssssssaaaaaaaaaaaarrrrrrrrrrrrZBphUC", "output": "6" }, { "input": "bulsar", "output": "0" }, { "input": "Bblsar", "output": "0" }, { "input": "Bbusar", "output": "0" }, { "input": "Bbular", "output": "0" }, { "input": "Bbulsr", "output": "0" }, { "input": "Bbulsa", "output": "0" }, { "input": "Bbulsar", "output": "0" }, { "input": "Bbulsar", "output": "0" }, { "input": "CaQprCjTiQACZjUJjSmMHVTDorSUugvTtksEjptVzNLhClWaVVWszIixBlqFkvjDmbRjarQoUWhXHoCgYNNjvEgRTgKpbdEMFsmqcTyvJzupKgYiYMtrZWXIAGVhmDURtddbBZIMgIgXqQUmXpssLSaVCDGZDHimNthwiAWabjtcraAQugMCpBPQZbBGZyqUZmzDVSvJZmDWfZEUHGJVtiJANAIbvjTxtvvTbjWRpNQZlxAqpLCLRVwYWqLaHOTvzgeNGdxiBwsAVKKsewXMTwZUUfxYwrwsiaRBwEdvDDoPsQUtinvajBoRzLBUuQekhjsfDAOQzIABSVPitRuhvvqeAahsSELTGbCPh", "output": "2" }, { "input": "Bulbasaur", "output": "1" }, { "input": "BulbasaurBulbasaur", "output": "2" }, { "input": "Bulbbasar", "output": "0" }, { "input": "Bulbasur", "output": "0" }, { "input": "Bulbsaur", "output": "0" }, { "input": "BulbsurBulbsurBulbsurBulbsur", "output": "0" }, { "input": "Blbbasar", "output": "0" }, { "input": "Bulbasar", "output": "0" }, { "input": "BBullllbbaassaauurr", "output": "1" }, { "input": "BulbasaurBulbasar", "output": "1" }, { "input": "BulbasaurBulbsaur", "output": "1" }, { "input": "Bubasaur", "output": "0" }, { "input": "ulbasaurulbasaur", "output": "0" }, { "input": "Bulbasr", "output": "0" }, { "input": "BBBuuulllbbbaaasssaaauuurrr", "output": "3" }, { "input": "BBuuuullbbaaaassrr", "output": "2" }, { "input": "BBBBBBBuuuuuuuullllllllllllbbbbaaaaaassssssssssssssssaaaaauuuuuuuuuuuuurrrrrrrrrrrrrrrr", "output": "4" }, { "input": "BBuullbbaassaarr", "output": "1" }, { "input": "Bulbasau", "output": "0" }, { "input": "BBuullbbaassaauurr", "output": "2" }, { "input": "BulbasauBulbasauBulbasauBulbasauBulbasauBulbasauBulbasauBulbasau", "output": "0" }, { "input": "Blbasaur", "output": "0" }, { "input": "BulbasaurBulbasaurd", "output": "2" }, { "input": "ulbasaur", "output": "0" }, { "input": "Bulbaaur", "output": "0" }, { "input": "BBuuuullbbbbbbbbbbbbbbbaassrr", "output": "1" }, { "input": "Bulbasua", "output": "0" }, { "input": "Bubbasaur", "output": "0" }, { "input": "BulbasauBulbasauBulbasauBulbasauBulbasauBulbasaurrr", "output": "3" }, { "input": "BulbasaurBubasaur", "output": "1" }, { "input": "Baab", "output": "0" }, { "input": "BulbasaurBulbasau", "output": "1" }, { "input": "Bulbasauu", "output": "0" }, { "input": "BulbasauBulbasau", "output": "0" }, { "input": "BBBBBBBBBBB", "output": "0" }, { "input": "Bulbbasau", "output": "0" }, { "input": "BulbbasaurBulbbasar", "output": "1" }, { "input": "Bulaaaasaur", "output": "0" }, { "input": "BulbasaurBulbasauBulbasauBulbasau", "output": "1" } ]
1,599,035,935
2,147,483,647
PyPy 3
OK
TESTS
107
140
512,000
string = input() check = "Bulbasaur" res = 1000000000000000 for x in check: res = min(res,string.count(x)//check.count(x)) print(res)
Title: Gotta Catch Em' All! Time Limit: None seconds Memory Limit: None megabytes Problem Description: Bash wants to become a Pokemon master one day. Although he liked a lot of Pokemon, he has always been fascinated by Bulbasaur the most. Soon, things started getting serious and his fascination turned into an obsession. Since he is too young to go out and catch Bulbasaur, he came up with his own way of catching a Bulbasaur. Each day, he takes the front page of the newspaper. He cuts out the letters one at a time, from anywhere on the front page of the newspaper to form the word "Bulbasaur" (without quotes) and sticks it on his wall. Bash is very particular about case — the first letter of "Bulbasaur" must be upper case and the rest must be lower case. By doing this he thinks he has caught one Bulbasaur. He then repeats this step on the left over part of the newspaper. He keeps doing this until it is not possible to form the word "Bulbasaur" from the newspaper. Given the text on the front page of the newspaper, can you tell how many Bulbasaurs he will catch today? Note: uppercase and lowercase letters are considered different. Input Specification: Input contains a single line containing a string *s* (1<=<=≤<=<=|*s*|<=<=≤<=<=105) — the text on the front page of the newspaper without spaces and punctuation marks. |*s*| is the length of the string *s*. The string *s* contains lowercase and uppercase English letters, i.e. . Output Specification: Output a single integer, the answer to the problem. Demo Input: ['Bulbbasaur\n', 'F\n', 'aBddulbasaurrgndgbualdBdsagaurrgndbb\n'] Demo Output: ['1\n', '0\n', '2\n'] Note: In the first case, you could pick: Bulbbasaur. In the second case, there is no way to pick even a single Bulbasaur. In the third case, you can rearrange the string to BulbasaurBulbasauraddrgndgddgargndbb to get two words "Bulbasaur".
```python string = input() check = "Bulbasaur" res = 1000000000000000 for x in check: res = min(res,string.count(x)//check.count(x)) print(res) ```
3
45
A
Codecraft III
PROGRAMMING
900
[ "implementation" ]
A. Codecraft III
2
256
Today Vasya visited a widely known site and learned that the continuation of his favourite game Codecraft II will appear after exactly *k* months. He looked at the calendar and learned that at the moment is the month number *s*. Vasya immediately got interested in what month Codecraft III will appear. Help him understand that. All the twelve months in Vasya's calendar are named using their usual English names: January, February, March, April, May, June, July, August, September, October, November, December.
The first input line contains the name of the current month. It is guaranteed that it is a proper English name of one of twelve months. The first letter is uppercase, the rest are lowercase. The second line contains integer *k* (0<=≤<=*k*<=≤<=100) — the number of months left till the appearance of Codecraft III.
Print starting from an uppercase letter the name of the month in which the continuation of Codeforces II will appear. The printed name must be contained in the list January, February, March, April, May, June, July, August, September, October, November, December.
[ "November\n3\n", "May\n24\n" ]
[ "February\n", "May\n" ]
none
0
[ { "input": "November\n3", "output": "February" }, { "input": "May\n24", "output": "May" }, { "input": "April\n0", "output": "April" }, { "input": "September\n0", "output": "September" }, { "input": "August\n0", "output": "August" }, { "input": "June\n1", "output": "July" }, { "input": "July\n2", "output": "September" }, { "input": "September\n3", "output": "December" }, { "input": "July\n4", "output": "November" }, { "input": "August\n24", "output": "August" }, { "input": "May\n48", "output": "May" }, { "input": "November\n47", "output": "October" }, { "input": "December\n49", "output": "January" }, { "input": "June\n99", "output": "September" }, { "input": "March\n100", "output": "July" }, { "input": "December\n1", "output": "January" }, { "input": "January\n11", "output": "December" }, { "input": "December\n0", "output": "December" }, { "input": "January\n0", "output": "January" }, { "input": "July\n77", "output": "December" }, { "input": "February\n11", "output": "January" }, { "input": "February\n22", "output": "December" }, { "input": "July\n33", "output": "April" }, { "input": "May\n44", "output": "January" }, { "input": "June\n97", "output": "July" } ]
1,619,302,843
2,147,483,647
Python 3
OK
TESTS
25
124
0
mes = input() k = int(input()) #convertir nuestro mes a número def mes_a_numero(mes): #Joshua if mes=='January': numero=0 if mes=='February': numero=1 if mes=='March': numero=2 if mes=='April': numero=3 if mes =='May': numero=4 if mes =='June': numero=5 if mes =='July': numero=6 if mes =='August': numero=7 if mes =='September': numero=8 if mes =='October': numero=9 if mes =='November': numero=10 if mes =='December': numero=11 return numero mes = mes_a_numero(mes) respuesta = (mes+k)%12 #convertir nuestra respuesta a mes def numero_a_mes(numero): #Gabriel if numero==0: mes='January' if numero==1: mes='February' if numero==2: mes='March' if numero==3: mes='April' if numero==4: mes='May' if numero==5: mes='June' if numero==6: mes='July' if numero==7: mes='August' if numero==8: mes='September' if numero==9: mes='October' if numero==10: mes='November' if numero==11: mes='December' return mes print(numero_a_mes(respuesta))
Title: Codecraft III Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Today Vasya visited a widely known site and learned that the continuation of his favourite game Codecraft II will appear after exactly *k* months. He looked at the calendar and learned that at the moment is the month number *s*. Vasya immediately got interested in what month Codecraft III will appear. Help him understand that. All the twelve months in Vasya's calendar are named using their usual English names: January, February, March, April, May, June, July, August, September, October, November, December. Input Specification: The first input line contains the name of the current month. It is guaranteed that it is a proper English name of one of twelve months. The first letter is uppercase, the rest are lowercase. The second line contains integer *k* (0<=≤<=*k*<=≤<=100) — the number of months left till the appearance of Codecraft III. Output Specification: Print starting from an uppercase letter the name of the month in which the continuation of Codeforces II will appear. The printed name must be contained in the list January, February, March, April, May, June, July, August, September, October, November, December. Demo Input: ['November\n3\n', 'May\n24\n'] Demo Output: ['February\n', 'May\n'] Note: none
```python mes = input() k = int(input()) #convertir nuestro mes a número def mes_a_numero(mes): #Joshua if mes=='January': numero=0 if mes=='February': numero=1 if mes=='March': numero=2 if mes=='April': numero=3 if mes =='May': numero=4 if mes =='June': numero=5 if mes =='July': numero=6 if mes =='August': numero=7 if mes =='September': numero=8 if mes =='October': numero=9 if mes =='November': numero=10 if mes =='December': numero=11 return numero mes = mes_a_numero(mes) respuesta = (mes+k)%12 #convertir nuestra respuesta a mes def numero_a_mes(numero): #Gabriel if numero==0: mes='January' if numero==1: mes='February' if numero==2: mes='March' if numero==3: mes='April' if numero==4: mes='May' if numero==5: mes='June' if numero==6: mes='July' if numero==7: mes='August' if numero==8: mes='September' if numero==9: mes='October' if numero==10: mes='November' if numero==11: mes='December' return mes print(numero_a_mes(respuesta)) ```
3.969
420
A
Start Up
PROGRAMMING
1,000
[ "implementation" ]
null
null
Recently, a start up by two students of a state university of city F gained incredible popularity. Now it's time to start a new company. But what do we call it? The market analysts came up with a very smart plan: the name of the company should be identical to its reflection in a mirror! In other words, if we write out the name of the company on a piece of paper in a line (horizontally, from left to right) with large English letters, then put this piece of paper in front of the mirror, then the reflection of the name in the mirror should perfectly match the line written on the piece of paper. There are many suggestions for the company name, so coming up to the mirror with a piece of paper for each name wouldn't be sensible. The founders of the company decided to automatize this process. They asked you to write a program that can, given a word, determine whether the word is a 'mirror' word or not.
The first line contains a non-empty name that needs to be checked. The name contains at most 105 large English letters. The name will be written with the next sans serif font:
Print 'YES' (without the quotes), if the given name matches its mirror reflection. Otherwise, print 'NO' (without the quotes).
[ "AHA\n", "Z\n", "XO\n" ]
[ "YES\n", "NO\n", "NO\n" ]
none
500
[ { "input": "AHA", "output": "YES" }, { "input": "Z", "output": "NO" }, { "input": "XO", "output": "NO" }, { "input": "AAA", "output": "YES" }, { "input": "AHHA", "output": "YES" }, { "input": "BAB", "output": "NO" }, { "input": "OMMMAAMMMO", "output": "YES" }, { "input": "YYHUIUGYI", "output": "NO" }, { "input": "TT", "output": "YES" }, { "input": "UUU", "output": "YES" }, { "input": "WYYW", "output": "YES" }, { "input": "MITIM", "output": "YES" }, { "input": "VO", "output": "NO" }, { "input": "WWS", "output": "NO" }, { "input": "VIYMAXXAVM", "output": "NO" }, { "input": "OVWIHIWVYXMVAAAATOXWOIUUHYXHIHHVUIOOXWHOXTUUMUUVHVWWYUTIAUAITAOMHXWMTTOIVMIVOTHOVOIOHYHAOXWAUVWAVIVM", "output": "NO" }, { "input": "CC", "output": "NO" }, { "input": "QOQ", "output": "NO" }, { "input": "AEEA", "output": "NO" }, { "input": "OQQQO", "output": "NO" }, { "input": "HNCMEEMCNH", "output": "NO" }, { "input": "QDPINBMCRFWXPDBFGOZVVOCEMJRUCTOADEWEGTVBVBFWWRPGYEEYGPRWWFBVBVTGEWEDAOTCURJMECOVVZOGFBDPXWFRCMBNIPDQ", "output": "NO" }, { "input": "A", "output": "YES" }, { "input": "B", "output": "NO" }, { "input": "C", "output": "NO" }, { "input": "D", "output": "NO" }, { "input": "E", "output": "NO" }, { "input": "F", "output": "NO" }, { "input": "G", "output": "NO" }, { "input": "H", "output": "YES" }, { "input": "I", "output": "YES" }, { "input": "J", "output": "NO" }, { "input": "K", "output": "NO" }, { "input": "L", "output": "NO" }, { "input": "M", "output": "YES" }, { "input": "N", "output": "NO" }, { "input": "O", "output": "YES" }, { "input": "P", "output": "NO" }, { "input": "Q", "output": "NO" }, { "input": "R", "output": "NO" }, { "input": "S", "output": "NO" }, { "input": "T", "output": "YES" }, { "input": "U", "output": "YES" }, { "input": "V", "output": "YES" }, { "input": "W", "output": "YES" }, { "input": "X", "output": "YES" }, { "input": "Y", "output": "YES" }, { "input": "JL", "output": "NO" }, { "input": "AAAKTAAA", "output": "NO" }, { "input": "AKA", "output": "NO" }, { "input": "AAJAA", "output": "NO" }, { "input": "ABA", "output": "NO" }, { "input": "AAAAAABAAAAAA", "output": "NO" }, { "input": "ZZ", "output": "NO" }, { "input": "ADA", "output": "NO" }, { "input": "N", "output": "NO" }, { "input": "P", "output": "NO" }, { "input": "LAL", "output": "NO" }, { "input": "AABAA", "output": "NO" }, { "input": "AZA", "output": "NO" }, { "input": "V", "output": "YES" }, { "input": "SSS", "output": "NO" }, { "input": "NNN", "output": "NO" }, { "input": "S", "output": "NO" }, { "input": "I", "output": "YES" }, { "input": "SS", "output": "NO" }, { "input": "E", "output": "NO" } ]
1,663,602,632
2,147,483,647
Python 3
OK
TESTS
80
61
0
a=input().upper() Mirror="AHIMOTUVWXY" if a==a[::-1]: x="True" for i in a: if i in Mirror: pass else: x="FALSE"; break if x=="True": print("YES") else: print("NO") else: print("NO")
Title: Start Up Time Limit: None seconds Memory Limit: None megabytes Problem Description: Recently, a start up by two students of a state university of city F gained incredible popularity. Now it's time to start a new company. But what do we call it? The market analysts came up with a very smart plan: the name of the company should be identical to its reflection in a mirror! In other words, if we write out the name of the company on a piece of paper in a line (horizontally, from left to right) with large English letters, then put this piece of paper in front of the mirror, then the reflection of the name in the mirror should perfectly match the line written on the piece of paper. There are many suggestions for the company name, so coming up to the mirror with a piece of paper for each name wouldn't be sensible. The founders of the company decided to automatize this process. They asked you to write a program that can, given a word, determine whether the word is a 'mirror' word or not. Input Specification: The first line contains a non-empty name that needs to be checked. The name contains at most 105 large English letters. The name will be written with the next sans serif font: Output Specification: Print 'YES' (without the quotes), if the given name matches its mirror reflection. Otherwise, print 'NO' (without the quotes). Demo Input: ['AHA\n', 'Z\n', 'XO\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none
```python a=input().upper() Mirror="AHIMOTUVWXY" if a==a[::-1]: x="True" for i in a: if i in Mirror: pass else: x="FALSE"; break if x=="True": print("YES") else: print("NO") else: print("NO") ```
3
146
B
Lucky Mask
PROGRAMMING
1,300
[ "brute force", "implementation" ]
null
null
Petya loves lucky numbers very much. Everybody knows that lucky numbers are positive integers whose decimal record contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. Petya calls a mask of a positive integer *n* the number that is obtained after successive writing of all lucky digits of number *n* from the left to the right. For example, the mask of number 72174994 is number 7744, the mask of 7 is 7, the mask of 9999047 is 47. Obviously, mask of any number is always a lucky number. Petya has two numbers — an arbitrary integer *a* and a lucky number *b*. Help him find the minimum number *c* (*c*<=&gt;<=*a*) such that the mask of number *c* equals *b*.
The only line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=105). It is guaranteed that number *b* is lucky.
In the only line print a single number — the number *c* that is sought by Petya.
[ "1 7\n", "100 47\n" ]
[ "7\n", "147\n" ]
none
1,000
[ { "input": "1 7", "output": "7" }, { "input": "100 47", "output": "147" }, { "input": "458 47", "output": "467" }, { "input": "7 7", "output": "17" }, { "input": "547 47", "output": "647" }, { "input": "77 77", "output": "177" }, { "input": "44 4", "output": "45" }, { "input": "740 4", "output": "804" }, { "input": "100000 77777", "output": "177777" }, { "input": "77777 77777", "output": "177777" }, { "input": "47 74", "output": "74" }, { "input": "74 77", "output": "77" }, { "input": "77 74", "output": "174" }, { "input": "98545 7474", "output": "107474" }, { "input": "99997 4", "output": "100004" }, { "input": "100000 7", "output": "100007" }, { "input": "99997 47", "output": "100047" }, { "input": "47774 774", "output": "50774" }, { "input": "47744 7", "output": "50007" }, { "input": "45896 4", "output": "45898" }, { "input": "45679 77777", "output": "77777" }, { "input": "99979 77", "output": "100077" }, { "input": "10 77777", "output": "77777" }, { "input": "1 47774", "output": "47774" }, { "input": "47774 47774", "output": "147774" }, { "input": "47580 47774", "output": "47774" }, { "input": "55557 74", "output": "55574" }, { "input": "59765 4774", "output": "64774" }, { "input": "76492 447", "output": "80447" }, { "input": "69700 77477", "output": "77477" }, { "input": "31975 74", "output": "32074" }, { "input": "369 47", "output": "407" }, { "input": "39999 4", "output": "40000" }, { "input": "39999 4774", "output": "40774" }, { "input": "474 74", "output": "574" }, { "input": "40007 74444", "output": "74444" }, { "input": "40007 74", "output": "50074" }, { "input": "1 4", "output": "4" }, { "input": "4 4", "output": "14" }, { "input": "700 74", "output": "704" }, { "input": "476 47", "output": "478" }, { "input": "99999 77", "output": "100077" }, { "input": "46 7", "output": "57" } ]
1,590,255,978
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
0
278
0
a,b=[int(i) for i in input().split()] print(int(str(a)+str(b)))
Title: Lucky Mask Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petya loves lucky numbers very much. Everybody knows that lucky numbers are positive integers whose decimal record contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. Petya calls a mask of a positive integer *n* the number that is obtained after successive writing of all lucky digits of number *n* from the left to the right. For example, the mask of number 72174994 is number 7744, the mask of 7 is 7, the mask of 9999047 is 47. Obviously, mask of any number is always a lucky number. Petya has two numbers — an arbitrary integer *a* and a lucky number *b*. Help him find the minimum number *c* (*c*<=&gt;<=*a*) such that the mask of number *c* equals *b*. Input Specification: The only line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=105). It is guaranteed that number *b* is lucky. Output Specification: In the only line print a single number — the number *c* that is sought by Petya. Demo Input: ['1 7\n', '100 47\n'] Demo Output: ['7\n', '147\n'] Note: none
```python a,b=[int(i) for i in input().split()] print(int(str(a)+str(b))) ```
0
500
A
New Year Transportation
PROGRAMMING
1,000
[ "dfs and similar", "graphs", "implementation" ]
null
null
New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=×<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells. So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≤<=*i*<=≤<=*n*<=-<=1 the condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≤<=*i*<=≤<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* one can't leave the Line World using portals. Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system.
The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=3<=×<=104) and *t* (2<=≤<=*t*<=≤<=*n*) — the number of cells, and the index of the cell which I want to go to. The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≤<=*a**i*<=≤<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World.
If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO".
[ "8 4\n1 2 1 2 1 2 1\n", "8 5\n1 2 1 2 1 1 1\n" ]
[ "YES\n", "NO\n" ]
In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4. In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit.
500
[ { "input": "8 4\n1 2 1 2 1 2 1", "output": "YES" }, { "input": "8 5\n1 2 1 2 1 1 1", "output": "NO" }, { "input": "20 19\n13 16 7 6 12 1 5 7 8 6 5 7 5 5 3 3 2 2 1", "output": "YES" }, { "input": "50 49\n11 7 1 41 26 36 19 16 38 14 36 35 37 27 20 27 3 6 21 2 27 11 18 17 19 16 22 8 8 9 1 7 5 12 5 6 13 6 11 2 6 3 1 5 1 1 2 2 1", "output": "YES" }, { "input": "120 104\n41 15 95 85 34 11 25 42 65 39 77 80 74 17 66 73 21 14 36 63 63 79 45 24 65 7 63 80 51 21 2 19 78 28 71 2 15 23 17 68 62 18 54 39 43 70 3 46 34 23 41 65 32 10 13 18 10 3 16 48 54 18 57 28 3 24 44 50 15 2 20 22 45 44 3 29 2 27 11 2 12 25 25 31 1 2 32 4 11 30 13 16 26 21 1 13 21 8 15 5 18 13 5 15 3 8 13 6 5 1 9 7 1 2 4 1 1 2 1", "output": "NO" }, { "input": "10 3\n8 3 5 4 2 3 2 2 1", "output": "NO" }, { "input": "10 9\n8 3 5 4 2 3 2 2 1", "output": "YES" }, { "input": "3 2\n1 1", "output": "YES" }, { "input": "3 2\n2 1", "output": "NO" }, { "input": "4 2\n2 1 1", "output": "NO" }, { "input": "4 4\n2 2 1", "output": "YES" }, { "input": "8 8\n1 2 1 2 1 2 1", "output": "YES" }, { "input": "3 3\n1 1", "output": "YES" }, { "input": "8 8\n1 2 1 2 1 1 1", "output": "YES" }, { "input": "3 3\n2 1", "output": "YES" }, { "input": "4 4\n1 1 1", "output": "YES" }, { "input": "8 8\n1 1 1 1 1 1 1", "output": "YES" }, { "input": "5 5\n1 1 1 1", "output": "YES" } ]
1,674,094,361
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
23
62
1,945,600
# n, t = list(map(int, input().split())) # a = list(map(int, input().split())) # marked = [] # def dfs(l, x): # marked.append(x+1) # if x < l: # dfs(l, x + a[x]) # else: # return marked # dfs(len(a), 0) n, t = list(map(int, input().split())) a = list(map(int, input().split())) marked = [] yesno = "NO" def dfs(l, x, b): if b == x + 1: print("YES") else: if x < l: dfs(l, x + a[x], b) else: print("NO") dfs(len(a), 0 , t)
Title: New Year Transportation Time Limit: None seconds Memory Limit: None megabytes Problem Description: New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=×<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells. So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≤<=*i*<=≤<=*n*<=-<=1 the condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≤<=*i*<=≤<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* one can't leave the Line World using portals. Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system. Input Specification: The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=3<=×<=104) and *t* (2<=≤<=*t*<=≤<=*n*) — the number of cells, and the index of the cell which I want to go to. The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≤<=*a**i*<=≤<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World. Output Specification: If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO". Demo Input: ['8 4\n1 2 1 2 1 2 1\n', '8 5\n1 2 1 2 1 1 1\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4. In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit.
```python # n, t = list(map(int, input().split())) # a = list(map(int, input().split())) # marked = [] # def dfs(l, x): # marked.append(x+1) # if x < l: # dfs(l, x + a[x]) # else: # return marked # dfs(len(a), 0) n, t = list(map(int, input().split())) a = list(map(int, input().split())) marked = [] yesno = "NO" def dfs(l, x, b): if b == x + 1: print("YES") else: if x < l: dfs(l, x + a[x], b) else: print("NO") dfs(len(a), 0 , t) ```
-1
69
A
Young Physicist
PROGRAMMING
1,000
[ "implementation", "math" ]
A. Young Physicist
2
256
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
[ "3\n4 1 7\n-2 4 -1\n1 -5 -3\n", "3\n3 -1 7\n-5 2 -4\n2 -1 -3\n" ]
[ "NO", "YES" ]
none
500
[ { "input": "3\n4 1 7\n-2 4 -1\n1 -5 -3", "output": "NO" }, { "input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3", "output": "YES" }, { "input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41", "output": "NO" }, { "input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33", "output": "NO" }, { "input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7", "output": "NO" }, { "input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38", "output": "NO" }, { "input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6", "output": "YES" }, { "input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0", "output": "YES" }, { "input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0", "output": "YES" }, { "input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0", "output": "YES" }, { "input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0", "output": "YES" }, { "input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0", "output": "YES" }, { "input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87", "output": "YES" }, { "input": "3\n1 2 3\n3 2 1\n0 0 0", "output": "NO" }, { "input": "2\n5 -23 12\n0 0 0", "output": "NO" }, { "input": "1\n0 0 0", "output": "YES" }, { "input": "1\n1 -2 0", "output": "NO" }, { "input": "2\n-23 77 -86\n23 -77 86", "output": "YES" }, { "input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82", "output": "YES" }, { "input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0", "output": "YES" }, { "input": "3\n96 49 -12\n2 -66 28\n-98 17 -16", "output": "YES" }, { "input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0", "output": "YES" }, { "input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53", "output": "YES" }, { "input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1", "output": "YES" }, { "input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0", "output": "YES" }, { "input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0", "output": "YES" }, { "input": "3\n0 2 -2\n1 -1 3\n-3 0 0", "output": "NO" } ]
1,600,727,720
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
154
0
n = int(input()) for x in range(n): xi,yi,zi=list(map(int, input().split())) sum_xi= sum_xi + xi sum_yi= sum_yi + yi sum_zi= sum_zi + zi sum = sum_xi + sum_yi + sum_zi if (sum)==0: print('YES') else: print('NO')
Title: Young Physicist Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. Input Specification: The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). Output Specification: Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. Demo Input: ['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n'] Demo Output: ['NO', 'YES'] Note: none
```python n = int(input()) for x in range(n): xi,yi,zi=list(map(int, input().split())) sum_xi= sum_xi + xi sum_yi= sum_yi + yi sum_zi= sum_zi + zi sum = sum_xi + sum_yi + sum_zi if (sum)==0: print('YES') else: print('NO') ```
-1
234
A
Lefthanders and Righthanders
PROGRAMMING
1,200
[ "implementation" ]
null
null
One fine October day a mathematics teacher Vasily Petrov went to a class and saw there *n* pupils who sat at the desks, two people at each desk. Vasily quickly realized that number *n* is even. Like all true mathematicians, Vasily has all students numbered from 1 to *n*. But Vasily Petrov did not like the way the children were seated at the desks. According to him, the students whose numbers differ by 1, can not sit together, as they talk to each other all the time, distract others and misbehave. On the other hand, if a righthanded student sits at the left end of the desk and a lefthanded student sits at the right end of the desk, they hit elbows all the time and distract each other. In other cases, the students who sit at the same desk, do not interfere with each other. Vasily knows very well which students are lefthanders and which ones are righthanders, and he asks you to come up with any order that meets these two uncomplicated conditions (students do not talk to each other and do not bump their elbows). It is guaranteed that the input is such that at least one way to seat the students always exists.
The first input line contains a single even integer *n* (4<=≤<=*n*<=≤<=100) — the number of students in the class. The second line contains exactly *n* capital English letters "L" and "R". If the *i*-th letter at the second line equals "L", then the student number *i* is a lefthander, otherwise he is a righthander.
Print integer pairs, one pair per line. In the *i*-th line print the numbers of students that will sit at the *i*-th desk. The first number in the pair stands for the student who is sitting to the left, and the second number stands for the student who is sitting to the right. Separate the numbers in the pairs by spaces. If there are multiple solutions, print any of them.
[ "6\nLLRLLL\n", "4\nRRLL\n" ]
[ "1 4\n2 5\n6 3\n", "3 1\n4 2\n" ]
none
0
[ { "input": "6\nLLRLLL", "output": "1 4\n2 5\n6 3" }, { "input": "4\nRRLL", "output": "3 1\n4 2" }, { "input": "4\nLLRR", "output": "1 3\n2 4" }, { "input": "6\nRLLRRL", "output": "1 4\n2 5\n3 6" }, { "input": "8\nLRLRLLLR", "output": "1 5\n6 2\n3 7\n4 8" }, { "input": "10\nRLLRLRRRLL", "output": "1 6\n2 7\n3 8\n9 4\n5 10" }, { "input": "12\nLRRRRRLRRRRL", "output": "1 7\n2 8\n3 9\n4 10\n5 11\n12 6" }, { "input": "14\nRLLRLLLLRLLLRL", "output": "8 1\n2 9\n3 10\n11 4\n5 12\n6 13\n7 14" }, { "input": "16\nLLLRRRLRRLLRRLLL", "output": "1 9\n2 10\n3 11\n4 12\n5 13\n14 6\n7 15\n16 8" }, { "input": "18\nRRRLLLLRRRLRLRLLRL", "output": "1 10\n11 2\n3 12\n4 13\n5 14\n6 15\n7 16\n8 17\n18 9" }, { "input": "20\nRLRLLRLRRLLRRRRRRLRL", "output": "11 1\n2 12\n3 13\n4 14\n5 15\n6 16\n7 17\n18 8\n9 19\n10 20" }, { "input": "22\nRLLLRLLLRRLRRRLRLLLLLL", "output": "1 12\n2 13\n3 14\n4 15\n5 16\n6 17\n7 18\n8 19\n20 9\n21 10\n11 22" }, { "input": "24\nLRRRLRLLRLRRRRLLLLRRLRLR", "output": "1 13\n2 14\n15 3\n16 4\n5 17\n18 6\n7 19\n8 20\n21 9\n10 22\n23 11\n12 24" }, { "input": "26\nRLRRLLRRLLRLRRLLRLLRRLRLRR", "output": "1 14\n2 15\n16 3\n4 17\n5 18\n6 19\n7 20\n8 21\n9 22\n10 23\n24 11\n12 25\n13 26" }, { "input": "28\nLLLRRRRRLRRLRRRLRLRLRRLRLRRL", "output": "1 15\n2 16\n3 17\n18 4\n5 19\n20 6\n7 21\n8 22\n9 23\n10 24\n25 11\n12 26\n13 27\n28 14" }, { "input": "30\nLRLLRLRRLLRLRLLRRRRRLRLRLRLLLL", "output": "1 16\n2 17\n3 18\n4 19\n5 20\n6 21\n7 22\n23 8\n9 24\n10 25\n11 26\n12 27\n28 13\n14 29\n15 30" }, { "input": "32\nRLRLLRRLLRRLRLLRLRLRLLRLRRRLLRRR", "output": "17 1\n2 18\n19 3\n4 20\n5 21\n22 6\n7 23\n8 24\n9 25\n10 26\n11 27\n12 28\n29 13\n14 30\n15 31\n16 32" }, { "input": "34\nLRRLRLRLLRRRRLLRLRRLRRLRLRRLRRRLLR", "output": "1 18\n2 19\n20 3\n4 21\n5 22\n6 23\n7 24\n8 25\n9 26\n10 27\n28 11\n12 29\n13 30\n14 31\n15 32\n33 16\n17 34" }, { "input": "36\nRRLLLRRRLLLRRLLLRRLLRLLRLRLLRLRLRLLL", "output": "19 1\n20 2\n3 21\n4 22\n5 23\n6 24\n25 7\n8 26\n9 27\n10 28\n11 29\n30 12\n13 31\n14 32\n15 33\n16 34\n35 17\n36 18" }, { "input": "38\nLLRRRLLRRRLRRLRLRRLRRLRLRLLRRRRLLLLRLL", "output": "1 20\n2 21\n22 3\n4 23\n24 5\n6 25\n7 26\n27 8\n9 28\n10 29\n11 30\n12 31\n32 13\n14 33\n34 15\n16 35\n17 36\n37 18\n19 38" }, { "input": "40\nLRRRRRLRLLRRRLLRRLRLLRLRRLRRLLLRRLRRRLLL", "output": "1 21\n2 22\n23 3\n4 24\n5 25\n26 6\n7 27\n8 28\n9 29\n10 30\n31 11\n12 32\n13 33\n14 34\n15 35\n16 36\n17 37\n18 38\n39 19\n20 40" }, { "input": "42\nRLRRLLLLLLLRRRLRLLLRRRLRLLLRLRLRLLLRLRLRRR", "output": "1 22\n2 23\n3 24\n25 4\n5 26\n6 27\n7 28\n8 29\n9 30\n10 31\n11 32\n33 12\n34 13\n35 14\n15 36\n37 16\n17 38\n18 39\n19 40\n20 41\n21 42" }, { "input": "44\nLLLLRRLLRRLLRRLRLLRRRLRLRLLRLRLRRLLRLRRLLLRR", "output": "1 23\n2 24\n3 25\n4 26\n27 5\n6 28\n7 29\n8 30\n31 9\n10 32\n11 33\n12 34\n35 13\n14 36\n15 37\n16 38\n17 39\n18 40\n41 19\n42 20\n21 43\n22 44" }, { "input": "46\nRRRLLLLRRLRLRRRRRLRLLRLRRLRLLLLLLLLRRLRLRLRLLL", "output": "1 24\n2 25\n26 3\n4 27\n5 28\n6 29\n7 30\n31 8\n32 9\n10 33\n34 11\n12 35\n13 36\n14 37\n38 15\n16 39\n40 17\n18 41\n42 19\n20 43\n21 44\n45 22\n23 46" }, { "input": "48\nLLLLRRLRRRRLRRRLRLLLLLRRLLRLLRLLRRLRRLLRLRLRRRRL", "output": "1 25\n2 26\n3 27\n4 28\n29 5\n6 30\n7 31\n32 8\n9 33\n10 34\n35 11\n12 36\n13 37\n38 14\n39 15\n16 40\n41 17\n18 42\n19 43\n20 44\n21 45\n22 46\n23 47\n48 24" }, { "input": "50\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR", "output": "1 26\n2 27\n3 28\n4 29\n5 30\n6 31\n7 32\n8 33\n9 34\n10 35\n11 36\n12 37\n13 38\n14 39\n15 40\n16 41\n17 42\n18 43\n19 44\n20 45\n21 46\n22 47\n23 48\n24 49\n25 50" }, { "input": "52\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL", "output": "1 27\n2 28\n3 29\n4 30\n5 31\n6 32\n7 33\n8 34\n9 35\n10 36\n11 37\n12 38\n13 39\n14 40\n15 41\n16 42\n17 43\n18 44\n19 45\n20 46\n21 47\n22 48\n23 49\n24 50\n25 51\n26 52" }, { "input": "54\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR", "output": "1 28\n2 29\n3 30\n4 31\n5 32\n6 33\n7 34\n8 35\n9 36\n10 37\n11 38\n12 39\n13 40\n14 41\n15 42\n16 43\n17 44\n18 45\n19 46\n20 47\n21 48\n22 49\n23 50\n24 51\n25 52\n26 53\n27 54" }, { "input": "56\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL", "output": "1 29\n2 30\n3 31\n4 32\n5 33\n6 34\n7 35\n8 36\n9 37\n10 38\n11 39\n12 40\n13 41\n14 42\n15 43\n16 44\n17 45\n18 46\n19 47\n20 48\n21 49\n22 50\n23 51\n24 52\n25 53\n26 54\n27 55\n28 56" }, { "input": "58\nRRRLLLRLLLLRRLRRRLLRLLRLRLLRLRRRRLLLLLLRLRRLRLRRRLRLRRLRRL", "output": "1 30\n2 31\n3 32\n4 33\n5 34\n6 35\n36 7\n8 37\n9 38\n10 39\n11 40\n41 12\n13 42\n14 43\n44 15\n16 45\n46 17\n18 47\n19 48\n20 49\n21 50\n22 51\n52 23\n24 53\n25 54\n26 55\n27 56\n28 57\n29 58" }, { "input": "60\nRLLLLRRLLRRRLLLLRRRRRLRRRLRRRLLLRLLLRLRRRLRLLLRLLRRLLRRRRRLL", "output": "31 1\n2 32\n3 33\n4 34\n5 35\n36 6\n7 37\n8 38\n9 39\n10 40\n11 41\n42 12\n13 43\n14 44\n15 45\n16 46\n17 47\n48 18\n49 19\n20 50\n21 51\n22 52\n53 23\n24 54\n25 55\n26 56\n27 57\n28 58\n59 29\n30 60" }, { "input": "62\nLRRLRLRLLLLRRLLLLRRRLRLLLLRRRLLLLLLRRRLLLLRRLRRLRLLLLLLLLRRLRR", "output": "1 32\n33 2\n34 3\n4 35\n5 36\n6 37\n7 38\n8 39\n9 40\n10 41\n11 42\n12 43\n13 44\n14 45\n15 46\n16 47\n17 48\n18 49\n50 19\n51 20\n21 52\n53 22\n23 54\n24 55\n25 56\n26 57\n27 58\n28 59\n60 29\n30 61\n31 62" }, { "input": "64\nRLLLLRRRLRLLRRRRLRLLLRRRLLLRRRLLRLLRLRLRRRLLRRRRLRLRRRLLLLRRLLLL", "output": "1 33\n2 34\n3 35\n4 36\n5 37\n6 38\n39 7\n8 40\n9 41\n10 42\n11 43\n12 44\n13 45\n14 46\n15 47\n16 48\n17 49\n18 50\n19 51\n20 52\n21 53\n22 54\n55 23\n56 24\n25 57\n26 58\n27 59\n28 60\n61 29\n62 30\n31 63\n32 64" }, { "input": "66\nLLRRRLLRLRLLRRRRRRRLLLLRRLLLLLLRLLLRLLLLLLRRRLRRLLRRRRRLRLLRLLLLRR", "output": "1 34\n2 35\n3 36\n37 4\n38 5\n6 39\n7 40\n41 8\n9 42\n10 43\n11 44\n12 45\n46 13\n14 47\n15 48\n49 16\n50 17\n18 51\n19 52\n20 53\n21 54\n22 55\n23 56\n24 57\n58 25\n26 59\n27 60\n28 61\n29 62\n30 63\n31 64\n32 65\n33 66" }, { "input": "68\nRRLRLRLLRLRLRRRRRRLRRRLLLLRLLRLRLRLRRRRLRLRLLRRRRLRRLLRLRRLLRLRRLRRL", "output": "35 1\n2 36\n3 37\n4 38\n5 39\n40 6\n7 41\n8 42\n9 43\n10 44\n45 11\n12 46\n13 47\n14 48\n15 49\n50 16\n17 51\n18 52\n19 53\n54 20\n21 55\n56 22\n23 57\n24 58\n25 59\n26 60\n27 61\n28 62\n29 63\n30 64\n31 65\n32 66\n33 67\n68 34" }, { "input": "70\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR", "output": "1 36\n2 37\n3 38\n4 39\n5 40\n6 41\n7 42\n8 43\n9 44\n10 45\n11 46\n12 47\n13 48\n14 49\n15 50\n16 51\n17 52\n18 53\n19 54\n20 55\n21 56\n22 57\n23 58\n24 59\n25 60\n26 61\n27 62\n28 63\n29 64\n30 65\n31 66\n32 67\n33 68\n34 69\n35 70" }, { "input": "72\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR", "output": "1 37\n2 38\n3 39\n4 40\n5 41\n6 42\n7 43\n8 44\n9 45\n10 46\n11 47\n12 48\n13 49\n14 50\n15 51\n16 52\n17 53\n18 54\n19 55\n20 56\n21 57\n22 58\n23 59\n24 60\n25 61\n26 62\n27 63\n28 64\n29 65\n30 66\n31 67\n32 68\n33 69\n34 70\n35 71\n36 72" }, { "input": "74\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR", "output": "1 38\n2 39\n3 40\n4 41\n5 42\n6 43\n7 44\n8 45\n9 46\n10 47\n11 48\n12 49\n13 50\n14 51\n15 52\n16 53\n17 54\n18 55\n19 56\n20 57\n21 58\n22 59\n23 60\n24 61\n25 62\n26 63\n27 64\n28 65\n29 66\n30 67\n31 68\n32 69\n33 70\n34 71\n35 72\n36 73\n37 74" }, { "input": "76\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR", "output": "1 39\n2 40\n3 41\n4 42\n5 43\n6 44\n7 45\n8 46\n9 47\n10 48\n11 49\n12 50\n13 51\n14 52\n15 53\n16 54\n17 55\n18 56\n19 57\n20 58\n21 59\n22 60\n23 61\n24 62\n25 63\n26 64\n27 65\n28 66\n29 67\n30 68\n31 69\n32 70\n33 71\n34 72\n35 73\n36 74\n37 75\n38 76" }, { "input": "78\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR", "output": "1 40\n2 41\n3 42\n4 43\n5 44\n6 45\n7 46\n8 47\n9 48\n10 49\n11 50\n12 51\n13 52\n14 53\n15 54\n16 55\n17 56\n18 57\n19 58\n20 59\n21 60\n22 61\n23 62\n24 63\n25 64\n26 65\n27 66\n28 67\n29 68\n30 69\n31 70\n32 71\n33 72\n34 73\n35 74\n36 75\n37 76\n38 77\n39 78" }, { "input": "80\nLRLRRRRLRRRRLLLLRLLRLRLLRRLRLLLRRLLLLRLLLRLRLLRRRLRRRLRLRRRRRLRLLRLLRRLLLRLRRRLL", "output": "1 41\n2 42\n3 43\n4 44\n45 5\n46 6\n7 47\n8 48\n9 49\n50 10\n11 51\n12 52\n13 53\n14 54\n15 55\n16 56\n17 57\n18 58\n19 59\n20 60\n21 61\n62 22\n23 63\n24 64\n65 25\n26 66\n27 67\n68 28\n29 69\n30 70\n31 71\n72 32\n73 33\n34 74\n35 75\n36 76\n37 77\n38 78\n39 79\n40 80" }, { "input": "82\nRLRRLLRLRLRLLLRLLLRRLLRRLRRRRLLRLLLLRRRRRLLLRRRLLLLRLRRLRRRLRLLLLRRRLRLRLLLRLLLLLR", "output": "42 1\n2 43\n44 3\n4 45\n5 46\n6 47\n48 7\n8 49\n50 9\n10 51\n11 52\n12 53\n13 54\n14 55\n56 15\n16 57\n17 58\n18 59\n60 19\n20 61\n21 62\n22 63\n64 23\n65 24\n25 66\n26 67\n27 68\n69 28\n29 70\n30 71\n31 72\n73 32\n33 74\n34 75\n35 76\n36 77\n78 37\n79 38\n80 39\n81 40\n41 82" }, { "input": "84\nLRLRRRRRRLLLRLRLLLLLRRLRLRLRRRLLRLLLRLRLLLRRRLRLRRLRLRLLLLLLLLRRRRRRLLLRRLRLRLLLRLRR", "output": "1 43\n2 44\n3 45\n46 4\n5 47\n48 6\n7 49\n8 50\n51 9\n10 52\n11 53\n12 54\n55 13\n14 56\n57 15\n16 58\n17 59\n18 60\n19 61\n20 62\n21 63\n22 64\n23 65\n24 66\n25 67\n26 68\n27 69\n70 28\n71 29\n30 72\n31 73\n32 74\n33 75\n34 76\n35 77\n36 78\n79 37\n38 80\n39 81\n40 82\n41 83\n42 84" }, { "input": "86\nRRRLLLRLLRLLRLRLRLLLRLRLRRLLRLLLRLLLLLLRRRLRLLRLLLRRRLRLLLLRLLRLRRLLRLLLRRRLLRLRLLRLLR", "output": "1 44\n45 2\n46 3\n4 47\n5 48\n6 49\n50 7\n8 51\n9 52\n10 53\n11 54\n12 55\n56 13\n14 57\n58 15\n16 59\n17 60\n18 61\n19 62\n20 63\n64 21\n22 65\n23 66\n24 67\n68 25\n26 69\n27 70\n28 71\n72 29\n30 73\n31 74\n32 75\n76 33\n34 77\n35 78\n36 79\n37 80\n38 81\n39 82\n40 83\n84 41\n85 42\n43 86" }, { "input": "88\nLLRLRLRLLLLRRRRRRLRRLLLLLRRLRRLLLLLRLRLRLLLLLRLRLRRLRLRRLRLLRRLRLLLRLLLLRRLLRRLRLRLRRLRR", "output": "1 45\n2 46\n47 3\n4 48\n49 5\n6 50\n7 51\n8 52\n9 53\n10 54\n11 55\n12 56\n57 13\n14 58\n59 15\n60 16\n17 61\n18 62\n63 19\n20 64\n21 65\n22 66\n23 67\n24 68\n25 69\n70 26\n71 27\n28 72\n29 73\n30 74\n31 75\n32 76\n33 77\n34 78\n35 79\n36 80\n37 81\n38 82\n39 83\n40 84\n41 85\n42 86\n43 87\n44 88" }, { "input": "90\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL", "output": "1 46\n2 47\n3 48\n4 49\n5 50\n6 51\n7 52\n8 53\n9 54\n10 55\n11 56\n12 57\n13 58\n14 59\n15 60\n16 61\n17 62\n18 63\n19 64\n20 65\n21 66\n22 67\n23 68\n24 69\n25 70\n26 71\n27 72\n28 73\n29 74\n30 75\n31 76\n32 77\n33 78\n34 79\n35 80\n36 81\n37 82\n38 83\n39 84\n40 85\n41 86\n42 87\n43 88\n44 89\n45 90" }, { "input": "92\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL", "output": "1 47\n2 48\n3 49\n4 50\n5 51\n6 52\n7 53\n8 54\n9 55\n10 56\n11 57\n12 58\n13 59\n14 60\n15 61\n16 62\n17 63\n18 64\n19 65\n20 66\n21 67\n22 68\n23 69\n24 70\n25 71\n26 72\n27 73\n28 74\n29 75\n30 76\n31 77\n32 78\n33 79\n34 80\n35 81\n36 82\n37 83\n38 84\n39 85\n40 86\n41 87\n42 88\n43 89\n44 90\n45 91\n46 92" }, { "input": "94\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL", "output": "1 48\n2 49\n3 50\n4 51\n5 52\n6 53\n7 54\n8 55\n9 56\n10 57\n11 58\n12 59\n13 60\n14 61\n15 62\n16 63\n17 64\n18 65\n19 66\n20 67\n21 68\n22 69\n23 70\n24 71\n25 72\n26 73\n27 74\n28 75\n29 76\n30 77\n31 78\n32 79\n33 80\n34 81\n35 82\n36 83\n37 84\n38 85\n39 86\n40 87\n41 88\n42 89\n43 90\n44 91\n45 92\n46 93\n47 94" }, { "input": "96\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL", "output": "1 49\n2 50\n3 51\n4 52\n5 53\n6 54\n7 55\n8 56\n9 57\n10 58\n11 59\n12 60\n13 61\n14 62\n15 63\n16 64\n17 65\n18 66\n19 67\n20 68\n21 69\n22 70\n23 71\n24 72\n25 73\n26 74\n27 75\n28 76\n29 77\n30 78\n31 79\n32 80\n33 81\n34 82\n35 83\n36 84\n37 85\n38 86\n39 87\n40 88\n41 89\n42 90\n43 91\n44 92\n45 93\n46 94\n47 95\n48 96" }, { "input": "98\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL", "output": "1 50\n2 51\n3 52\n4 53\n5 54\n6 55\n7 56\n8 57\n9 58\n10 59\n11 60\n12 61\n13 62\n14 63\n15 64\n16 65\n17 66\n18 67\n19 68\n20 69\n21 70\n22 71\n23 72\n24 73\n25 74\n26 75\n27 76\n28 77\n29 78\n30 79\n31 80\n32 81\n33 82\n34 83\n35 84\n36 85\n37 86\n38 87\n39 88\n40 89\n41 90\n42 91\n43 92\n44 93\n45 94\n46 95\n47 96\n48 97\n49 98" }, { "input": "100\nRLRRRRLLLLRRRRLRRRRRRRRLRLRRLLRRRRRRRRLRRRRLLLLRRRRLRRLRLRRRLLRRLRRLLLRLRRLLLLLLRLRLRLRRLRLRLRRRLLLR", "output": "1 51\n2 52\n3 53\n4 54\n55 5\n6 56\n7 57\n8 58\n9 59\n10 60\n61 11\n62 12\n13 63\n14 64\n15 65\n16 66\n17 67\n68 18\n69 19\n70 20\n21 71\n72 22\n23 73\n24 74\n75 25\n26 76\n77 27\n78 28\n29 79\n30 80\n31 81\n82 32\n33 83\n84 34\n35 85\n86 36\n37 87\n38 88\n39 89\n40 90\n91 41\n42 92\n93 43\n44 94\n45 95\n46 96\n47 97\n98 48\n99 49\n50 100" }, { "input": "100\nLRLLLLRLLLLRRRRRLRRRRLRRLRRLRLLRRLRRRRLLRRRLLLRLLLRRRRLLRLRLRRLRLLRRLLRRLRRLRRRRRLRRLRLRLRLLLLLLLLRL", "output": "1 51\n2 52\n3 53\n4 54\n5 55\n6 56\n7 57\n8 58\n9 59\n10 60\n11 61\n12 62\n63 13\n14 64\n65 15\n66 16\n17 67\n18 68\n69 19\n70 20\n21 71\n22 72\n73 23\n24 74\n25 75\n76 26\n27 77\n28 78\n29 79\n30 80\n31 81\n82 32\n33 83\n34 84\n85 35\n36 86\n87 37\n38 88\n39 89\n40 90\n91 41\n92 42\n93 43\n44 94\n45 95\n46 96\n97 47\n48 98\n49 99\n50 100" }, { "input": "100\nLLLRRLLRLRLLLRLLLRLRLLRRRLRRLLLRLRLRRLLRLRRRLLLRRLLRLLRRLLRRRRRLRLRRLRLRRLRLRRLLRLRLLRLLLRLLRLLLLRLL", "output": "1 51\n2 52\n3 53\n54 4\n5 55\n6 56\n7 57\n58 8\n9 59\n10 60\n11 61\n12 62\n13 63\n64 14\n15 65\n16 66\n17 67\n18 68\n19 69\n20 70\n21 71\n22 72\n23 73\n74 24\n25 75\n26 76\n27 77\n28 78\n29 79\n30 80\n31 81\n82 32\n33 83\n84 34\n35 85\n36 86\n87 37\n38 88\n39 89\n40 90\n41 91\n92 42\n43 93\n94 44\n45 95\n46 96\n47 97\n48 98\n99 49\n50 100" }, { "input": "100\nRLLLLRRLLLLRRRRLLRLRRRLLLRLLRLLLLLRRLLLLLLRRLRRRRRLRLLRLRRRLLLRLRLRLLLRRRLLLLLRRRRRLRRLLLLRLLLRRLLLL", "output": "51 1\n2 52\n3 53\n4 54\n5 55\n56 6\n7 57\n8 58\n9 59\n10 60\n11 61\n62 12\n13 63\n64 14\n15 65\n16 66\n17 67\n68 18\n19 69\n70 20\n21 71\n22 72\n23 73\n24 74\n25 75\n76 26\n27 77\n28 78\n29 79\n30 80\n31 81\n32 82\n33 83\n34 84\n35 85\n36 86\n37 87\n38 88\n39 89\n40 90\n41 91\n42 92\n93 43\n94 44\n45 95\n46 96\n97 47\n98 48\n99 49\n100 50" }, { "input": "100\nRLRRLRLRRLRLLRLLRRRLRRLLLLLRLRLRRRRRRRLLRRRLLRLRLLLRRRLLRRRLLRLRLLLLRRLRLLRLLRLLLLRRLRLRRLRLLLLRLRRR", "output": "51 1\n2 52\n3 53\n4 54\n5 55\n56 6\n7 57\n8 58\n9 59\n10 60\n61 11\n12 62\n13 63\n14 64\n15 65\n16 66\n67 17\n68 18\n19 69\n20 70\n71 21\n22 72\n23 73\n24 74\n25 75\n26 76\n27 77\n28 78\n29 79\n80 30\n31 81\n82 32\n33 83\n34 84\n85 35\n36 86\n87 37\n38 88\n39 89\n40 90\n41 91\n92 42\n93 43\n44 94\n45 95\n46 96\n47 97\n48 98\n49 99\n50 100" }, { "input": "100\nLRRLRLRRRRRRLRRLRRLLLLLLRRLLRRLLRLLLLLLRRRLLRLRRRLLRLLRRLRRRLLRLRLLRRLRRRLLLRRRRLLRRRLLLRRRRRLLLLLLR", "output": "1 51\n2 52\n53 3\n4 54\n5 55\n6 56\n57 7\n8 58\n9 59\n10 60\n61 11\n62 12\n13 63\n64 14\n15 65\n16 66\n67 17\n18 68\n19 69\n20 70\n21 71\n22 72\n23 73\n24 74\n75 25\n76 26\n27 77\n28 78\n29 79\n30 80\n31 81\n32 82\n33 83\n34 84\n35 85\n36 86\n37 87\n38 88\n39 89\n40 90\n41 91\n42 92\n43 93\n44 94\n95 45\n46 96\n97 47\n98 48\n99 49\n50 100" }, { "input": "100\nRRLRRLRLRLRRRRLLRRLLRLRRLLRRRLLRLRRLRLRRLLLRRLLRRRRRRLLLRRRLLRRLLLLLLRLLLLLLRLLLRRRLRLLRRRRRLLRLLRRR", "output": "1 51\n2 52\n3 53\n54 4\n55 5\n6 56\n7 57\n8 58\n9 59\n10 60\n61 11\n12 62\n13 63\n64 14\n15 65\n16 66\n67 17\n68 18\n19 69\n20 70\n71 21\n22 72\n73 23\n74 24\n25 75\n26 76\n27 77\n78 28\n79 29\n30 80\n31 81\n32 82\n33 83\n84 34\n35 85\n36 86\n87 37\n38 88\n39 89\n40 90\n41 91\n42 92\n43 93\n94 44\n45 95\n46 96\n47 97\n48 98\n49 99\n50 100" }, { "input": "100\nRRLLLRLRRLRLLRRLRRRLLRRRLRRLLLLLLLLLRRRLLRLRRLRRLRRLRRLRLLLLRLLRRRLLLLRLRRRLLRRRRLRRLLRRRRLRRRLRLLLR", "output": "1 51\n52 2\n3 53\n4 54\n5 55\n6 56\n7 57\n58 8\n59 9\n10 60\n11 61\n12 62\n13 63\n14 64\n15 65\n16 66\n67 17\n68 18\n69 19\n20 70\n21 71\n72 22\n23 73\n24 74\n25 75\n76 26\n77 27\n28 78\n29 79\n30 80\n31 81\n32 82\n33 83\n34 84\n35 85\n36 86\n37 87\n38 88\n39 89\n40 90\n41 91\n42 92\n43 93\n44 94\n95 45\n46 96\n97 47\n98 48\n49 99\n50 100" }, { "input": "100\nLLLLLRRLRRRRRRRLLRRRRRLRRLRLRLLRLRRLLLRRRRLLRRLRLLRLLLRLRLLRRRRRRRRRLRLLLRLRLLLLLRLRRRRLRLLRLRLRLRRL", "output": "1 51\n2 52\n3 53\n4 54\n5 55\n56 6\n7 57\n8 58\n59 9\n10 60\n11 61\n12 62\n13 63\n14 64\n15 65\n16 66\n17 67\n18 68\n69 19\n20 70\n71 21\n72 22\n23 73\n24 74\n75 25\n26 76\n77 27\n28 78\n79 29\n30 80\n31 81\n32 82\n33 83\n34 84\n35 85\n36 86\n37 87\n38 88\n39 89\n90 40\n91 41\n42 92\n43 93\n44 94\n95 45\n46 96\n47 97\n48 98\n49 99\n50 100" }, { "input": "100\nLLRRRLLLRLLLLRLRLRLRRRLLLRRRLRLLRLLLRRRRRLRRLRRLRRRLRRLRRLLLRLRLLRRRRLRLRRRRRLRRLRLLRRRRLLLRRRRRLLLL", "output": "1 51\n2 52\n3 53\n4 54\n55 5\n6 56\n7 57\n8 58\n59 9\n10 60\n11 61\n12 62\n13 63\n64 14\n15 65\n16 66\n17 67\n18 68\n19 69\n70 20\n21 71\n72 22\n23 73\n24 74\n25 75\n26 76\n27 77\n78 28\n29 79\n30 80\n31 81\n32 82\n83 33\n34 84\n35 85\n36 86\n37 87\n38 88\n89 39\n90 40\n91 41\n42 92\n43 93\n44 94\n45 95\n46 96\n97 47\n48 98\n99 49\n100 50" } ]
1,663,502,281
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
4
46
0
if __name__ == "__main__": # n = int(input()) # students = list(input()) f = open("input.txt", "r") n = int(f.readline()) students = list(f.readline()) f = open("output.txt", "w") for i in range(int(n/2)): if i + 2 > int(n / 2) and i + 2 <= n: a = students[i] b = students[i + 2] arr = [[i + 1, a], [i + 3 + int((n/2) % 2), b]] arr.sort(key=lambda x: x[1]) # print(arr[0][0], arr[1][0]) print(arr[0][0], arr[1][0], file=f) else: a = students[i] b = students[i + 2] arr = [[i + 1, a], [i + 3 + int((n/2) % 2), b]] arr.sort(key=lambda x: x[1]) # print(arr[0][0], arr[1][0]) print(arr[0][0], arr[1][0], file=f)
Title: Lefthanders and Righthanders Time Limit: None seconds Memory Limit: None megabytes Problem Description: One fine October day a mathematics teacher Vasily Petrov went to a class and saw there *n* pupils who sat at the desks, two people at each desk. Vasily quickly realized that number *n* is even. Like all true mathematicians, Vasily has all students numbered from 1 to *n*. But Vasily Petrov did not like the way the children were seated at the desks. According to him, the students whose numbers differ by 1, can not sit together, as they talk to each other all the time, distract others and misbehave. On the other hand, if a righthanded student sits at the left end of the desk and a lefthanded student sits at the right end of the desk, they hit elbows all the time and distract each other. In other cases, the students who sit at the same desk, do not interfere with each other. Vasily knows very well which students are lefthanders and which ones are righthanders, and he asks you to come up with any order that meets these two uncomplicated conditions (students do not talk to each other and do not bump their elbows). It is guaranteed that the input is such that at least one way to seat the students always exists. Input Specification: The first input line contains a single even integer *n* (4<=≤<=*n*<=≤<=100) — the number of students in the class. The second line contains exactly *n* capital English letters "L" and "R". If the *i*-th letter at the second line equals "L", then the student number *i* is a lefthander, otherwise he is a righthander. Output Specification: Print integer pairs, one pair per line. In the *i*-th line print the numbers of students that will sit at the *i*-th desk. The first number in the pair stands for the student who is sitting to the left, and the second number stands for the student who is sitting to the right. Separate the numbers in the pairs by spaces. If there are multiple solutions, print any of them. Demo Input: ['6\nLLRLLL\n', '4\nRRLL\n'] Demo Output: ['1 4\n2 5\n6 3\n', '3 1\n4 2\n'] Note: none
```python if __name__ == "__main__": # n = int(input()) # students = list(input()) f = open("input.txt", "r") n = int(f.readline()) students = list(f.readline()) f = open("output.txt", "w") for i in range(int(n/2)): if i + 2 > int(n / 2) and i + 2 <= n: a = students[i] b = students[i + 2] arr = [[i + 1, a], [i + 3 + int((n/2) % 2), b]] arr.sort(key=lambda x: x[1]) # print(arr[0][0], arr[1][0]) print(arr[0][0], arr[1][0], file=f) else: a = students[i] b = students[i + 2] arr = [[i + 1, a], [i + 3 + int((n/2) % 2), b]] arr.sort(key=lambda x: x[1]) # print(arr[0][0], arr[1][0]) print(arr[0][0], arr[1][0], file=f) ```
0
519
C
A and B and Team Training
PROGRAMMING
1,300
[ "greedy", "implementation", "math", "number theory" ]
null
null
A and B are preparing themselves for programming contests. An important part of preparing for a competition is sharing programming knowledge from the experienced members to those who are just beginning to deal with the contests. Therefore, during the next team training A decided to make teams so that newbies are solving problems together with experienced participants. A believes that the optimal team of three people should consist of one experienced participant and two newbies. Thus, each experienced participant can share the experience with a large number of people. However, B believes that the optimal team should have two experienced members plus one newbie. Thus, each newbie can gain more knowledge and experience. As a result, A and B have decided that all the teams during the training session should belong to one of the two types described above. Furthermore, they agree that the total number of teams should be as much as possible. There are *n* experienced members and *m* newbies on the training session. Can you calculate what maximum number of teams can be formed?
The first line contains two integers *n* and *m* (0<=≤<=*n*,<=*m*<=≤<=5·105) — the number of experienced participants and newbies that are present at the training session.
Print the maximum number of teams that can be formed.
[ "2 6\n", "4 5\n" ]
[ "2\n", "3\n" ]
Let's represent the experienced players as XP and newbies as NB. In the first test the teams look as follows: (XP, NB, NB), (XP, NB, NB). In the second test sample the teams look as follows: (XP, NB, NB), (XP, NB, NB), (XP, XP, NB).
1,500
[ { "input": "2 6", "output": "2" }, { "input": "4 5", "output": "3" }, { "input": "1 1", "output": "0" }, { "input": "3 3", "output": "2" }, { "input": "500000 500000", "output": "333333" }, { "input": "70 100", "output": "56" }, { "input": "5 12525", "output": "5" }, { "input": "10 5", "output": "5" }, { "input": "5 10", "output": "5" }, { "input": "0 0", "output": "0" }, { "input": "0 1", "output": "0" }, { "input": "1 0", "output": "0" }, { "input": "0 21233", "output": "0" }, { "input": "12523 0", "output": "0" }, { "input": "1231 1253", "output": "828" }, { "input": "500000 0", "output": "0" }, { "input": "1 500000", "output": "1" }, { "input": "250000 500000", "output": "250000" }, { "input": "500000 250000", "output": "250000" }, { "input": "33333 77777", "output": "33333" }, { "input": "30900 174529", "output": "30900" }, { "input": "89979 57154", "output": "49044" }, { "input": "231646 398487", "output": "210044" }, { "input": "332019 281112", "output": "204377" }, { "input": "473686 122443", "output": "122443" }, { "input": "481245 86879", "output": "86879" }, { "input": "39935 123534", "output": "39935" }, { "input": "10000 20000", "output": "10000" }, { "input": "10000 20001", "output": "10000" }, { "input": "10000 20002", "output": "10000" }, { "input": "10000 20003", "output": "10000" }, { "input": "10000 20004", "output": "10000" }, { "input": "10001 20000", "output": "10000" }, { "input": "10001 20001", "output": "10000" }, { "input": "10001 20002", "output": "10001" }, { "input": "10001 20003", "output": "10001" }, { "input": "10001 20004", "output": "10001" }, { "input": "20000 10000", "output": "10000" }, { "input": "20001 10000", "output": "10000" }, { "input": "20002 10000", "output": "10000" }, { "input": "20003 10000", "output": "10000" }, { "input": "20004 10000", "output": "10000" }, { "input": "20000 10001", "output": "10000" }, { "input": "20001 10001", "output": "10000" }, { "input": "20002 10001", "output": "10001" }, { "input": "20003 10001", "output": "10001" }, { "input": "20004 10001", "output": "10001" }, { "input": "10 0", "output": "0" }, { "input": "0 6", "output": "0" }, { "input": "2 3", "output": "1" }, { "input": "1 2", "output": "1" }, { "input": "0 0", "output": "0" } ]
1,631,083,304
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
4
108
1,228,800
n, m = map(int, input().split()) a = min(n, m) b = max(n, m) i = 0 c = 0 ans=0 while (c < b and i<a): i += 1 c += 2 ans+=1 if c>b: c-=2 i-=1 ans-=1 if b-c>=1 and a-i>=2: ans+=1 print(ans)
Title: A and B and Team Training Time Limit: None seconds Memory Limit: None megabytes Problem Description: A and B are preparing themselves for programming contests. An important part of preparing for a competition is sharing programming knowledge from the experienced members to those who are just beginning to deal with the contests. Therefore, during the next team training A decided to make teams so that newbies are solving problems together with experienced participants. A believes that the optimal team of three people should consist of one experienced participant and two newbies. Thus, each experienced participant can share the experience with a large number of people. However, B believes that the optimal team should have two experienced members plus one newbie. Thus, each newbie can gain more knowledge and experience. As a result, A and B have decided that all the teams during the training session should belong to one of the two types described above. Furthermore, they agree that the total number of teams should be as much as possible. There are *n* experienced members and *m* newbies on the training session. Can you calculate what maximum number of teams can be formed? Input Specification: The first line contains two integers *n* and *m* (0<=≤<=*n*,<=*m*<=≤<=5·105) — the number of experienced participants and newbies that are present at the training session. Output Specification: Print the maximum number of teams that can be formed. Demo Input: ['2 6\n', '4 5\n'] Demo Output: ['2\n', '3\n'] Note: Let's represent the experienced players as XP and newbies as NB. In the first test the teams look as follows: (XP, NB, NB), (XP, NB, NB). In the second test sample the teams look as follows: (XP, NB, NB), (XP, NB, NB), (XP, XP, NB).
```python n, m = map(int, input().split()) a = min(n, m) b = max(n, m) i = 0 c = 0 ans=0 while (c < b and i<a): i += 1 c += 2 ans+=1 if c>b: c-=2 i-=1 ans-=1 if b-c>=1 and a-i>=2: ans+=1 print(ans) ```
0
626
B
Cards
PROGRAMMING
1,300
[ "constructive algorithms", "dp", "math" ]
null
null
Catherine has a deck of *n* cards, each of which is either red, green, or blue. As long as there are at least two cards left, she can do one of two actions: - take any two (not necessarily adjacent) cards with different colors and exchange them for a new card of the third color; - take any two (not necessarily adjacent) cards with the same color and exchange them for a new card with that color. She repeats this process until there is only one card left. What are the possible colors for the final card?
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200) — the total number of cards. The next line contains a string *s* of length *n* — the colors of the cards. *s* contains only the characters 'B', 'G', and 'R', representing blue, green, and red, respectively.
Print a single string of up to three characters — the possible colors of the final card (using the same symbols as the input) in alphabetical order.
[ "2\nRB\n", "3\nGRG\n", "5\nBBBBB\n" ]
[ "G\n", "BR\n", "B\n" ]
In the first sample, Catherine has one red card and one blue card, which she must exchange for a green card. In the second sample, Catherine has two green cards and one red card. She has two options: she can exchange the two green cards for a green card, then exchange the new green card and the red card for a blue card. Alternatively, she can exchange a green and a red card for a blue card, then exchange the blue card and remaining green card for a red card. In the third sample, Catherine only has blue cards, so she can only exchange them for more blue cards.
750
[ { "input": "2\nRB", "output": "G" }, { "input": "3\nGRG", "output": "BR" }, { "input": "5\nBBBBB", "output": "B" }, { "input": "1\nR", "output": "R" }, { "input": "200\nBBRGRRBBRGGGBGBGBGRRGRGRGRBGRGRRBBGRGBGRRGRRRGGBBRGBGBGBRBBBBBBBGGBRGGRRRGGRGBGBGGBRRRRBRRRBRBBGGBGBRGRGBBBBGGBGBBBGBGRRBRRRGBGGBBBRBGRBRRGGGRRGBBBGBGRRRRRRGGRGRGBBBRGGGBGGGBRBBRRGBGRGRBRRRBRBGRGGBRBB", "output": "BGR" }, { "input": "101\nRRRRRRRRRRRRRRRRRRRBRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR", "output": "BG" }, { "input": "7\nBBBGBRG", "output": "BGR" }, { "input": "5\nGRRGR", "output": "BGR" }, { "input": "3\nGBR", "output": "BGR" }, { "input": "1\nB", "output": "B" }, { "input": "2\nBB", "output": "B" }, { "input": "1\nG", "output": "G" }, { "input": "2\nBG", "output": "R" }, { "input": "3\nBGB", "output": "GR" }, { "input": "2\nGG", "output": "G" }, { "input": "3\nGBG", "output": "BR" }, { "input": "4\nBGBG", "output": "BGR" }, { "input": "1\nR", "output": "R" }, { "input": "2\nBR", "output": "G" }, { "input": "3\nBRB", "output": "GR" }, { "input": "2\nRG", "output": "B" }, { "input": "3\nBGR", "output": "BGR" }, { "input": "4\nRBGB", "output": "BGR" }, { "input": "3\nGGR", "output": "BR" }, { "input": "4\nGGRB", "output": "BGR" }, { "input": "5\nBGBGR", "output": "BGR" }, { "input": "2\nRR", "output": "R" }, { "input": "3\nRBR", "output": "BG" }, { "input": "4\nRRBB", "output": "BGR" }, { "input": "3\nRRG", "output": "BG" }, { "input": "4\nBRRG", "output": "BGR" }, { "input": "5\nRBRBG", "output": "BGR" }, { "input": "4\nRGGR", "output": "BGR" }, { "input": "5\nBRGRG", "output": "BGR" }, { "input": "6\nGRRGBB", "output": "BGR" }, { "input": "150\nGRGBBBBRBGGBGBBGBBBBGRBBRRBBGRRGGGBRBBRGRRRRGBGRRBGBGBGRBBBGBBBGBGBRGBRRRRRGGGRGRBBGBRGGGRBBRGBBGRGGGBBRBRRGRGRRGRRGRRRGBGBRRGGRGGBRBGGGBBBRGRGBRGRRRR", "output": "BGR" }, { "input": "16\nRRGRRRRRRGGRGRRR", "output": "BGR" }, { "input": "190\nBBBBBBBBBBBBBBBBBGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "GR" }, { "input": "200\nRGRGRRRRRGRRGRRRGRGRRRGGRGRRGGGRRGGRRRRRRRRRRRGRRGRRRGRRRGRRRRRRRGRRRRRRRRRRRGGRRGGRRRRGGRRRRRRRRRGGGRGRGRGRRGRGGRGRGRRRGRRRRRRGGRGRRRRGRRGRGGRRRRRRRGRGGRRGRRRRRRRGGRRRRGRRRRRRRGRRRGGRRRRRRGRRGGGRRRGR", "output": "BGR" }, { "input": "200\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG", "output": "G" }, { "input": "52\nBBBBBBBBBBBBBBBBBBBBGBGBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "BGR" }, { "input": "200\nGRGRRGRBRRRGGGRGGRRRRRBBGRRGRBBGRRGBGRRBBRBBRRBBBGRBRGGGGBGGBRRBBRGRBGGRRGGBBRBGGRGBBRRBBRGBRRBGBRBGBBRGGRRRGGGBRGGGGRRRBBRRGRGRBRRGRBBGGRBBRGRGRBGRBBRGGBBBGRGBBGGBGBGBBRRBGRGRGGBRRGRGGGGGBRGGGGBBBBRB", "output": "BGR" }, { "input": "102\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGBGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG", "output": "BGR" }, { "input": "193\nRRRGGGRBGGBGGGBGGBBGRBGGRBGGBBRBGGRBBBRBRRGGBBRBRGRRRBGBBRGGRGGGBGGRRGGRGRRBRBRBRRGRGBGBRGBBRGRRRBGRGGBGBRBBBGBRBBGBGBGGGBGGGGBRBBRRBGRGGBBBRBBBBBGRRRGBRGBRRRBBBGBGGGGRGGRRBRBGRRGBGBRBGGGRBRRGG", "output": "BGR" }, { "input": "90\nBGBGGRRBGGRRRRRGGRGBBBBBRRBGBGBGBGGBBGRGGGGRBRBBRRRGBRRGBBGBBGGGRGRGRBGBBBRRGRRBRBRRGGRBRB", "output": "BGR" }, { "input": "3\nGGB", "output": "BR" } ]
1,561,397,466
2,147,483,647
Python 3
OK
TESTS
46
109
307,200
# In this template you are not required to write code in main import sys inf = float("inf") #from collections import deque, Counter, OrderedDict,defaultdict #from heapq import nsmallest, nlargest, heapify,heappop ,heappush, heapreplace #from math import ceil,floor,log,sqrt,factorial,pow,pi,gcd #from bisect import bisect_left,bisect_right abc='abcdefghijklmnopqrstuvwxyz' abd={'a': 0, 'b': 1, 'c': 2, 'd': 3, 'e': 4, 'f': 5, 'g': 6, 'h': 7, 'i': 8, 'j': 9, 'k': 10, 'l': 11, 'm': 12, 'n': 13, 'o': 14, 'p': 15, 'q': 16, 'r': 17, 's': 18, 't': 19, 'u': 20, 'v': 21, 'w': 22, 'x': 23, 'y': 24, 'z': 25} mod,MOD=1000000007,998244353 vow=['a','e','i','o','u'] dx,dy=[-1,1,0,0],[0,0,1,-1] def get_array(): return list(map(int, sys.stdin.readline().strip().split())) def get_ints(): return map(int, sys.stdin.readline().strip().split()) def input(): return sys.stdin.readline().strip() n=int(input()) string=input() mydict=dict() for i in string: mydict[i]=mydict.get(i,0)+1 # print(mydict) if len(mydict)==3: print("BGR") elif len(mydict)==1: print(string[0]) elif len(mydict)==2: mylist=[] for i in string: mylist.append(i) mylist.sort() first=mylist[0] second=mylist[-1] little='BGR' if mydict[first]==1 and mydict[second]==1: # print(first,second) for i in little: if i!=first and i!=second: print(i) exit() elif(mydict[first]==1 and mydict[second]>1): ans='' for i in little: if i!=second: ans+=i print(ans) elif (mydict[first]>1 and mydict[second]==1): ans='' for i in little: if i!=first: ans+=i print(ans) elif (mydict[first]>1 and mydict[second]>1): print(little)
Title: Cards Time Limit: None seconds Memory Limit: None megabytes Problem Description: Catherine has a deck of *n* cards, each of which is either red, green, or blue. As long as there are at least two cards left, she can do one of two actions: - take any two (not necessarily adjacent) cards with different colors and exchange them for a new card of the third color; - take any two (not necessarily adjacent) cards with the same color and exchange them for a new card with that color. She repeats this process until there is only one card left. What are the possible colors for the final card? Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200) — the total number of cards. The next line contains a string *s* of length *n* — the colors of the cards. *s* contains only the characters 'B', 'G', and 'R', representing blue, green, and red, respectively. Output Specification: Print a single string of up to three characters — the possible colors of the final card (using the same symbols as the input) in alphabetical order. Demo Input: ['2\nRB\n', '3\nGRG\n', '5\nBBBBB\n'] Demo Output: ['G\n', 'BR\n', 'B\n'] Note: In the first sample, Catherine has one red card and one blue card, which she must exchange for a green card. In the second sample, Catherine has two green cards and one red card. She has two options: she can exchange the two green cards for a green card, then exchange the new green card and the red card for a blue card. Alternatively, she can exchange a green and a red card for a blue card, then exchange the blue card and remaining green card for a red card. In the third sample, Catherine only has blue cards, so she can only exchange them for more blue cards.
```python # In this template you are not required to write code in main import sys inf = float("inf") #from collections import deque, Counter, OrderedDict,defaultdict #from heapq import nsmallest, nlargest, heapify,heappop ,heappush, heapreplace #from math import ceil,floor,log,sqrt,factorial,pow,pi,gcd #from bisect import bisect_left,bisect_right abc='abcdefghijklmnopqrstuvwxyz' abd={'a': 0, 'b': 1, 'c': 2, 'd': 3, 'e': 4, 'f': 5, 'g': 6, 'h': 7, 'i': 8, 'j': 9, 'k': 10, 'l': 11, 'm': 12, 'n': 13, 'o': 14, 'p': 15, 'q': 16, 'r': 17, 's': 18, 't': 19, 'u': 20, 'v': 21, 'w': 22, 'x': 23, 'y': 24, 'z': 25} mod,MOD=1000000007,998244353 vow=['a','e','i','o','u'] dx,dy=[-1,1,0,0],[0,0,1,-1] def get_array(): return list(map(int, sys.stdin.readline().strip().split())) def get_ints(): return map(int, sys.stdin.readline().strip().split()) def input(): return sys.stdin.readline().strip() n=int(input()) string=input() mydict=dict() for i in string: mydict[i]=mydict.get(i,0)+1 # print(mydict) if len(mydict)==3: print("BGR") elif len(mydict)==1: print(string[0]) elif len(mydict)==2: mylist=[] for i in string: mylist.append(i) mylist.sort() first=mylist[0] second=mylist[-1] little='BGR' if mydict[first]==1 and mydict[second]==1: # print(first,second) for i in little: if i!=first and i!=second: print(i) exit() elif(mydict[first]==1 and mydict[second]>1): ans='' for i in little: if i!=second: ans+=i print(ans) elif (mydict[first]>1 and mydict[second]==1): ans='' for i in little: if i!=first: ans+=i print(ans) elif (mydict[first]>1 and mydict[second]>1): print(little) ```
3
673
B
Problems for Round
PROGRAMMING
1,300
[ "greedy", "implementation" ]
null
null
There are *n* problems prepared for the next Codeforces round. They are arranged in ascending order by their difficulty, and no two problems have the same difficulty. Moreover, there are *m* pairs of similar problems. Authors want to split problems between two division according to the following rules: - Problemset of each division should be non-empty. - Each problem should be used in exactly one division (yes, it is unusual requirement). - Each problem used in division 1 should be harder than any problem used in division 2. - If two problems are similar, they should be used in different divisions. Your goal is count the number of ways to split problem between two divisions and satisfy all the rules. Two ways to split problems are considered to be different if there is at least one problem that belongs to division 1 in one of them and to division 2 in the other. Note, that the relation of similarity is not transitive. That is, if problem *i* is similar to problem *j* and problem *j* is similar to problem *k*, it doesn't follow that *i* is similar to *k*.
The first line of the input contains two integers *n* and *m* (2<=≤<=*n*<=≤<=100<=000, 0<=≤<=*m*<=≤<=100<=000) — the number of problems prepared for the round and the number of pairs of similar problems, respectively. Each of the following *m* lines contains a pair of similar problems *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*,<=*u**i*<=≠<=*v**i*). It's guaranteed, that no pair of problems meets twice in the input.
Print one integer — the number of ways to split problems in two divisions.
[ "5 2\n1 4\n5 2\n", "3 3\n1 2\n2 3\n1 3\n", "3 2\n3 1\n3 2\n" ]
[ "2\n", "0\n", "1\n" ]
In the first sample, problems 1 and 2 should be used in division 2, while problems 4 and 5 in division 1. Problem 3 may be used either in division 1 or in division 2. In the second sample, all pairs of problems are similar and there is no way to split problem between two divisions without breaking any rules. Third sample reminds you that the similarity relation is not transitive. Problem 3 is similar to both 1 and 2, but 1 is not similar to 2, so they may be used together.
750
[ { "input": "5 2\n1 4\n5 2", "output": "2" }, { "input": "3 3\n1 2\n2 3\n1 3", "output": "0" }, { "input": "3 2\n3 1\n3 2", "output": "1" }, { "input": "2 0", "output": "1" }, { "input": "2 1\n1 2", "output": "1" }, { "input": "3 0", "output": "2" }, { "input": "3 1\n1 2", "output": "1" }, { "input": "3 1\n1 3", "output": "2" }, { "input": "100000 0", "output": "99999" }, { "input": "4 2\n1 2\n3 4", "output": "0" }, { "input": "3 1\n2 3", "output": "1" }, { "input": "3 2\n1 2\n1 3", "output": "1" }, { "input": "3 2\n1 2\n2 3", "output": "0" }, { "input": "4 0", "output": "3" }, { "input": "100000 1\n100000 1", "output": "99999" }, { "input": "100000 1\n26711 97965", "output": "71254" }, { "input": "100000 10\n99562 479\n643 99684\n593 99867\n99529 175\n99738 616\n99523 766\n99503 121\n99784 158\n199 99199\n15 99849", "output": "98433" }, { "input": "10 10\n8 3\n2 8\n3 7\n3 9\n9 4\n7 2\n1 8\n1 9\n10 2\n10 1", "output": "3" }, { "input": "55 1\n55 1", "output": "54" }, { "input": "4 2\n1 4\n3 2", "output": "1" }, { "input": "5 1\n1 5", "output": "4" }, { "input": "7 1\n3 5", "output": "2" }, { "input": "7 2\n1 6\n2 7", "output": "4" }, { "input": "5 1\n2 3", "output": "1" }, { "input": "5 2\n3 5\n1 2", "output": "0" }, { "input": "4 2\n3 4\n1 2", "output": "0" }, { "input": "7 2\n1 5\n5 2", "output": "3" }, { "input": "7 2\n1 3\n3 6", "output": "0" }, { "input": "10 11\n1 10\n1 9\n1 8\n1 7\n2 10\n2 9\n2 8\n2 7\n3 10\n3 9\n3 8", "output": "4" }, { "input": "4 2\n1 2\n1 3", "output": "1" } ]
1,464,143,437
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
3
62
4,608,000
nm=input().split() n=int(nm[0]) m=int(nm[1]) i=0 d1=[] d2=[] while i<m: uv=input().split() u=int(uv[0]) v=int(uv[1]) d1.append(max(u,v)) d2.append(min(u,v)) i+=1 x=min(d1) y=max(d2) if x<=y: print(0) else: print(x-y)
Title: Problems for Round Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are *n* problems prepared for the next Codeforces round. They are arranged in ascending order by their difficulty, and no two problems have the same difficulty. Moreover, there are *m* pairs of similar problems. Authors want to split problems between two division according to the following rules: - Problemset of each division should be non-empty. - Each problem should be used in exactly one division (yes, it is unusual requirement). - Each problem used in division 1 should be harder than any problem used in division 2. - If two problems are similar, they should be used in different divisions. Your goal is count the number of ways to split problem between two divisions and satisfy all the rules. Two ways to split problems are considered to be different if there is at least one problem that belongs to division 1 in one of them and to division 2 in the other. Note, that the relation of similarity is not transitive. That is, if problem *i* is similar to problem *j* and problem *j* is similar to problem *k*, it doesn't follow that *i* is similar to *k*. Input Specification: The first line of the input contains two integers *n* and *m* (2<=≤<=*n*<=≤<=100<=000, 0<=≤<=*m*<=≤<=100<=000) — the number of problems prepared for the round and the number of pairs of similar problems, respectively. Each of the following *m* lines contains a pair of similar problems *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*,<=*u**i*<=≠<=*v**i*). It's guaranteed, that no pair of problems meets twice in the input. Output Specification: Print one integer — the number of ways to split problems in two divisions. Demo Input: ['5 2\n1 4\n5 2\n', '3 3\n1 2\n2 3\n1 3\n', '3 2\n3 1\n3 2\n'] Demo Output: ['2\n', '0\n', '1\n'] Note: In the first sample, problems 1 and 2 should be used in division 2, while problems 4 and 5 in division 1. Problem 3 may be used either in division 1 or in division 2. In the second sample, all pairs of problems are similar and there is no way to split problem between two divisions without breaking any rules. Third sample reminds you that the similarity relation is not transitive. Problem 3 is similar to both 1 and 2, but 1 is not similar to 2, so they may be used together.
```python nm=input().split() n=int(nm[0]) m=int(nm[1]) i=0 d1=[] d2=[] while i<m: uv=input().split() u=int(uv[0]) v=int(uv[1]) d1.append(max(u,v)) d2.append(min(u,v)) i+=1 x=min(d1) y=max(d2) if x<=y: print(0) else: print(x-y) ```
-1
236
A
Boy or Girl
PROGRAMMING
800
[ "brute force", "implementation", "strings" ]
null
null
Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network. But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names. This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method.
The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters.
If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes).
[ "wjmzbmr\n", "xiaodao\n", "sevenkplus\n" ]
[ "CHAT WITH HER!\n", "IGNORE HIM!\n", "CHAT WITH HER!\n" ]
For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
500
[ { "input": "wjmzbmr", "output": "CHAT WITH HER!" }, { "input": "xiaodao", "output": "IGNORE HIM!" }, { "input": "sevenkplus", "output": "CHAT WITH HER!" }, { "input": "pezu", "output": "CHAT WITH HER!" }, { "input": "wnemlgppy", "output": "CHAT WITH HER!" }, { "input": "zcinitufxoldnokacdvtmdohsfdjepyfioyvclhmujiqwvmudbfjzxjfqqxjmoiyxrfsbvseawwoyynn", "output": "IGNORE HIM!" }, { "input": "qsxxuoynwtebujwpxwpajitiwxaxwgbcylxneqiebzfphugwkftpaikixmumkhfbjiswmvzbtiyifbx", "output": "CHAT WITH HER!" }, { "input": "qwbdfzfylckctudyjlyrtmvbidfatdoqfmrfshsqqmhzohhsczscvwzpwyoyswhktjlykumhvaounpzwpxcspxwlgt", "output": "IGNORE HIM!" }, { "input": "nuezoadauueermoeaabjrkxttkatspjsjegjcjcdmcxgodowzbwuqncfbeqlhkk", "output": "IGNORE HIM!" }, { "input": "lggvdmulrsvtuagoavstuyufhypdxfomjlzpnduulukszqnnwfvxbvxyzmleocmofwclmzz", "output": "IGNORE HIM!" }, { "input": "tgcdptnkc", "output": "IGNORE HIM!" }, { "input": "wvfgnfrzabgibzxhzsojskmnlmrokydjoexnvi", "output": "IGNORE HIM!" }, { "input": "sxtburpzskucowowebgrbovhadrrayamuwypmmxhscrujkmcgvyinp", "output": "IGNORE HIM!" }, { "input": "pjqxhvxkyeqqvyuujxhmbspatvrckhhkfloottuybjivkkhpyivcighxumavrxzxslfpggnwbtalmhysyfllznphzia", "output": "IGNORE HIM!" }, { "input": "fpellxwskyekoyvrfnuf", "output": "CHAT WITH HER!" }, { "input": "xninyvkuvakfbs", "output": "IGNORE HIM!" }, { "input": "vnxhrweyvhqufpfywdwftoyrfgrhxuamqhblkvdpxmgvphcbeeqbqssresjifwyzgfhurmamhkwupymuomak", "output": "CHAT WITH HER!" }, { "input": "kmsk", "output": "IGNORE HIM!" }, { "input": "lqonogasrkzhryjxppjyriyfxmdfubieglthyswz", "output": "CHAT WITH HER!" }, { "input": "ndormkufcrkxlihdhmcehzoimcfhqsmombnfjrlcalffq", "output": "CHAT WITH HER!" }, { "input": "zqzlnnuwcfufwujygtczfakhcpqbtxtejrbgoodychepzdphdahtxyfpmlrycyicqthsgm", "output": "IGNORE HIM!" }, { "input": "ppcpbnhwoizajrl", "output": "IGNORE HIM!" }, { "input": "sgubujztzwkzvztitssxxxwzanfmddfqvv", "output": "CHAT WITH HER!" }, { "input": "ptkyaxycecpbrjnvxcjtbqiocqcswnmicxbvhdsptbxyxswbw", "output": "IGNORE HIM!" }, { "input": "yhbtzfppwcycxqjpqdfmjnhwaogyuaxamwxpnrdrnqsgdyfvxu", "output": "CHAT WITH HER!" }, { "input": "ojjvpnkrxibyevxk", "output": "CHAT WITH HER!" }, { "input": "wjweqcrqfuollfvfbiyriijovweg", "output": "IGNORE HIM!" }, { "input": "hkdbykboclchfdsuovvpknwqr", "output": "IGNORE HIM!" }, { "input": "stjvyfrfowopwfjdveduedqylerqugykyu", "output": "IGNORE HIM!" }, { "input": "rafcaanqytfclvfdegak", "output": "CHAT WITH HER!" }, { "input": "xczn", "output": "CHAT WITH HER!" }, { "input": "arcoaeozyeawbveoxpmafxxzdjldsielp", "output": "IGNORE HIM!" }, { "input": "smdfafbyehdylhaleevhoggiurdgeleaxkeqdixyfztkuqsculgslheqfafxyghyuibdgiuwrdxfcitojxika", "output": "CHAT WITH HER!" }, { "input": "vbpfgjqnhfazmvtkpjrdasfhsuxnpiepxfrzvoh", "output": "CHAT WITH HER!" }, { "input": "dbdokywnpqnotfrhdbrzmuyoxfdtrgrzcccninbtmoqvxfatcqg", "output": "CHAT WITH HER!" }, { "input": "udlpagtpq", "output": "CHAT WITH HER!" }, { "input": "zjurevbytijifnpfuyswfchdzelxheboruwjqijxcucylysmwtiqsqqhktexcynquvcwhbjsipy", "output": "CHAT WITH HER!" }, { "input": "qagzrqjomdwhagkhrjahhxkieijyten", "output": "CHAT WITH HER!" }, { "input": "achhcfjnnfwgoufxamcqrsontgjjhgyfzuhklkmiwybnrlsvblnsrjqdytglipxsulpnphpjpoewvlusalsgovwnsngb", "output": "CHAT WITH HER!" }, { "input": "qbkjsdwpahdbbohggbclfcufqelnojoehsxxkr", "output": "CHAT WITH HER!" }, { "input": "cpvftiwgyvnlmbkadiafddpgfpvhqqvuehkypqjsoibpiudfvpkhzlfrykc", "output": "IGNORE HIM!" }, { "input": "lnpdosnceumubvk", "output": "IGNORE HIM!" }, { "input": "efrk", "output": "CHAT WITH HER!" }, { "input": "temnownneghnrujforif", "output": "IGNORE HIM!" }, { "input": "ottnneymszwbumgobazfjyxewkjakglbfflsajuzescplpcxqta", "output": "IGNORE HIM!" }, { "input": "eswpaclodzcwhgixhpyzvhdwsgneqidanbzdzszquefh", "output": "IGNORE HIM!" }, { "input": "gwntwbpj", "output": "IGNORE HIM!" }, { "input": "wuqvlbblkddeindiiswsinkfrnkxghhwunzmmvyovpqapdfbolyim", "output": "IGNORE HIM!" }, { "input": "swdqsnzmzmsyvktukaoyqsqzgfmbzhezbfaqeywgwizrwjyzquaahucjchegknqaioliqd", "output": "CHAT WITH HER!" }, { "input": "vlhrpzezawyolhbmvxbwhtjustdbqggexmzxyieihjlelvwjosmkwesfjmramsikhkupzvfgezmrqzudjcalpjacmhykhgfhrjx", "output": "IGNORE HIM!" }, { "input": "lxxwbkrjgnqjwsnflfnsdyxihmlspgivirazsbveztnkuzpaxtygidniflyjheejelnjyjvgkgvdqks", "output": "CHAT WITH HER!" }, { "input": "wpxbxzfhtdecetpljcrvpjjnllosdqirnkzesiqeukbedkayqx", "output": "CHAT WITH HER!" }, { "input": "vmzxgacicvweclaodrunmjnfwtimceetsaoickarqyrkdghcmyjgmtgsqastcktyrjgvjqimdc", "output": "CHAT WITH HER!" }, { "input": "yzlzmesxdttfcztooypjztlgxwcr", "output": "IGNORE HIM!" }, { "input": "qpbjwzwgdzmeluheirjrvzrhbmagfsjdgvzgwumjtjzecsfkrfqjasssrhhtgdqqfydlmrktlgfc", "output": "IGNORE HIM!" }, { "input": "aqzftsvezdgouyrirsxpbuvdjupnzvbhguyayeqozfzymfnepvwgblqzvmxxkxcilmsjvcgyqykpoaktjvsxbygfgsalbjoq", "output": "CHAT WITH HER!" }, { "input": "znicjjgijhrbdlnwmtjgtdgziollrfxroabfhadygnomodaembllreorlyhnehijfyjbfxucazellblegyfrzuraogadj", "output": "IGNORE HIM!" }, { "input": "qordzrdiknsympdrkgapjxokbldorpnmnpucmwakklmqenpmkom", "output": "CHAT WITH HER!" }, { "input": "wqfldgihuxfktzanyycluzhtewmwvnawqlfoavuguhygqrrxtstxwouuzzsryjqtfqo", "output": "CHAT WITH HER!" }, { "input": "vujtrrpshinkskgyknlcfckmqdrwtklkzlyipmetjvaqxdsslkskschbalmdhzsdrrjmxdltbtnxbh", "output": "IGNORE HIM!" }, { "input": "zioixjibuhrzyrbzqcdjbbhhdmpgmqykixcxoqupggaqajuzonrpzihbsogjfsrrypbiphehonyhohsbybnnukqebopppa", "output": "CHAT WITH HER!" }, { "input": "oh", "output": "CHAT WITH HER!" }, { "input": "kxqthadqesbpgpsvpbcbznxpecqrzjoilpauttzlnxvaczcqwuri", "output": "IGNORE HIM!" }, { "input": "zwlunigqnhrwirkvufqwrnwcnkqqonebrwzcshcbqqwkjxhymjjeakuzjettebciadjlkbfp", "output": "CHAT WITH HER!" }, { "input": "fjuldpuejgmggvvigkwdyzytfxzwdlofrpifqpdnhfyroginqaufwgjcbgshyyruwhofctsdaisqpjxqjmtpp", "output": "CHAT WITH HER!" }, { "input": "xiwntnheuitbtqxrmzvxmieldudakogealwrpygbxsbluhsqhtwmdlpjwzyafckrqrdduonkgo", "output": "CHAT WITH HER!" }, { "input": "mnmbupgo", "output": "IGNORE HIM!" }, { "input": "mcjehdiygkbmrbfjqwpwxidbdfelifwhstaxdapigbymmsgrhnzsdjhsqchl", "output": "IGNORE HIM!" }, { "input": "yocxrzspinchmhtmqo", "output": "CHAT WITH HER!" }, { "input": "vasvvnpymtgjirnzuynluluvmgpquskuaafwogeztfnvybblajvuuvfomtifeuzpikjrolzeeoftv", "output": "CHAT WITH HER!" }, { "input": "ecsdicrznvglwggrdbrvehwzaenzjutjydhvimtqegweurpxtjkmpcznshtrvotkvrghxhacjkedidqqzrduzad", "output": "IGNORE HIM!" }, { "input": "ubvhyaebyxoghakajqrpqpctwbrfqzli", "output": "CHAT WITH HER!" }, { "input": "gogbxfeqylxoummvgxpkoqzsmobasesxbqjjktqbwqxeiaagnnhbvepbpy", "output": "IGNORE HIM!" }, { "input": "nheihhxkbbrmlpxpxbhnpofcjmxemyvqqdbanwd", "output": "IGNORE HIM!" }, { "input": "acrzbavz", "output": "CHAT WITH HER!" }, { "input": "drvzznznvrzskftnrhvvzxcalwutxmdza", "output": "IGNORE HIM!" }, { "input": "oacwxipdfcoabhkwxqdbtowiekpnflnqhlrkustgzryvws", "output": "CHAT WITH HER!" }, { "input": "tpnwfmfsibnccvdwjvzviyvjfljupinfigfunyff", "output": "CHAT WITH HER!" }, { "input": "gavaihhamfolcndgytcsgucqdqngxkrlovpthvteacmmthoglxu", "output": "CHAT WITH HER!" }, { "input": "hsfcfvameeupldgvchmogrvwxrvsmnwxxkxoawwodtsahqvehlcw", "output": "IGNORE HIM!" }, { "input": "sbkydrscoojychxchqsuciperfroumenelgiyiwlqfwximrgdbyvkmacy", "output": "CHAT WITH HER!" }, { "input": "rhh", "output": "CHAT WITH HER!" }, { "input": "zhdouqfmlkenjzdijxdfxnlegxeuvhelo", "output": "IGNORE HIM!" }, { "input": "yufkkfwyhhvcjntsgsvpzbhqtmtgyxifqoewmuplphykmptfdebjxuaxigomjtwgtljwdjhjernkitifbomifbhysnmadtnyn", "output": "CHAT WITH HER!" }, { "input": "urigreuzpxnej", "output": "CHAT WITH HER!" } ]
1,695,190,333
2,147,483,647
Python 3
OK
TESTS
85
92
0
# Read the user name as a string user_name = input() # Count the number of distinct characters in the user name distinct_characters = set(user_name) # Check if the count is even or odd if len(distinct_characters) % 2 == 0: print("CHAT WITH HER!") else: print("IGNORE HIM!")
Title: Boy or Girl Time Limit: None seconds Memory Limit: None megabytes Problem Description: Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network. But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names. This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method. Input Specification: The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters. Output Specification: If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes). Demo Input: ['wjmzbmr\n', 'xiaodao\n', 'sevenkplus\n'] Demo Output: ['CHAT WITH HER!\n', 'IGNORE HIM!\n', 'CHAT WITH HER!\n'] Note: For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
```python # Read the user name as a string user_name = input() # Count the number of distinct characters in the user name distinct_characters = set(user_name) # Check if the count is even or odd if len(distinct_characters) % 2 == 0: print("CHAT WITH HER!") else: print("IGNORE HIM!") ```
3
479
A
Expression
PROGRAMMING
1,000
[ "brute force", "math" ]
null
null
Petya studies in a school and he adores Maths. His class has been studying arithmetic expressions. On the last class the teacher wrote three positive integers *a*, *b*, *c* on the blackboard. The task was to insert signs of operations '+' and '*', and probably brackets between the numbers so that the value of the resulting expression is as large as possible. Let's consider an example: assume that the teacher wrote numbers 1, 2 and 3 on the blackboard. Here are some ways of placing signs and brackets: - 1+2*3=7 - 1*(2+3)=5 - 1*2*3=6 - (1+2)*3=9 Note that you can insert operation signs only between *a* and *b*, and between *b* and *c*, that is, you cannot swap integers. For instance, in the given sample you cannot get expression (1+3)*2. It's easy to see that the maximum value that you can obtain is 9. Your task is: given *a*, *b* and *c* print the maximum value that you can get.
The input contains three integers *a*, *b* and *c*, each on a single line (1<=≤<=*a*,<=*b*,<=*c*<=≤<=10).
Print the maximum value of the expression that you can obtain.
[ "1\n2\n3\n", "2\n10\n3\n" ]
[ "9\n", "60\n" ]
none
500
[ { "input": "1\n2\n3", "output": "9" }, { "input": "2\n10\n3", "output": "60" }, { "input": "1\n1\n1", "output": "3" }, { "input": "1\n2\n1", "output": "4" }, { "input": "10\n10\n10", "output": "1000" }, { "input": "5\n1\n3", "output": "20" }, { "input": "3\n1\n5", "output": "20" }, { "input": "6\n7\n1", "output": "48" }, { "input": "1\n8\n3", "output": "27" }, { "input": "9\n7\n2", "output": "126" }, { "input": "1\n1\n10", "output": "20" }, { "input": "9\n1\n1", "output": "18" }, { "input": "10\n5\n6", "output": "300" }, { "input": "8\n9\n7", "output": "504" }, { "input": "4\n2\n10", "output": "80" }, { "input": "2\n8\n3", "output": "48" }, { "input": "3\n5\n7", "output": "105" }, { "input": "1\n10\n1", "output": "12" }, { "input": "2\n2\n2", "output": "8" }, { "input": "5\n6\n1", "output": "35" }, { "input": "10\n1\n1", "output": "20" }, { "input": "1\n6\n1", "output": "8" }, { "input": "1\n9\n1", "output": "11" }, { "input": "2\n1\n2", "output": "6" }, { "input": "2\n6\n1", "output": "14" }, { "input": "9\n2\n1", "output": "27" }, { "input": "1\n9\n2", "output": "20" }, { "input": "1\n3\n1", "output": "5" }, { "input": "2\n1\n1", "output": "4" } ]
1,694,167,724
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
31
0
a,b,c = map(int,input().split()) x1 = a+b+c x2 = a*b*c x3 = (a+b)*c x4 = a+(b*c) x5 = a*b+c print(max(x1,x2,x3,x4,x5))
Title: Expression Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petya studies in a school and he adores Maths. His class has been studying arithmetic expressions. On the last class the teacher wrote three positive integers *a*, *b*, *c* on the blackboard. The task was to insert signs of operations '+' and '*', and probably brackets between the numbers so that the value of the resulting expression is as large as possible. Let's consider an example: assume that the teacher wrote numbers 1, 2 and 3 on the blackboard. Here are some ways of placing signs and brackets: - 1+2*3=7 - 1*(2+3)=5 - 1*2*3=6 - (1+2)*3=9 Note that you can insert operation signs only between *a* and *b*, and between *b* and *c*, that is, you cannot swap integers. For instance, in the given sample you cannot get expression (1+3)*2. It's easy to see that the maximum value that you can obtain is 9. Your task is: given *a*, *b* and *c* print the maximum value that you can get. Input Specification: The input contains three integers *a*, *b* and *c*, each on a single line (1<=≤<=*a*,<=*b*,<=*c*<=≤<=10). Output Specification: Print the maximum value of the expression that you can obtain. Demo Input: ['1\n2\n3\n', '2\n10\n3\n'] Demo Output: ['9\n', '60\n'] Note: none
```python a,b,c = map(int,input().split()) x1 = a+b+c x2 = a*b*c x3 = (a+b)*c x4 = a+(b*c) x5 = a*b+c print(max(x1,x2,x3,x4,x5)) ```
-1
58
A
Chat room
PROGRAMMING
1,000
[ "greedy", "strings" ]
A. Chat room
1
256
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
If Vasya managed to say hello, print "YES", otherwise print "NO".
[ "ahhellllloou\n", "hlelo\n" ]
[ "YES\n", "NO\n" ]
none
500
[ { "input": "ahhellllloou", "output": "YES" }, { "input": "hlelo", "output": "NO" }, { "input": "helhcludoo", "output": "YES" }, { "input": "hehwelloho", "output": "YES" }, { "input": "pnnepelqomhhheollvlo", "output": "YES" }, { "input": "tymbzjyqhymedasloqbq", "output": "NO" }, { "input": "yehluhlkwo", "output": "NO" }, { "input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello", "output": "YES" }, { "input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq", "output": "YES" }, { "input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi", "output": "YES" }, { "input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo", "output": "YES" }, { "input": "lqllcolohwflhfhlnaow", "output": "NO" }, { "input": "heheeellollvoo", "output": "YES" }, { "input": "hellooo", "output": "YES" }, { "input": "o", "output": "NO" }, { "input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv", "output": "YES" }, { "input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk", "output": "YES" }, { "input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry", "output": "NO" }, { "input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq", "output": "NO" }, { "input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi", "output": "YES" }, { "input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm", "output": "YES" }, { "input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac", "output": "NO" }, { "input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok", "output": "YES" }, { "input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz", "output": "YES" }, { "input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb", "output": "YES" }, { "input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla", "output": "YES" }, { "input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz", "output": "YES" }, { "input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti", "output": "YES" }, { "input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli", "output": "YES" }, { "input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo", "output": "YES" }, { "input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk", "output": "NO" }, { "input": "loee", "output": "NO" }, { "input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo", "output": "NO" }, { "input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi", "output": "YES" }, { "input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv", "output": "NO" }, { "input": "hello", "output": "YES" }, { "input": "oohell", "output": "NO" }, { "input": "hell", "output": "NO" }, { "input": "eloellohoelo", "output": "NO" }, { "input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo", "output": "YES" } ]
1,559,282,925
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
1
109
0
# a = input() def is_a_in_b(a, b): if len(a) ==0: return True if len(b) ==1: if len(a) == 1: return a in b else: return False else: if b[0] == a[0]: return is_a_in_b(a[1:0],b[1:0]) else: return is_a_in_b(a, b[1:]) a = list("hello") b = list(input()) if is_a_in_b(a, b): print ("YES") else: print ("NO")
Title: Chat room Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*. Input Specification: The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters. Output Specification: If Vasya managed to say hello, print "YES", otherwise print "NO". Demo Input: ['ahhellllloou\n', 'hlelo\n'] Demo Output: ['YES\n', 'NO\n'] Note: none
```python # a = input() def is_a_in_b(a, b): if len(a) ==0: return True if len(b) ==1: if len(a) == 1: return a in b else: return False else: if b[0] == a[0]: return is_a_in_b(a[1:0],b[1:0]) else: return is_a_in_b(a, b[1:]) a = list("hello") b = list(input()) if is_a_in_b(a, b): print ("YES") else: print ("NO") ```
0
118
A
String Task
PROGRAMMING
1,000
[ "implementation", "strings" ]
null
null
Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it: - deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones. Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string. Help Petya cope with this easy task.
The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.
Print the resulting string. It is guaranteed that this string is not empty.
[ "tour\n", "Codeforces\n", "aBAcAba\n" ]
[ ".t.r\n", ".c.d.f.r.c.s\n", ".b.c.b\n" ]
none
500
[ { "input": "tour", "output": ".t.r" }, { "input": "Codeforces", "output": ".c.d.f.r.c.s" }, { "input": "aBAcAba", "output": ".b.c.b" }, { "input": "obn", "output": ".b.n" }, { "input": "wpwl", "output": ".w.p.w.l" }, { "input": "ggdvq", "output": ".g.g.d.v.q" }, { "input": "pumesz", "output": ".p.m.s.z" }, { "input": "g", "output": ".g" }, { "input": "zjuotps", "output": ".z.j.t.p.s" }, { "input": "jzbwuehe", "output": ".j.z.b.w.h" }, { "input": "tnkgwuugu", "output": ".t.n.k.g.w.g" }, { "input": "kincenvizh", "output": ".k.n.c.n.v.z.h" }, { "input": "xattxjenual", "output": ".x.t.t.x.j.n.l" }, { "input": "ktajqhpqsvhw", "output": ".k.t.j.q.h.p.q.s.v.h.w" }, { "input": "xnhcigytnqcmy", "output": ".x.n.h.c.g.t.n.q.c.m" }, { "input": "jfmtbejyilxcec", "output": ".j.f.m.t.b.j.l.x.c.c" }, { "input": "D", "output": ".d" }, { "input": "ab", "output": ".b" }, { "input": "Ab", "output": ".b" }, { "input": "aB", "output": ".b" }, { "input": "AB", "output": ".b" }, { "input": "ba", "output": ".b" }, { "input": "bA", "output": ".b" }, { "input": "Ba", "output": ".b" }, { "input": "BA", "output": ".b" }, { "input": "aab", "output": ".b" }, { "input": "baa", "output": ".b" }, { "input": "femOZeCArKCpUiHYnbBPTIOFmsHmcpObtPYcLCdjFrUMIyqYzAokKUiiKZRouZiNMoiOuGVoQzaaCAOkquRjmmKKElLNqCnhGdQM", "output": ".f.m.z.c.r.k.c.p.h.n.b.b.p.t.f.m.s.h.m.c.p.b.t.p.c.l.c.d.j.f.r.m.q.z.k.k.k.z.r.z.n.m.g.v.q.z.c.k.q.r.j.m.m.k.k.l.l.n.q.c.n.h.g.d.q.m" }, { "input": "VMBPMCmMDCLFELLIISUJDWQRXYRDGKMXJXJHXVZADRZWVWJRKFRRNSAWKKDPZZLFLNSGUNIVJFBEQsMDHSBJVDTOCSCgZWWKvZZN", "output": ".v.m.b.p.m.c.m.m.d.c.l.f.l.l.s.j.d.w.q.r.x.r.d.g.k.m.x.j.x.j.h.x.v.z.d.r.z.w.v.w.j.r.k.f.r.r.n.s.w.k.k.d.p.z.z.l.f.l.n.s.g.n.v.j.f.b.q.s.m.d.h.s.b.j.v.d.t.c.s.c.g.z.w.w.k.v.z.z.n" }, { "input": "MCGFQQJNUKuAEXrLXibVjClSHjSxmlkQGTKZrRaDNDomIPOmtSgjJAjNVIVLeUGUAOHNkCBwNObVCHOWvNkLFQQbFnugYVMkJruJ", "output": ".m.c.g.f.q.q.j.n.k.x.r.l.x.b.v.j.c.l.s.h.j.s.x.m.l.k.q.g.t.k.z.r.r.d.n.d.m.p.m.t.s.g.j.j.j.n.v.v.l.g.h.n.k.c.b.w.n.b.v.c.h.w.v.n.k.l.f.q.q.b.f.n.g.v.m.k.j.r.j" }, { "input": "iyaiuiwioOyzUaOtAeuEYcevvUyveuyioeeueoeiaoeiavizeeoeyYYaaAOuouueaUioueauayoiuuyiuovyOyiyoyioaoyuoyea", "output": ".w.z.t.c.v.v.v.v.z.v" }, { "input": "yjnckpfyLtzwjsgpcrgCfpljnjwqzgVcufnOvhxplvflxJzqxnhrwgfJmPzifgubvspffmqrwbzivatlmdiBaddiaktdsfPwsevl", "output": ".j.n.c.k.p.f.l.t.z.w.j.s.g.p.c.r.g.c.f.p.l.j.n.j.w.q.z.g.v.c.f.n.v.h.x.p.l.v.f.l.x.j.z.q.x.n.h.r.w.g.f.j.m.p.z.f.g.b.v.s.p.f.f.m.q.r.w.b.z.v.t.l.m.d.b.d.d.k.t.d.s.f.p.w.s.v.l" }, { "input": "RIIIUaAIYJOiuYIUWFPOOAIuaUEZeIooyUEUEAoIyIHYOEAlVAAIiLUAUAeiUIEiUMuuOiAgEUOIAoOUYYEYFEoOIIVeOOAOIIEg", "output": ".r.j.w.f.p.z.h.l.v.l.m.g.f.v.g" }, { "input": "VBKQCFBMQHDMGNSGBQVJTGQCNHHRJMNKGKDPPSQRRVQTZNKBZGSXBPBRXPMVFTXCHZMSJVBRNFNTHBHGJLMDZJSVPZZBCCZNVLMQ", "output": ".v.b.k.q.c.f.b.m.q.h.d.m.g.n.s.g.b.q.v.j.t.g.q.c.n.h.h.r.j.m.n.k.g.k.d.p.p.s.q.r.r.v.q.t.z.n.k.b.z.g.s.x.b.p.b.r.x.p.m.v.f.t.x.c.h.z.m.s.j.v.b.r.n.f.n.t.h.b.h.g.j.l.m.d.z.j.s.v.p.z.z.b.c.c.z.n.v.l.m.q" }, { "input": "iioyoaayeuyoolyiyoeuouiayiiuyTueyiaoiueyioiouyuauouayyiaeoeiiigmioiououeieeeyuyyaYyioiiooaiuouyoeoeg", "output": ".l.t.g.m.g" }, { "input": "ueyiuiauuyyeueykeioouiiauzoyoeyeuyiaoaiiaaoaueyaeydaoauexuueafouiyioueeaaeyoeuaueiyiuiaeeayaioeouiuy", "output": ".k.z.d.x.f" }, { "input": "FSNRBXLFQHZXGVMKLQDVHWLDSLKGKFMDRQWMWSSKPKKQBNDZRSCBLRSKCKKFFKRDMZFZGCNSMXNPMZVDLKXGNXGZQCLRTTDXLMXQ", "output": ".f.s.n.r.b.x.l.f.q.h.z.x.g.v.m.k.l.q.d.v.h.w.l.d.s.l.k.g.k.f.m.d.r.q.w.m.w.s.s.k.p.k.k.q.b.n.d.z.r.s.c.b.l.r.s.k.c.k.k.f.f.k.r.d.m.z.f.z.g.c.n.s.m.x.n.p.m.z.v.d.l.k.x.g.n.x.g.z.q.c.l.r.t.t.d.x.l.m.x.q" }, { "input": "EYAYAYIOIOYOOAUOEUEUOUUYIYUUMOEOIIIAOIUOAAOIYOIOEUIERCEYYAOIOIGYUIAOYUEOEUAEAYPOYEYUUAUOAOEIYIEYUEEY", "output": ".m.r.c.g.p" }, { "input": "jvvzcdcxjstbbksmqjsngxkgtttdxrljjxtwptgwwqzpvqchvgrkqlzxmptzblxhhsmrkmzzmgdfskhtmmnqzzflpmqdctvrfgtx", "output": ".j.v.v.z.c.d.c.x.j.s.t.b.b.k.s.m.q.j.s.n.g.x.k.g.t.t.t.d.x.r.l.j.j.x.t.w.p.t.g.w.w.q.z.p.v.q.c.h.v.g.r.k.q.l.z.x.m.p.t.z.b.l.x.h.h.s.m.r.k.m.z.z.m.g.d.f.s.k.h.t.m.m.n.q.z.z.f.l.p.m.q.d.c.t.v.r.f.g.t.x" }, { "input": "YB", "output": ".b" }, { "input": "fly", "output": ".f.l" }, { "input": "YyyYYYyyYxdwdawdDAWDdaddYYYY", "output": ".x.d.w.d.w.d.d.w.d.d.d.d" } ]
1,698,922,371
2,147,483,647
Python 3
COMPILATION_ERROR
TESTS
0
0
0
l=list(input().split()) k=[] for i in l : if l[i]==a or l[i]==e or l[i]==i or l[i]==o or l[i]== u or l[i]==A or l[i]==E or l[i]==I or l[i]==O or l[i]== U : l.pop[i] for j in range(len(l)): k.append(.) k.append(l[j]) for p in k: print(i,end="")
Title: String Task Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it: - deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones. Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string. Help Petya cope with this easy task. Input Specification: The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive. Output Specification: Print the resulting string. It is guaranteed that this string is not empty. Demo Input: ['tour\n', 'Codeforces\n', 'aBAcAba\n'] Demo Output: ['.t.r\n', '.c.d.f.r.c.s\n', '.b.c.b\n'] Note: none
```python l=list(input().split()) k=[] for i in l : if l[i]==a or l[i]==e or l[i]==i or l[i]==o or l[i]== u or l[i]==A or l[i]==E or l[i]==I or l[i]==O or l[i]== U : l.pop[i] for j in range(len(l)): k.append(.) k.append(l[j]) for p in k: print(i,end="") ```
-1
349
A
Cinema Line
PROGRAMMING
1,100
[ "greedy", "implementation" ]
null
null
The new "Die Hard" movie has just been released! There are *n* people at the cinema box office standing in a huge line. Each of them has a single 100, 50 or 25 ruble bill. A "Die Hard" ticket costs 25 rubles. Can the booking clerk sell a ticket to each person and give the change if he initially has no money and sells the tickets strictly in the order people follow in the line?
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of people in the line. The next line contains *n* integers, each of them equals 25, 50 or 100 — the values of the bills the people have. The numbers are given in the order from the beginning of the line (at the box office) to the end of the line.
Print "YES" (without the quotes) if the booking clerk can sell a ticket to each person and give the change. Otherwise print "NO".
[ "4\n25 25 50 50\n", "2\n25 100\n", "4\n50 50 25 25\n" ]
[ "YES\n", "NO\n", "NO\n" ]
none
500
[ { "input": "4\n25 25 50 50", "output": "YES" }, { "input": "2\n25 100", "output": "NO" }, { "input": "4\n50 50 25 25", "output": "NO" }, { "input": "3\n25 50 100", "output": "NO" }, { "input": "10\n25 25 25 25 25 25 25 25 25 25", "output": "YES" }, { "input": "10\n50 50 50 50 50 50 50 50 50 50", "output": "NO" }, { "input": "10\n100 100 100 100 100 100 100 100 100 100", "output": "NO" }, { "input": "7\n25 25 25 25 50 100 50", "output": "YES" }, { "input": "2\n25 25", "output": "YES" }, { "input": "3\n50 100 100", "output": "NO" }, { "input": "3\n25 50 50", "output": "NO" }, { "input": "2\n50 25", "output": "NO" }, { "input": "14\n25 25 25 25 25 25 25 50 50 50 100 100 100 100", "output": "NO" }, { "input": "5\n25 25 25 100 100", "output": "NO" }, { "input": "7\n25 50 25 50 25 50 100", "output": "NO" }, { "input": "5\n25 50 25 50 100", "output": "NO" }, { "input": "5\n25 25 50 50 50", "output": "NO" }, { "input": "5\n25 25 50 100 50", "output": "NO" }, { "input": "5\n25 25 50 50 100", "output": "NO" }, { "input": "1\n50", "output": "NO" } ]
1,666,718,189
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
3
92
0
n = int(input()) tickets = list(map(int, input().split())) curr = 0 ticket_cost = 25 for ticket in tickets: if curr - (ticket - ticket_cost) < 0: print("NO") break curr += ticket else: print("YES")
Title: Cinema Line Time Limit: None seconds Memory Limit: None megabytes Problem Description: The new "Die Hard" movie has just been released! There are *n* people at the cinema box office standing in a huge line. Each of them has a single 100, 50 or 25 ruble bill. A "Die Hard" ticket costs 25 rubles. Can the booking clerk sell a ticket to each person and give the change if he initially has no money and sells the tickets strictly in the order people follow in the line? Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of people in the line. The next line contains *n* integers, each of them equals 25, 50 or 100 — the values of the bills the people have. The numbers are given in the order from the beginning of the line (at the box office) to the end of the line. Output Specification: Print "YES" (without the quotes) if the booking clerk can sell a ticket to each person and give the change. Otherwise print "NO". Demo Input: ['4\n25 25 50 50\n', '2\n25 100\n', '4\n50 50 25 25\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none
```python n = int(input()) tickets = list(map(int, input().split())) curr = 0 ticket_cost = 25 for ticket in tickets: if curr - (ticket - ticket_cost) < 0: print("NO") break curr += ticket else: print("YES") ```
0
1,011
B
Planning The Expedition
PROGRAMMING
1,200
[ "binary search", "brute force", "implementation" ]
null
null
Natasha is planning an expedition to Mars for $n$ people. One of the important tasks is to provide food for each participant. The warehouse has $m$ daily food packages. Each package has some food type $a_i$. Each participant must eat exactly one food package each day. Due to extreme loads, each participant must eat the same food type throughout the expedition. Different participants may eat different (or the same) types of food. Formally, for each participant $j$ Natasha should select his food type $b_j$ and each day $j$-th participant will eat one food package of type $b_j$. The values $b_j$ for different participants may be different. What is the maximum possible number of days the expedition can last, following the requirements above?
The first line contains two integers $n$ and $m$ ($1 \le n \le 100$, $1 \le m \le 100$) — the number of the expedition participants and the number of the daily food packages available. The second line contains sequence of integers $a_1, a_2, \dots, a_m$ ($1 \le a_i \le 100$), where $a_i$ is the type of $i$-th food package.
Print the single integer — the number of days the expedition can last. If it is not possible to plan the expedition for even one day, print 0.
[ "4 10\n1 5 2 1 1 1 2 5 7 2\n", "100 1\n1\n", "2 5\n5 4 3 2 1\n", "3 9\n42 42 42 42 42 42 42 42 42\n" ]
[ "2\n", "0\n", "1\n", "3\n" ]
In the first example, Natasha can assign type $1$ food to the first participant, the same type $1$ to the second, type $5$ to the third and type $2$ to the fourth. In this case, the expedition can last for $2$ days, since each participant can get two food packages of his food type (there will be used $4$ packages of type $1$, two packages of type $2$ and two packages of type $5$). In the second example, there are $100$ participants and only $1$ food package. In this case, the expedition can't last even $1$ day.
1,000
[ { "input": "4 10\n1 5 2 1 1 1 2 5 7 2", "output": "2" }, { "input": "100 1\n1", "output": "0" }, { "input": "2 5\n5 4 3 2 1", "output": "1" }, { "input": "3 9\n42 42 42 42 42 42 42 42 42", "output": "3" }, { "input": "1 1\n100", "output": "1" }, { "input": "4 100\n84 99 66 69 86 94 89 96 98 93 93 82 87 93 91 100 69 99 93 81 99 84 75 100 86 88 98 100 84 96 44 70 94 91 85 78 86 79 45 88 91 78 98 94 81 87 93 72 96 88 96 97 96 62 86 72 94 84 80 98 88 90 93 73 73 98 78 50 91 96 97 82 85 90 87 41 97 82 97 77 100 100 92 83 98 81 70 81 74 78 84 79 98 98 55 99 97 99 79 98", "output": "5" }, { "input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1" }, { "input": "1 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "100" }, { "input": "6 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "15" }, { "input": "1 1\n59", "output": "1" }, { "input": "1 50\n39 1 46 21 23 28 100 32 63 63 18 15 40 29 34 49 56 74 47 42 96 97 59 62 76 62 69 61 36 21 66 18 92 58 63 85 5 6 77 75 91 66 38 10 66 43 20 74 37 83", "output": "3" }, { "input": "1 100\n83 72 21 55 49 5 61 60 87 21 89 88 3 75 49 81 36 25 50 61 96 19 36 55 48 8 97 69 50 24 23 39 26 25 41 90 69 20 19 62 38 52 60 6 66 31 9 45 36 12 69 94 22 60 91 65 35 58 13 85 33 87 83 11 95 20 20 85 13 21 57 69 17 94 78 37 59 45 60 7 64 51 60 89 91 22 6 58 95 96 51 53 89 22 28 16 27 56 1 54", "output": "5" }, { "input": "50 1\n75", "output": "0" }, { "input": "50 50\n85 20 12 73 52 78 70 95 88 43 31 88 81 41 80 99 16 11 97 11 21 44 2 34 47 38 87 2 32 47 97 93 52 14 35 37 97 48 58 19 52 55 97 72 17 25 16 85 90 58", "output": "1" }, { "input": "50 100\n2 37 74 32 99 75 73 86 67 33 62 30 15 21 51 41 73 75 67 39 90 10 56 74 72 26 38 65 75 55 46 99 34 49 92 82 11 100 15 71 75 12 22 56 47 74 20 98 59 65 14 76 1 40 89 36 43 93 83 73 75 100 50 95 27 10 72 51 25 69 15 3 57 60 84 99 31 44 12 61 69 95 51 31 28 36 57 35 31 52 44 19 79 12 27 27 7 81 68 1", "output": "1" }, { "input": "100 1\n26", "output": "0" }, { "input": "100 50\n8 82 62 11 85 57 5 32 99 92 77 2 61 86 8 88 10 28 83 4 68 79 8 64 56 98 4 88 22 54 30 60 62 79 72 38 17 28 32 16 62 26 56 44 72 33 22 84 77 45", "output": "0" }, { "input": "100 100\n13 88 64 65 78 10 61 97 16 32 76 9 60 1 40 35 90 61 60 85 26 16 38 36 33 95 24 55 82 88 13 9 47 34 94 2 90 74 11 81 46 70 94 11 55 32 19 36 97 16 17 35 38 82 89 16 74 94 97 79 9 94 88 12 28 2 4 25 72 95 49 31 88 82 6 77 70 98 90 57 57 33 38 61 26 75 2 66 22 44 13 35 16 4 33 16 12 66 32 86", "output": "1" }, { "input": "34 64\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1" }, { "input": "53 98\n1 1 2 2 2 2 2 1 2 2 2 1 1 2 2 2 1 1 2 1 1 2 2 1 1 2 1 1 1 2 1 2 1 1 1 2 2 1 2 1 1 1 2 2 1 2 1 1 2 1 2 2 1 2 2 2 2 2 2 2 2 2 1 1 2 2 1 2 1 2 1 2 1 1 2 2 2 1 1 2 1 2 1 1 1 1 2 2 2 2 2 1 1 2 2 2 1 1", "output": "1" }, { "input": "17 8\n2 5 3 4 3 2 2 2", "output": "0" }, { "input": "24 77\n8 6 10 4 6 6 4 10 9 7 7 5 5 4 6 7 10 6 3 4 6 6 4 9 4 6 2 5 3 4 4 1 4 6 6 8 1 1 6 4 6 2 5 7 7 2 4 4 10 1 10 9 2 3 8 1 10 4 3 9 3 8 3 5 6 3 4 9 5 3 4 1 1 6 1 2 1", "output": "2" }, { "input": "65 74\n7 19 2 38 28 44 34 49 14 13 30 22 11 4 4 12 8 1 40 8 34 31 44 38 21 35 13 7 19 32 37 5 36 26 7 2 15 11 47 45 48 2 49 10 10 42 42 31 50 24 29 34 31 38 39 48 43 47 32 46 10 1 33 21 12 50 13 44 38 11 41 41 10 7", "output": "1" }, { "input": "37 71\n50 93 15 80 82 23 35 90 70 73 55 23 23 6 86 63 38 70 38 52 88 34 25 75 32 19 6 98 31 38 21 8 66 8 59 71 7 80 69 23 17 70 6 40 72 5 48 59 18 1 48 91 17 41 11 27 53 95 87 31 62 94 94 60 38 99 70 50 81 86 44", "output": "1" }, { "input": "35 4\n100 100 100 100", "output": "0" }, { "input": "68 12\n100 100 100 99 99 100 100 100 99 99 99 99", "output": "0" }, { "input": "91 33\n97 100 96 96 97 100 97 97 96 96 99 99 98 97 97 99 99 98 100 96 96 99 100 96 97 100 97 97 99 98 96 98 97", "output": "0" }, { "input": "59 72\n99 96 96 93 94 97 93 96 100 99 93 99 96 92 92 97 93 100 92 100 91 96 99 100 97 98 93 93 96 100 97 99 100 100 91 93 96 91 93 100 95 96 92 97 91 91 99 100 91 95 95 100 92 93 98 93 95 92 95 100 91 95 99 95 92 91 100 93 98 98 96 99", "output": "1" }, { "input": "9 35\n95 54 78 94 56 63 68 73 61 85 73 62 61 94 67 91 66 54 89 69 92 60 91 87 63 62 85 70 62 68 97 88 96 55 62", "output": "2" }, { "input": "99 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1" }, { "input": "1 50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "50" } ]
1,692,819,746
2,147,483,647
PyPy 3-64
OK
TESTS
31
77
2,662,400
import sys import math import collections from heapq import heappush, heappop input = sys.stdin.readline ints = lambda: list(map(int, input().split())) m, n = ints() a = ints() def check(x): cnt = 0 f = collections.defaultdict(int) for i in range(n): f[str(a[i])] += 1 for key, val in f.items(): cnt += val//x return cnt >= m l = 1 r = 10 ** 9 while l <=r: mid = (l + r) // 2 if check(mid): l = mid + 1 else: r = mid - 1 print(l - 1)
Title: Planning The Expedition Time Limit: None seconds Memory Limit: None megabytes Problem Description: Natasha is planning an expedition to Mars for $n$ people. One of the important tasks is to provide food for each participant. The warehouse has $m$ daily food packages. Each package has some food type $a_i$. Each participant must eat exactly one food package each day. Due to extreme loads, each participant must eat the same food type throughout the expedition. Different participants may eat different (or the same) types of food. Formally, for each participant $j$ Natasha should select his food type $b_j$ and each day $j$-th participant will eat one food package of type $b_j$. The values $b_j$ for different participants may be different. What is the maximum possible number of days the expedition can last, following the requirements above? Input Specification: The first line contains two integers $n$ and $m$ ($1 \le n \le 100$, $1 \le m \le 100$) — the number of the expedition participants and the number of the daily food packages available. The second line contains sequence of integers $a_1, a_2, \dots, a_m$ ($1 \le a_i \le 100$), where $a_i$ is the type of $i$-th food package. Output Specification: Print the single integer — the number of days the expedition can last. If it is not possible to plan the expedition for even one day, print 0. Demo Input: ['4 10\n1 5 2 1 1 1 2 5 7 2\n', '100 1\n1\n', '2 5\n5 4 3 2 1\n', '3 9\n42 42 42 42 42 42 42 42 42\n'] Demo Output: ['2\n', '0\n', '1\n', '3\n'] Note: In the first example, Natasha can assign type $1$ food to the first participant, the same type $1$ to the second, type $5$ to the third and type $2$ to the fourth. In this case, the expedition can last for $2$ days, since each participant can get two food packages of his food type (there will be used $4$ packages of type $1$, two packages of type $2$ and two packages of type $5$). In the second example, there are $100$ participants and only $1$ food package. In this case, the expedition can't last even $1$ day.
```python import sys import math import collections from heapq import heappush, heappop input = sys.stdin.readline ints = lambda: list(map(int, input().split())) m, n = ints() a = ints() def check(x): cnt = 0 f = collections.defaultdict(int) for i in range(n): f[str(a[i])] += 1 for key, val in f.items(): cnt += val//x return cnt >= m l = 1 r = 10 ** 9 while l <=r: mid = (l + r) // 2 if check(mid): l = mid + 1 else: r = mid - 1 print(l - 1) ```
3
572
A
Arrays
PROGRAMMING
900
[ "sortings" ]
null
null
You are given two arrays *A* and *B* consisting of integers, sorted in non-decreasing order. Check whether it is possible to choose *k* numbers in array *A* and choose *m* numbers in array *B* so that any number chosen in the first array is strictly less than any number chosen in the second array.
The first line contains two integers *n**A*,<=*n**B* (1<=≤<=*n**A*,<=*n**B*<=≤<=105), separated by a space — the sizes of arrays *A* and *B*, correspondingly. The second line contains two integers *k* and *m* (1<=≤<=*k*<=≤<=*n**A*,<=1<=≤<=*m*<=≤<=*n**B*), separated by a space. The third line contains *n**A* numbers *a*1,<=*a*2,<=... *a**n**A* (<=-<=109<=≤<=*a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n**A*<=≤<=109), separated by spaces — elements of array *A*. The fourth line contains *n**B* integers *b*1,<=*b*2,<=... *b**n**B* (<=-<=109<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**n**B*<=≤<=109), separated by spaces — elements of array *B*.
Print "YES" (without the quotes), if you can choose *k* numbers in array *A* and *m* numbers in array *B* so that any number chosen in array *A* was strictly less than any number chosen in array *B*. Otherwise, print "NO" (without the quotes).
[ "3 3\n2 1\n1 2 3\n3 4 5\n", "3 3\n3 3\n1 2 3\n3 4 5\n", "5 2\n3 1\n1 1 1 1 1\n2 2\n" ]
[ "YES\n", "NO\n", "YES\n" ]
In the first sample test you can, for example, choose numbers 1 and 2 from array *A* and number 3 from array *B* (1 &lt; 3 and 2 &lt; 3). In the second sample test the only way to choose *k* elements in the first array and *m* elements in the second one is to choose all numbers in both arrays, but then not all the numbers chosen in *A* will be less than all the numbers chosen in *B*: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7280148ed5eab0a7d418d4f92b32061243a8ca58.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
500
[ { "input": "3 3\n2 1\n1 2 3\n3 4 5", "output": "YES" }, { "input": "3 3\n3 3\n1 2 3\n3 4 5", "output": "NO" }, { "input": "5 2\n3 1\n1 1 1 1 1\n2 2", "output": "YES" }, { "input": "3 5\n1 1\n5 5 5\n5 5 5 5 5", "output": "NO" }, { "input": "1 1\n1 1\n1\n1", "output": "NO" }, { "input": "3 3\n1 1\n1 2 3\n1 2 3", "output": "YES" }, { "input": "3 3\n1 2\n1 2 3\n1 2 3", "output": "YES" }, { "input": "3 3\n2 2\n1 2 3\n1 2 3", "output": "NO" }, { "input": "10 15\n10 1\n1 1 5 17 22 29 32 36 39 48\n9 10 20 23 26 26 32 32 33 39 43 45 47 49 49", "output": "YES" }, { "input": "10 15\n1 15\n91 91 91 92 92 94 94 95 98 100\n92 92 93 93 93 94 95 96 97 98 98 99 99 100 100", "output": "YES" }, { "input": "15 10\n12 5\n9 25 25 32 32 38 40 41 46 46 48 51 64 64 73\n5 14 30 35 50 52 67 79 89 99", "output": "YES" }, { "input": "15 10\n4 10\n22 32 35 45 45 50 51 55 79 80 83 88 90 92 93\n46 48 52 55 60 60 68 75 80 81", "output": "YES" }, { "input": "20 30\n2 8\n6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 10 10 10 10 10\n1 1 2 2 2 2 2 2 2 3 3 4 5 5 5 5 6 6 6 6 6 6 7 7 7 8 8 9 10 10", "output": "NO" }, { "input": "20 30\n19 29\n1 1 2 2 2 3 4 4 7 7 7 8 8 8 8 8 9 9 9 9\n6 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 10 10 10 10 10", "output": "NO" }, { "input": "1 1\n1 1\n-1000000000\n30", "output": "YES" }, { "input": "3 3\n1 3\n1 3 3\n3 3 3", "output": "YES" }, { "input": "3 3\n1 1\n3 3 3\n2 2 2", "output": "NO" }, { "input": "5 5\n3 3\n1 5 6 7 8\n1 2 5 6 7", "output": "NO" }, { "input": "3 4\n2 2\n5 6 7\n1 2 3 4", "output": "NO" }, { "input": "3 3\n3 3\n1 2 3\n4 5 6", "output": "YES" }, { "input": "5 5\n4 5\n2 2 3 4 5\n5 6 7 8 9", "output": "YES" } ]
1,531,134,946
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
93
0
n_a, n_b = map(int, input().split()) k, l = map(int, input().split()) a_list = list(map(int, input().split())) b_list = list(map(int, input().split())) if (a_list[k-1] < b_list[l-1]): print('YES') else: print('NO')
Title: Arrays Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given two arrays *A* and *B* consisting of integers, sorted in non-decreasing order. Check whether it is possible to choose *k* numbers in array *A* and choose *m* numbers in array *B* so that any number chosen in the first array is strictly less than any number chosen in the second array. Input Specification: The first line contains two integers *n**A*,<=*n**B* (1<=≤<=*n**A*,<=*n**B*<=≤<=105), separated by a space — the sizes of arrays *A* and *B*, correspondingly. The second line contains two integers *k* and *m* (1<=≤<=*k*<=≤<=*n**A*,<=1<=≤<=*m*<=≤<=*n**B*), separated by a space. The third line contains *n**A* numbers *a*1,<=*a*2,<=... *a**n**A* (<=-<=109<=≤<=*a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n**A*<=≤<=109), separated by spaces — elements of array *A*. The fourth line contains *n**B* integers *b*1,<=*b*2,<=... *b**n**B* (<=-<=109<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**n**B*<=≤<=109), separated by spaces — elements of array *B*. Output Specification: Print "YES" (without the quotes), if you can choose *k* numbers in array *A* and *m* numbers in array *B* so that any number chosen in array *A* was strictly less than any number chosen in array *B*. Otherwise, print "NO" (without the quotes). Demo Input: ['3 3\n2 1\n1 2 3\n3 4 5\n', '3 3\n3 3\n1 2 3\n3 4 5\n', '5 2\n3 1\n1 1 1 1 1\n2 2\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n'] Note: In the first sample test you can, for example, choose numbers 1 and 2 from array *A* and number 3 from array *B* (1 &lt; 3 and 2 &lt; 3). In the second sample test the only way to choose *k* elements in the first array and *m* elements in the second one is to choose all numbers in both arrays, but then not all the numbers chosen in *A* will be less than all the numbers chosen in *B*: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7280148ed5eab0a7d418d4f92b32061243a8ca58.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
```python n_a, n_b = map(int, input().split()) k, l = map(int, input().split()) a_list = list(map(int, input().split())) b_list = list(map(int, input().split())) if (a_list[k-1] < b_list[l-1]): print('YES') else: print('NO') ```
0
25
A
IQ test
PROGRAMMING
1,300
[ "brute force" ]
A. IQ test
2
256
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
[ "5\n2 4 7 8 10\n", "4\n1 2 1 1\n" ]
[ "3\n", "2\n" ]
none
0
[ { "input": "5\n2 4 7 8 10", "output": "3" }, { "input": "4\n1 2 1 1", "output": "2" }, { "input": "3\n1 2 2", "output": "1" }, { "input": "3\n100 99 100", "output": "2" }, { "input": "3\n5 3 2", "output": "3" }, { "input": "4\n43 28 1 91", "output": "2" }, { "input": "4\n75 13 94 77", "output": "3" }, { "input": "4\n97 8 27 3", "output": "2" }, { "input": "10\n95 51 12 91 85 3 1 31 25 7", "output": "3" }, { "input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46", "output": "4" }, { "input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36", "output": "26" }, { "input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83", "output": "48" }, { "input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25", "output": "1" }, { "input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46", "output": "25" }, { "input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73", "output": "13" }, { "input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76", "output": "99" }, { "input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14", "output": "1" }, { "input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22", "output": "93" }, { "input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23", "output": "1" }, { "input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98", "output": "1" }, { "input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94", "output": "93" }, { "input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29", "output": "32" }, { "input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47", "output": "26" }, { "input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72", "output": "56" }, { "input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86", "output": "97" }, { "input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42", "output": "79" }, { "input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52", "output": "25" }, { "input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86", "output": "78" }, { "input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68", "output": "70" }, { "input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81", "output": "39" }, { "input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83", "output": "88" }, { "input": "3\n100 100 1", "output": "3" } ]
1,584,481,220
2,147,483,647
Python 3
OK
TESTS
32
280
0
n = int(input()) a = list(map(int, input().split())) count = a[0] % 2 + a[1] % 2 + a[2] % 2 even = True if count <= 1 else False for i in range(n): if even == True and a[i] % 2 != 0: print(i+1) break elif even == False and a[i] % 2 == 0: print(i+1) break
Title: IQ test Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness. Input Specification: The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness. Output Specification: Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order. Demo Input: ['5\n2 4 7 8 10\n', '4\n1 2 1 1\n'] Demo Output: ['3\n', '2\n'] Note: none
```python n = int(input()) a = list(map(int, input().split())) count = a[0] % 2 + a[1] % 2 + a[2] % 2 even = True if count <= 1 else False for i in range(n): if even == True and a[i] % 2 != 0: print(i+1) break elif even == False and a[i] % 2 == 0: print(i+1) break ```
3.93
584
A
Olesya and Rodion
PROGRAMMING
1,000
[ "math" ]
null
null
Olesya loves numbers consisting of *n* digits, and Rodion only likes numbers that are divisible by *t*. Find some number that satisfies both of them. Your task is: given the *n* and *t* print an integer strictly larger than zero consisting of *n* digits that is divisible by *t*. If such number doesn't exist, print <=-<=1.
The single line contains two numbers, *n* and *t* (1<=≤<=*n*<=≤<=100, 2<=≤<=*t*<=≤<=10) — the length of the number and the number it should be divisible by.
Print one such positive number without leading zeroes, — the answer to the problem, or <=-<=1, if such number doesn't exist. If there are multiple possible answers, you are allowed to print any of them.
[ "3 2\n" ]
[ "712" ]
none
500
[ { "input": "3 2", "output": "222" }, { "input": "2 2", "output": "22" }, { "input": "4 3", "output": "3333" }, { "input": "5 3", "output": "33333" }, { "input": "10 7", "output": "7777777777" }, { "input": "2 9", "output": "99" }, { "input": "18 8", "output": "888888888888888888" }, { "input": "1 5", "output": "5" }, { "input": "1 10", "output": "-1" }, { "input": "100 5", "output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "10 2", "output": "2222222222" }, { "input": "18 10", "output": "111111111111111110" }, { "input": "1 9", "output": "9" }, { "input": "7 6", "output": "6666666" }, { "input": "4 4", "output": "4444" }, { "input": "14 7", "output": "77777777777777" }, { "input": "3 8", "output": "888" }, { "input": "1 3", "output": "3" }, { "input": "2 8", "output": "88" }, { "input": "3 8", "output": "888" }, { "input": "4 3", "output": "3333" }, { "input": "5 9", "output": "99999" }, { "input": "4 8", "output": "8888" }, { "input": "3 4", "output": "444" }, { "input": "9 4", "output": "444444444" }, { "input": "8 10", "output": "11111110" }, { "input": "1 6", "output": "6" }, { "input": "20 3", "output": "33333333333333333333" }, { "input": "15 10", "output": "111111111111110" }, { "input": "31 4", "output": "4444444444444444444444444444444" }, { "input": "18 9", "output": "999999999999999999" }, { "input": "72 4", "output": "444444444444444444444444444444444444444444444444444444444444444444444444" }, { "input": "76 8", "output": "8888888888888888888888888888888888888888888888888888888888888888888888888888" }, { "input": "12 5", "output": "555555555555" }, { "input": "54 5", "output": "555555555555555555555555555555555555555555555555555555" }, { "input": "96 10", "output": "111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "15 9", "output": "999999999999999" }, { "input": "100 2", "output": "2222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222" }, { "input": "99 3", "output": "333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333" }, { "input": "98 4", "output": "44444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444" }, { "input": "97 5", "output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "100 6", "output": "6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666" }, { "input": "99 7", "output": "777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" }, { "input": "98 8", "output": "88888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888" }, { "input": "97 9", "output": "9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999" }, { "input": "100 10", "output": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "3 10", "output": "110" }, { "input": "2 4", "output": "44" }, { "input": "2 10", "output": "10" }, { "input": "10 10", "output": "1111111110" }, { "input": "4 10", "output": "1110" }, { "input": "25 10", "output": "1111111111111111111111110" }, { "input": "50 10", "output": "11111111111111111111111111111111111111111111111110" }, { "input": "5 10", "output": "11110" }, { "input": "99 10", "output": "111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "100 10", "output": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "1 2", "output": "2" }, { "input": "20 10", "output": "11111111111111111110" }, { "input": "99 7", "output": "777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" }, { "input": "89 5", "output": "55555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "6 10", "output": "111110" }, { "input": "3 8", "output": "888" }, { "input": "1 9", "output": "9" }, { "input": "1 4", "output": "4" }, { "input": "100 7", "output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" } ]
1,675,704,168
2,147,483,647
Python 3
OK
TESTS
65
46
0
import math x = list(map(int,input().split())) if(x[0] ==1 and x[1] == 10): print(-1) exit() sol = x[1] while(True) : div = math.floor(sol/(math.pow(10,x[0]-1))) if (div < 10 and div > 0): print(sol) exit() sol *= 2 print(-1)
Title: Olesya and Rodion Time Limit: None seconds Memory Limit: None megabytes Problem Description: Olesya loves numbers consisting of *n* digits, and Rodion only likes numbers that are divisible by *t*. Find some number that satisfies both of them. Your task is: given the *n* and *t* print an integer strictly larger than zero consisting of *n* digits that is divisible by *t*. If such number doesn't exist, print <=-<=1. Input Specification: The single line contains two numbers, *n* and *t* (1<=≤<=*n*<=≤<=100, 2<=≤<=*t*<=≤<=10) — the length of the number and the number it should be divisible by. Output Specification: Print one such positive number without leading zeroes, — the answer to the problem, or <=-<=1, if such number doesn't exist. If there are multiple possible answers, you are allowed to print any of them. Demo Input: ['3 2\n'] Demo Output: ['712'] Note: none
```python import math x = list(map(int,input().split())) if(x[0] ==1 and x[1] == 10): print(-1) exit() sol = x[1] while(True) : div = math.floor(sol/(math.pow(10,x[0]-1))) if (div < 10 and div > 0): print(sol) exit() sol *= 2 print(-1) ```
3
620
B
Grandfather Dovlet’s calculator
PROGRAMMING
1,000
[ "implementation" ]
null
null
Once Max found an electronic calculator from his grandfather Dovlet's chest. He noticed that the numbers were written with seven-segment indicators ([https://en.wikipedia.org/wiki/Seven-segment_display](https://en.wikipedia.org/wiki/Seven-segment_display)). Max starts to type all the values from *a* to *b*. After typing each number Max resets the calculator. Find the total number of segments printed on the calculator. For example if *a*<==<=1 and *b*<==<=3 then at first the calculator will print 2 segments, then — 5 segments and at last it will print 5 segments. So the total number of printed segments is 12.
The only line contains two integers *a*,<=*b* (1<=≤<=*a*<=≤<=*b*<=≤<=106) — the first and the last number typed by Max.
Print the only integer *a* — the total number of printed segments.
[ "1 3\n", "10 15\n" ]
[ "12\n", "39\n" ]
none
0
[ { "input": "1 3", "output": "12" }, { "input": "10 15", "output": "39" }, { "input": "1 100", "output": "928" }, { "input": "100 10000", "output": "188446" }, { "input": "213 221442", "output": "5645356" }, { "input": "1 1000000", "output": "28733372" }, { "input": "1000000 1000000", "output": "38" }, { "input": "222145 353252", "output": "3860750" }, { "input": "2 1000000", "output": "28733370" }, { "input": "1 999999", "output": "28733334" }, { "input": "192 200", "output": "122" } ]
1,680,740,190
2,147,483,647
PyPy 3-64
OK
TESTS
11
109
2,150,400
def f(n): s=0 while n>9: s+= mp[n%10] n//=10 s+=mp[n] return s mp = [6,2,5,5,4,5,6,3,7,6] s = 0 a,b = map(int,input().split()) for i in range(a,b+1): s += f(i) print(s)
Title: Grandfather Dovlet’s calculator Time Limit: None seconds Memory Limit: None megabytes Problem Description: Once Max found an electronic calculator from his grandfather Dovlet's chest. He noticed that the numbers were written with seven-segment indicators ([https://en.wikipedia.org/wiki/Seven-segment_display](https://en.wikipedia.org/wiki/Seven-segment_display)). Max starts to type all the values from *a* to *b*. After typing each number Max resets the calculator. Find the total number of segments printed on the calculator. For example if *a*<==<=1 and *b*<==<=3 then at first the calculator will print 2 segments, then — 5 segments and at last it will print 5 segments. So the total number of printed segments is 12. Input Specification: The only line contains two integers *a*,<=*b* (1<=≤<=*a*<=≤<=*b*<=≤<=106) — the first and the last number typed by Max. Output Specification: Print the only integer *a* — the total number of printed segments. Demo Input: ['1 3\n', '10 15\n'] Demo Output: ['12\n', '39\n'] Note: none
```python def f(n): s=0 while n>9: s+= mp[n%10] n//=10 s+=mp[n] return s mp = [6,2,5,5,4,5,6,3,7,6] s = 0 a,b = map(int,input().split()) for i in range(a,b+1): s += f(i) print(s) ```
3
605
B
Lazy Student
PROGRAMMING
1,700
[ "constructive algorithms", "data structures", "graphs" ]
null
null
Student Vladislav came to his programming exam completely unprepared as usual. He got a question about some strange algorithm on a graph — something that will definitely never be useful in real life. He asked a girl sitting next to him to lend him some cheat papers for this questions and found there the following definition: The minimum spanning tree *T* of graph *G* is such a tree that it contains all the vertices of the original graph *G*, and the sum of the weights of its edges is the minimum possible among all such trees. Vladislav drew a graph with *n* vertices and *m* edges containing no loops and multiple edges. He found one of its minimum spanning trees and then wrote for each edge its weight and whether it is included in the found tree or not. Unfortunately, the piece of paper where the graph was painted is gone and the teacher is getting very angry and demands to see the original graph. Help Vladislav come up with a graph so that the information about the minimum spanning tree remains correct.
The first line of the input contains two integers *n* and *m* () — the number of vertices and the number of edges in the graph. Each of the next *m* lines describes an edge of the graph and consists of two integers *a**j* and *b**j* (1<=≤<=*a**j*<=≤<=109,<=*b**j*<==<={0,<=1}). The first of these numbers is the weight of the edge and the second number is equal to 1 if this edge was included in the minimum spanning tree found by Vladislav, or 0 if it was not. It is guaranteed that exactly *n*<=-<=1 number {*b**j*} are equal to one and exactly *m*<=-<=*n*<=+<=1 of them are equal to zero.
If Vladislav has made a mistake and such graph doesn't exist, print <=-<=1. Otherwise print *m* lines. On the *j*-th line print a pair of vertices (*u**j*,<=*v**j*) (1<=≤<=*u**j*,<=*v**j*<=≤<=*n*,<=*u**j*<=≠<=*v**j*), that should be connected by the *j*-th edge. The edges are numbered in the same order as in the input. The graph, determined by these edges, must be connected, contain no loops or multiple edges and its edges with *b**j*<==<=1 must define the minimum spanning tree. In case there are multiple possible solutions, print any of them.
[ "4 5\n2 1\n3 1\n4 0\n1 1\n5 0\n", "3 3\n1 0\n2 1\n3 1\n" ]
[ "2 4\n1 4\n3 4\n3 1\n3 2\n", "-1\n" ]
none
1,000
[ { "input": "4 5\n2 1\n3 1\n4 0\n1 1\n5 0", "output": "2 4\n1 4\n3 4\n3 1\n3 2" }, { "input": "3 3\n1 0\n2 1\n3 1", "output": "-1" }, { "input": "2 1\n7 1", "output": "1 2" }, { "input": "3 2\n8 1\n9 1", "output": "1 2\n1 3" }, { "input": "3 3\n4 1\n5 0\n7 1", "output": "-1" }, { "input": "3 3\n4 1\n5 1\n7 0", "output": "1 2\n1 3\n2 3" }, { "input": "3 3\n4 1\n4 0\n4 1", "output": "1 2\n2 3\n1 3" }, { "input": "3 3\n4 0\n5 1\n4 1", "output": "-1" }, { "input": "3 3\n5 0\n4 1\n5 1", "output": "2 3\n1 2\n1 3" }, { "input": "4 4\n2 1\n3 0\n3 1\n4 1", "output": "1 2\n2 3\n1 3\n1 4" }, { "input": "4 5\n4 1\n4 1\n4 0\n4 0\n6 1", "output": "-1" }, { "input": "4 6\n2 1\n4 0\n3 0\n1 1\n4 1\n5 0", "output": "1 3\n2 4\n2 3\n1 2\n1 4\n3 4" }, { "input": "4 4\n2 1\n6 0\n7 1\n7 1", "output": "-1" }, { "input": "4 4\n2 1\n8 0\n8 1\n8 1", "output": "1 2\n2 3\n1 3\n1 4" }, { "input": "4 4\n2 0\n2 1\n8 1\n2 1", "output": "2 3\n1 2\n1 4\n1 3" }, { "input": "4 4\n2 1\n3 1\n1 1\n4 0", "output": "1 3\n1 4\n1 2\n2 3" }, { "input": "4 5\n3 1\n4 1\n4 0\n6 0\n6 1", "output": "1 2\n1 3\n2 3\n2 4\n1 4" }, { "input": "4 5\n7 0\n3 0\n1 1\n5 1\n7 1", "output": "-1" }, { "input": "4 6\n2 1\n7 1\n3 0\n1 1\n7 0\n6 0", "output": "-1" }, { "input": "4 6\n1 1\n3 1\n2 0\n2 1\n3 0\n3 0", "output": "1 2\n1 4\n2 3\n1 3\n2 4\n3 4" }, { "input": "4 6\n1 1\n4 1\n2 0\n2 1\n4 0\n3 0", "output": "-1" }, { "input": "10 15\n900000012 1\n900000010 1\n900000007 0\n900000005 0\n900000014 1\n900000000 1\n900000004 0\n900000006 1\n900000009 0\n900000002 0\n900000008 0\n900000001 1\n900000011 1\n900000003 1\n900000013 1", "output": "1 8\n1 6\n2 5\n3 4\n1 10\n1 2\n2 4\n1 5\n4 5\n2 3\n3 5\n1 3\n1 7\n1 4\n1 9" }, { "input": "10 15\n900000007 1\n900000002 1\n900000004 0\n900000002 1\n900000006 1\n900000000 1\n900000006 1\n900000008 1\n900000002 0\n900000003 0\n900000002 0\n900000005 0\n900000001 0\n900000000 1\n900000008 1", "output": "1 8\n1 4\n3 5\n1 5\n1 6\n1 2\n1 7\n1 9\n2 4\n2 5\n3 4\n4 5\n2 3\n1 3\n1 10" }, { "input": "10 15\n900000004 0\n900000006 1\n900000001 1\n900000004 1\n900000007 1\n900000007 1\n900000004 1\n900000008 1\n900000004 0\n900000004 0\n900000007 1\n900000005 0\n900000004 0\n900000002 0\n900000000 1", "output": "2 4\n1 6\n1 3\n1 4\n1 7\n1 8\n1 5\n1 10\n3 4\n2 5\n1 9\n4 5\n3 5\n2 3\n1 2" }, { "input": "10 15\n900000006 1\n900000000 1\n900000004 0\n900000000 1\n900000004 0\n900000006 1\n900000000 1\n900000006 1\n900000005 1\n900000001 0\n900000003 1\n900000006 1\n900000000 0\n900000003 0\n900000000 0", "output": "1 7\n1 2\n3 5\n1 3\n4 5\n1 8\n1 4\n1 9\n1 6\n3 4\n1 5\n1 10\n2 3\n2 5\n2 4" }, { "input": "10 15\n900000000 1\n900000003 1\n900000000 1\n900000000 0\n900000003 0\n900000005 1\n900000005 1\n900000005 1\n900000001 0\n900000002 0\n900000002 0\n900000004 1\n900000002 0\n900000000 1\n900000004 1", "output": "-1" }, { "input": "10 15\n900000001 1\n900000001 1\n900000002 1\n900000001 1\n900000001 0\n900000001 1\n900000001 0\n900000001 0\n900000001 0\n900000001 1\n900000001 0\n900000001 0\n900000004 1\n900000000 1\n900000001 1", "output": "1 3\n1 4\n1 9\n1 5\n2 3\n1 6\n2 4\n3 4\n2 5\n1 7\n3 5\n4 5\n1 10\n1 2\n1 8" }, { "input": "10 15\n900000001 1\n900000001 1\n900000001 0\n900000000 1\n900000001 0\n900000002 1\n900000000 1\n900000002 1\n900000001 0\n900000001 0\n900000001 0\n900000002 1\n900000000 0\n900000002 1\n900000000 1", "output": "1 5\n1 6\n2 4\n1 2\n3 4\n1 7\n1 3\n1 8\n2 5\n3 5\n4 5\n1 9\n2 3\n1 10\n1 4" }, { "input": "5 5\n1 1\n2 1\n3 0\n4 1\n5 1", "output": "1 2\n1 3\n2 3\n1 4\n1 5" }, { "input": "5 6\n1 1\n2 1\n3 0\n4 1\n5 0\n6 1", "output": "1 2\n1 3\n2 3\n1 4\n2 4\n1 5" }, { "input": "5 6\n1 1\n2 1\n3 0\n4 0\n5 1\n6 1", "output": "-1" }, { "input": "5 7\n1 1\n1 1\n1 0\n2 0\n1 0\n2 1\n2 1", "output": "-1" }, { "input": "5 8\n1 0\n1 1\n1 1\n2 0\n1 0\n2 1\n1 0\n1 1", "output": "2 3\n1 2\n1 3\n2 5\n2 4\n1 5\n3 4\n1 4" }, { "input": "5 8\n1 0\n1 1\n1 1\n3 0\n1 0\n3 1\n2 0\n1 1", "output": "2 3\n1 2\n1 3\n2 5\n2 4\n1 5\n3 4\n1 4" }, { "input": "5 8\n1 0\n1 1\n1 1\n3 0\n1 0\n4 1\n2 0\n1 1", "output": "-1" }, { "input": "5 9\n1 1\n2 1\n3 0\n4 1\n5 0\n6 0\n7 1\n8 0\n9 0", "output": "1 2\n1 3\n2 3\n1 4\n2 4\n3 4\n1 5\n2 5\n3 5" }, { "input": "5 9\n1 1\n2 1\n3 0\n4 1\n5 0\n6 0\n7 0\n8 1\n9 0", "output": "-1" }, { "input": "5 10\n1 1\n1 1\n1 0\n1 1\n2 0\n2 0\n2 1\n2 0\n2 0\n2 0", "output": "1 2\n1 3\n2 3\n1 4\n2 4\n3 4\n1 5\n2 5\n3 5\n4 5" }, { "input": "5 10\n1 1\n1 1\n1 0\n1 1\n2 0\n2 0\n3 1\n2 0\n3 0\n3 0", "output": "-1" }, { "input": "10 15\n761759620 0\n761759620 1\n787655728 1\n761759620 0\n294001884 1\n465325912 1\n787655728 0\n683571303 1\n683571303 0\n761759620 0\n787655728 0\n391499930 1\n758807870 1\n611782565 1\n132266542 1", "output": "2 4\n1 9\n1 10\n3 4\n1 3\n1 5\n3 5\n1 7\n2 3\n2 5\n4 5\n1 4\n1 8\n1 6\n1 2" }, { "input": "10 15\n752087443 1\n537185872 1\n439895449 1\n494086747 1\n718088132 1\n93444012 0\n670136349 1\n545547453 0\n718088132 0\n853059674 0\n853059674 1\n762928724 1\n762928724 0\n853059674 0\n156495293 1", "output": "-1" }, { "input": "10 15\n417559883 0\n300974070 1\n292808458 1\n469395226 0\n469395226 1\n564721882 1\n125636288 1\n417559883 0\n417559883 1\n469395226 0\n376390930 1\n233782394 1\n780369860 1\n564721882 0\n417559883 0", "output": "2 3\n1 5\n1 4\n2 5\n1 8\n1 9\n1 2\n2 4\n1 7\n3 5\n1 6\n1 3\n1 10\n4 5\n3 4" } ]
1,550,439,674
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
4
109
307,200
g = input().split(" ") Namount = int(g[0]) Eamount = int(g[1]) Array = [] Pointer1 = 1 # Pointer1 keeps the number of points currently active Pointer2 = 1 # Pointer2 keeps the smallest number for which we can add more edges (Location in Namount) NArray = [Pointer1] LArray = [] for j in range(Eamount): g = input().split(" ") if(int(g[1]) == 1): LArray.append(j) Array.append([int(g[0]),int(g[1])]) Array.sort(key=lambda x: (x[0], -x[1])) def Program(): if(Array[0][1] == 0): return False global Pointer2, Pointer1 for x in range(Eamount): if(Array[x][1] == 1): Pointer2 = 1 Pointer1 += 1 NArray.append(Pointer1) NArray[0] += 1 else: if(Pointer2 >= Pointer1): return False elif NArray[Pointer2] < Pointer1: NArray[Pointer2] += 1 else: Pointer2 += 1 if(Program() != False): g = 0 Pointer1 = 1 Pointer2 = 3 b = len(LArray) for x in range(Eamount): if(g<b): if x == LArray[g]: g += 1 print(1,g+1) else: print(Pointer1+1,Pointer2) Pointer2 += 1 if Pointer2>NArray[Pointer1]: Pointer1+=1 Pointer2 = Pointer1+2 else: print(Pointer1+1,Pointer2) Pointer2 += 1 if Pointer2>NArray[Pointer1]: Pointer1+=1 Pointer2 = Pointer1+2 else: print(-1)
Title: Lazy Student Time Limit: None seconds Memory Limit: None megabytes Problem Description: Student Vladislav came to his programming exam completely unprepared as usual. He got a question about some strange algorithm on a graph — something that will definitely never be useful in real life. He asked a girl sitting next to him to lend him some cheat papers for this questions and found there the following definition: The minimum spanning tree *T* of graph *G* is such a tree that it contains all the vertices of the original graph *G*, and the sum of the weights of its edges is the minimum possible among all such trees. Vladislav drew a graph with *n* vertices and *m* edges containing no loops and multiple edges. He found one of its minimum spanning trees and then wrote for each edge its weight and whether it is included in the found tree or not. Unfortunately, the piece of paper where the graph was painted is gone and the teacher is getting very angry and demands to see the original graph. Help Vladislav come up with a graph so that the information about the minimum spanning tree remains correct. Input Specification: The first line of the input contains two integers *n* and *m* () — the number of vertices and the number of edges in the graph. Each of the next *m* lines describes an edge of the graph and consists of two integers *a**j* and *b**j* (1<=≤<=*a**j*<=≤<=109,<=*b**j*<==<={0,<=1}). The first of these numbers is the weight of the edge and the second number is equal to 1 if this edge was included in the minimum spanning tree found by Vladislav, or 0 if it was not. It is guaranteed that exactly *n*<=-<=1 number {*b**j*} are equal to one and exactly *m*<=-<=*n*<=+<=1 of them are equal to zero. Output Specification: If Vladislav has made a mistake and such graph doesn't exist, print <=-<=1. Otherwise print *m* lines. On the *j*-th line print a pair of vertices (*u**j*,<=*v**j*) (1<=≤<=*u**j*,<=*v**j*<=≤<=*n*,<=*u**j*<=≠<=*v**j*), that should be connected by the *j*-th edge. The edges are numbered in the same order as in the input. The graph, determined by these edges, must be connected, contain no loops or multiple edges and its edges with *b**j*<==<=1 must define the minimum spanning tree. In case there are multiple possible solutions, print any of them. Demo Input: ['4 5\n2 1\n3 1\n4 0\n1 1\n5 0\n', '3 3\n1 0\n2 1\n3 1\n'] Demo Output: ['2 4\n1 4\n3 4\n3 1\n3 2\n', '-1\n'] Note: none
```python g = input().split(" ") Namount = int(g[0]) Eamount = int(g[1]) Array = [] Pointer1 = 1 # Pointer1 keeps the number of points currently active Pointer2 = 1 # Pointer2 keeps the smallest number for which we can add more edges (Location in Namount) NArray = [Pointer1] LArray = [] for j in range(Eamount): g = input().split(" ") if(int(g[1]) == 1): LArray.append(j) Array.append([int(g[0]),int(g[1])]) Array.sort(key=lambda x: (x[0], -x[1])) def Program(): if(Array[0][1] == 0): return False global Pointer2, Pointer1 for x in range(Eamount): if(Array[x][1] == 1): Pointer2 = 1 Pointer1 += 1 NArray.append(Pointer1) NArray[0] += 1 else: if(Pointer2 >= Pointer1): return False elif NArray[Pointer2] < Pointer1: NArray[Pointer2] += 1 else: Pointer2 += 1 if(Program() != False): g = 0 Pointer1 = 1 Pointer2 = 3 b = len(LArray) for x in range(Eamount): if(g<b): if x == LArray[g]: g += 1 print(1,g+1) else: print(Pointer1+1,Pointer2) Pointer2 += 1 if Pointer2>NArray[Pointer1]: Pointer1+=1 Pointer2 = Pointer1+2 else: print(Pointer1+1,Pointer2) Pointer2 += 1 if Pointer2>NArray[Pointer1]: Pointer1+=1 Pointer2 = Pointer1+2 else: print(-1) ```
0
408
A
Line to Cashier
PROGRAMMING
900
[ "implementation" ]
null
null
Little Vasya went to the supermarket to get some groceries. He walked about the supermarket for a long time and got a basket full of products. Now he needs to choose the cashier to pay for the products. There are *n* cashiers at the exit from the supermarket. At the moment the queue for the *i*-th cashier already has *k**i* people. The *j*-th person standing in the queue to the *i*-th cashier has *m**i*,<=*j* items in the basket. Vasya knows that: - the cashier needs 5 seconds to scan one item; - after the cashier scans each item of some customer, he needs 15 seconds to take the customer's money and give him the change. Of course, Vasya wants to select a queue so that he can leave the supermarket as soon as possible. Help him write a program that displays the minimum number of seconds after which Vasya can get to one of the cashiers.
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of cashes in the shop. The second line contains *n* space-separated integers: *k*1,<=*k*2,<=...,<=*k**n* (1<=≤<=*k**i*<=≤<=100), where *k**i* is the number of people in the queue to the *i*-th cashier. The *i*-th of the next *n* lines contains *k**i* space-separated integers: *m**i*,<=1,<=*m**i*,<=2,<=...,<=*m**i*,<=*k**i* (1<=≤<=*m**i*,<=*j*<=≤<=100) — the number of products the *j*-th person in the queue for the *i*-th cash has.
Print a single integer — the minimum number of seconds Vasya needs to get to the cashier.
[ "1\n1\n1\n", "4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8\n" ]
[ "20\n", "100\n" ]
In the second test sample, if Vasya goes to the first queue, he gets to the cashier in 100·5 + 15 = 515 seconds. But if he chooses the second queue, he will need 1·5 + 2·5 + 2·5 + 3·5 + 4·15 = 100 seconds. He will need 1·5 + 9·5 + 1·5 + 3·15 = 100 seconds for the third one and 7·5 + 8·5 + 2·15 = 105 seconds for the fourth one. Thus, Vasya gets to the cashier quicker if he chooses the second or the third queue.
500
[ { "input": "1\n1\n1", "output": "20" }, { "input": "4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8", "output": "100" }, { "input": "4\n5 4 5 5\n3 1 3 1 2\n3 1 1 3\n1 1 1 2 2\n2 2 1 1 3", "output": "100" }, { "input": "5\n5 3 6 6 4\n7 5 3 3 9\n6 8 2\n1 10 8 5 9 2\n9 7 8 5 9 10\n9 8 3 3", "output": "125" }, { "input": "5\n10 10 10 10 10\n6 7 8 6 8 5 9 8 10 5\n9 6 9 8 7 8 8 10 8 5\n8 7 7 8 7 5 6 8 9 5\n6 5 10 5 5 10 7 8 5 5\n10 9 8 7 6 9 7 9 6 5", "output": "480" }, { "input": "10\n9 10 10 10 9 5 9 7 8 7\n11 6 10 4 4 15 7 15 5\n3 9 11 12 11 1 13 13 1 5\n6 15 9 12 3 2 8 12 11 10\n7 1 1 6 10 2 6 1 14 2\n8 14 2 3 6 1 14 1 12\n6 10 9 3 5\n13 12 12 7 13 4 4 8 10\n5 6 4 3 14 9 13\n8 12 1 5 7 4 13 1\n1 9 5 3 5 1 4", "output": "240" }, { "input": "10\n5 5 5 5 5 5 5 5 5 5\n5 5 4 5 4\n6 5 7 7 6\n5 4 4 5 5\n4 4 5 5 5\n7 6 4 5 7\n4 6 5 4 5\n6 6 7 6 6\n4 5 4 4 7\n7 5 4 4 5\n6 6 7 4 4", "output": "190" }, { "input": "1\n1\n100", "output": "515" }, { "input": "1\n90\n90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90", "output": "41850" } ]
1,607,162,817
2,147,483,647
PyPy 3
OK
TESTS
20
139
1,536,000
n = int(input()) k = list(map(int,input().split())) ans = [] for i in range(n): p = list(map(int,input().split())) q = sum(p)*5 + k[i]*15 ans.append(q) print(min(ans))
Title: Line to Cashier Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Vasya went to the supermarket to get some groceries. He walked about the supermarket for a long time and got a basket full of products. Now he needs to choose the cashier to pay for the products. There are *n* cashiers at the exit from the supermarket. At the moment the queue for the *i*-th cashier already has *k**i* people. The *j*-th person standing in the queue to the *i*-th cashier has *m**i*,<=*j* items in the basket. Vasya knows that: - the cashier needs 5 seconds to scan one item; - after the cashier scans each item of some customer, he needs 15 seconds to take the customer's money and give him the change. Of course, Vasya wants to select a queue so that he can leave the supermarket as soon as possible. Help him write a program that displays the minimum number of seconds after which Vasya can get to one of the cashiers. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of cashes in the shop. The second line contains *n* space-separated integers: *k*1,<=*k*2,<=...,<=*k**n* (1<=≤<=*k**i*<=≤<=100), where *k**i* is the number of people in the queue to the *i*-th cashier. The *i*-th of the next *n* lines contains *k**i* space-separated integers: *m**i*,<=1,<=*m**i*,<=2,<=...,<=*m**i*,<=*k**i* (1<=≤<=*m**i*,<=*j*<=≤<=100) — the number of products the *j*-th person in the queue for the *i*-th cash has. Output Specification: Print a single integer — the minimum number of seconds Vasya needs to get to the cashier. Demo Input: ['1\n1\n1\n', '4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8\n'] Demo Output: ['20\n', '100\n'] Note: In the second test sample, if Vasya goes to the first queue, he gets to the cashier in 100·5 + 15 = 515 seconds. But if he chooses the second queue, he will need 1·5 + 2·5 + 2·5 + 3·5 + 4·15 = 100 seconds. He will need 1·5 + 9·5 + 1·5 + 3·15 = 100 seconds for the third one and 7·5 + 8·5 + 2·15 = 105 seconds for the fourth one. Thus, Vasya gets to the cashier quicker if he chooses the second or the third queue.
```python n = int(input()) k = list(map(int,input().split())) ans = [] for i in range(n): p = list(map(int,input().split())) q = sum(p)*5 + k[i]*15 ans.append(q) print(min(ans)) ```
3
785
A
Anton and Polyhedrons
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons: - Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces. All five kinds of polyhedrons are shown on the picture below: Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number!
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of polyhedrons in Anton's collection. Each of the following *n* lines of the input contains a string *s**i* — the name of the *i*-th polyhedron in Anton's collection. The string can look like this: - "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron.
Output one number — the total number of faces in all the polyhedrons in Anton's collection.
[ "4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n", "3\nDodecahedron\nOctahedron\nOctahedron\n" ]
[ "42\n", "28\n" ]
In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces.
500
[ { "input": "4\nIcosahedron\nCube\nTetrahedron\nDodecahedron", "output": "42" }, { "input": "3\nDodecahedron\nOctahedron\nOctahedron", "output": "28" }, { "input": "25\nIcosahedron\nOctahedron\nTetrahedron\nDodecahedron\nCube\nIcosahedron\nOctahedron\nCube\nTetrahedron\nIcosahedron\nIcosahedron\nTetrahedron\nOctahedron\nDodecahedron\nIcosahedron\nOctahedron\nIcosahedron\nTetrahedron\nDodecahedron\nTetrahedron\nOctahedron\nCube\nCube\nDodecahedron\nTetrahedron", "output": "256" }, { "input": "1\nTetrahedron", "output": "4" }, { "input": "1\nCube", "output": "6" }, { "input": "1\nOctahedron", "output": "8" }, { "input": "1\nDodecahedron", "output": "12" }, { "input": "1\nIcosahedron", "output": "20" }, { "input": "28\nOctahedron\nDodecahedron\nOctahedron\nOctahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nDodecahedron\nDodecahedron\nCube\nDodecahedron\nCube\nTetrahedron\nCube\nCube\nTetrahedron\nDodecahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nIcosahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron", "output": "340" } ]
1,697,494,363
2,147,483,647
Python 3
OK
TESTS
30
264
16,076,800
n = int(input()) Tetrahedron = 4 Cube = 6 Octahedron =8 Dodecahedron = 12 Icosahedron = 20 face = 0 ls = [] for i in range(n): x = input() ls.append(x) for i in ls: if i == "Tetrahedron": face += Tetrahedron elif i == "Cube": face += Cube elif i == "Octahedron": face += Octahedron elif i == "Dodecahedron": face += Dodecahedron else: face += Icosahedron print(face)
Title: Anton and Polyhedrons Time Limit: None seconds Memory Limit: None megabytes Problem Description: Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons: - Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces. All five kinds of polyhedrons are shown on the picture below: Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number! Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of polyhedrons in Anton's collection. Each of the following *n* lines of the input contains a string *s**i* — the name of the *i*-th polyhedron in Anton's collection. The string can look like this: - "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron. Output Specification: Output one number — the total number of faces in all the polyhedrons in Anton's collection. Demo Input: ['4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n', '3\nDodecahedron\nOctahedron\nOctahedron\n'] Demo Output: ['42\n', '28\n'] Note: In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces.
```python n = int(input()) Tetrahedron = 4 Cube = 6 Octahedron =8 Dodecahedron = 12 Icosahedron = 20 face = 0 ls = [] for i in range(n): x = input() ls.append(x) for i in ls: if i == "Tetrahedron": face += Tetrahedron elif i == "Cube": face += Cube elif i == "Octahedron": face += Octahedron elif i == "Dodecahedron": face += Dodecahedron else: face += Icosahedron print(face) ```
3
217
A
Ice Skating
PROGRAMMING
1,200
[ "brute force", "dfs and similar", "dsu", "graphs" ]
null
null
Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created. We assume that Bajtek can only heap up snow drifts at integer coordinates.
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift. Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct.
Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one.
[ "2\n2 1\n1 2\n", "2\n2 1\n4 1\n" ]
[ "1\n", "0\n" ]
none
500
[ { "input": "2\n2 1\n1 2", "output": "1" }, { "input": "2\n2 1\n4 1", "output": "0" }, { "input": "24\n171 35\n261 20\n4 206\n501 446\n961 912\n581 748\n946 978\n463 514\n841 889\n341 466\n842 967\n54 102\n235 261\n925 889\n682 672\n623 636\n268 94\n635 710\n474 510\n697 794\n586 663\n182 184\n806 663\n468 459", "output": "21" }, { "input": "17\n660 646\n440 442\n689 618\n441 415\n922 865\n950 972\n312 366\n203 229\n873 860\n219 199\n344 308\n169 176\n961 992\n153 84\n201 230\n987 938\n834 815", "output": "16" }, { "input": "11\n798 845\n722 911\n374 270\n629 537\n748 856\n831 885\n486 641\n751 829\n609 492\n98 27\n654 663", "output": "10" }, { "input": "1\n321 88", "output": "0" }, { "input": "9\n811 859\n656 676\n76 141\n945 951\n497 455\n18 55\n335 294\n267 275\n656 689", "output": "7" }, { "input": "7\n948 946\n130 130\n761 758\n941 938\n971 971\n387 385\n509 510", "output": "6" }, { "input": "6\n535 699\n217 337\n508 780\n180 292\n393 112\n732 888", "output": "5" }, { "input": "14\n25 23\n499 406\n193 266\n823 751\n219 227\n101 138\n978 992\n43 74\n997 932\n237 189\n634 538\n774 740\n842 767\n742 802", "output": "13" }, { "input": "12\n548 506\n151 198\n370 380\n655 694\n654 690\n407 370\n518 497\n819 827\n765 751\n802 771\n741 752\n653 662", "output": "11" }, { "input": "40\n685 711\n433 403\n703 710\n491 485\n616 619\n288 282\n884 871\n367 352\n500 511\n977 982\n51 31\n576 564\n508 519\n755 762\n22 20\n368 353\n232 225\n953 955\n452 436\n311 330\n967 988\n369 364\n791 803\n150 149\n651 661\n118 93\n398 387\n748 766\n852 852\n230 228\n555 545\n515 519\n667 678\n867 862\n134 146\n859 863\n96 99\n486 469\n303 296\n780 786", "output": "38" }, { "input": "3\n175 201\n907 909\n388 360", "output": "2" }, { "input": "7\n312 298\n86 78\n73 97\n619 594\n403 451\n538 528\n71 86", "output": "6" }, { "input": "19\n802 820\n368 248\n758 794\n455 378\n876 888\n771 814\n245 177\n586 555\n844 842\n364 360\n820 856\n731 624\n982 975\n825 856\n122 121\n862 896\n42 4\n792 841\n828 820", "output": "16" }, { "input": "32\n643 877\n842 614\n387 176\n99 338\n894 798\n652 728\n611 648\n622 694\n579 781\n243 46\n322 305\n198 438\n708 579\n246 325\n536 459\n874 593\n120 277\n989 907\n223 110\n35 130\n761 692\n690 661\n518 766\n226 93\n678 597\n725 617\n661 574\n775 496\n56 416\n14 189\n358 359\n898 901", "output": "31" }, { "input": "32\n325 327\n20 22\n72 74\n935 933\n664 663\n726 729\n785 784\n170 171\n315 314\n577 580\n984 987\n313 317\n434 435\n962 961\n55 54\n46 44\n743 742\n434 433\n617 612\n332 332\n883 886\n940 936\n793 792\n645 644\n611 607\n418 418\n465 465\n219 218\n167 164\n56 54\n403 405\n210 210", "output": "29" }, { "input": "32\n652 712\n260 241\n27 154\n188 16\n521 351\n518 356\n452 540\n790 827\n339 396\n336 551\n897 930\n828 627\n27 168\n180 113\n134 67\n794 671\n812 711\n100 241\n686 813\n138 289\n384 506\n884 932\n913 959\n470 508\n730 734\n373 478\n788 862\n392 426\n148 68\n113 49\n713 852\n924 894", "output": "29" }, { "input": "14\n685 808\n542 677\n712 747\n832 852\n187 410\n399 338\n626 556\n530 635\n267 145\n215 209\n559 684\n944 949\n753 596\n601 823", "output": "13" }, { "input": "5\n175 158\n16 2\n397 381\n668 686\n957 945", "output": "4" }, { "input": "5\n312 284\n490 509\n730 747\n504 497\n782 793", "output": "4" }, { "input": "2\n802 903\n476 348", "output": "1" }, { "input": "4\n325 343\n425 442\n785 798\n275 270", "output": "3" }, { "input": "28\n462 483\n411 401\n118 94\n111 127\n5 6\n70 52\n893 910\n73 63\n818 818\n182 201\n642 633\n900 886\n893 886\n684 700\n157 173\n953 953\n671 660\n224 225\n832 801\n152 157\n601 585\n115 101\n739 722\n611 606\n659 642\n461 469\n702 689\n649 653", "output": "25" }, { "input": "36\n952 981\n885 900\n803 790\n107 129\n670 654\n143 132\n66 58\n813 819\n849 837\n165 198\n247 228\n15 39\n619 618\n105 138\n868 855\n965 957\n293 298\n613 599\n227 212\n745 754\n723 704\n877 858\n503 487\n678 697\n592 595\n155 135\n962 982\n93 89\n660 673\n225 212\n967 987\n690 680\n804 813\n489 518\n240 221\n111 124", "output": "34" }, { "input": "30\n89 3\n167 156\n784 849\n943 937\n144 95\n24 159\n80 120\n657 683\n585 596\n43 147\n909 964\n131 84\n345 389\n333 321\n91 126\n274 325\n859 723\n866 922\n622 595\n690 752\n902 944\n127 170\n426 383\n905 925\n172 284\n793 810\n414 510\n890 884\n123 24\n267 255", "output": "29" }, { "input": "5\n664 666\n951 941\n739 742\n844 842\n2 2", "output": "4" }, { "input": "3\n939 867\n411 427\n757 708", "output": "2" }, { "input": "36\n429 424\n885 972\n442 386\n512 511\n751 759\n4 115\n461 497\n496 408\n8 23\n542 562\n296 331\n448 492\n412 395\n109 166\n622 640\n379 355\n251 262\n564 586\n66 115\n275 291\n666 611\n629 534\n510 567\n635 666\n738 803\n420 369\n92 17\n101 144\n141 92\n258 258\n184 235\n492 456\n311 210\n394 357\n531 512\n634 636", "output": "34" }, { "input": "29\n462 519\n871 825\n127 335\n156 93\n576 612\n885 830\n634 779\n340 105\n744 795\n716 474\n93 139\n563 805\n137 276\n177 101\n333 14\n391 437\n873 588\n817 518\n460 597\n572 670\n140 303\n392 441\n273 120\n862 578\n670 639\n410 161\n544 577\n193 116\n252 195", "output": "28" }, { "input": "23\n952 907\n345 356\n812 807\n344 328\n242 268\n254 280\n1000 990\n80 78\n424 396\n595 608\n755 813\n383 380\n55 56\n598 633\n203 211\n508 476\n600 593\n206 192\n855 882\n517 462\n967 994\n642 657\n493 488", "output": "22" }, { "input": "10\n579 816\n806 590\n830 787\n120 278\n677 800\n16 67\n188 251\n559 560\n87 67\n104 235", "output": "8" }, { "input": "23\n420 424\n280 303\n515 511\n956 948\n799 803\n441 455\n362 369\n299 289\n823 813\n982 967\n876 878\n185 157\n529 551\n964 989\n655 656\n1 21\n114 112\n45 56\n935 937\n1000 997\n934 942\n360 366\n648 621", "output": "22" }, { "input": "23\n102 84\n562 608\n200 127\n952 999\n465 496\n322 367\n728 690\n143 147\n855 867\n861 866\n26 59\n300 273\n255 351\n192 246\n70 111\n365 277\n32 104\n298 319\n330 354\n241 141\n56 125\n315 298\n412 461", "output": "22" }, { "input": "7\n429 506\n346 307\n99 171\n853 916\n322 263\n115 157\n906 924", "output": "6" }, { "input": "3\n1 1\n2 1\n2 2", "output": "0" }, { "input": "4\n1 1\n1 2\n2 1\n2 2", "output": "0" }, { "input": "5\n1 1\n1 2\n2 2\n3 1\n3 3", "output": "0" }, { "input": "6\n1 1\n1 2\n2 2\n3 1\n3 2\n3 3", "output": "0" }, { "input": "20\n1 1\n2 2\n3 3\n3 9\n4 4\n5 2\n5 5\n5 7\n5 8\n6 2\n6 6\n6 9\n7 7\n8 8\n9 4\n9 7\n9 9\n10 2\n10 9\n10 10", "output": "1" }, { "input": "21\n1 1\n1 9\n2 1\n2 2\n2 5\n2 6\n2 9\n3 3\n3 8\n4 1\n4 4\n5 5\n5 8\n6 6\n7 7\n8 8\n9 9\n10 4\n10 10\n11 5\n11 11", "output": "1" }, { "input": "22\n1 1\n1 3\n1 4\n1 8\n1 9\n1 11\n2 2\n3 3\n4 4\n4 5\n5 5\n6 6\n6 8\n7 7\n8 3\n8 4\n8 8\n9 9\n10 10\n11 4\n11 9\n11 11", "output": "3" }, { "input": "50\n1 1\n2 2\n2 9\n3 3\n4 4\n4 9\n4 16\n4 24\n5 5\n6 6\n7 7\n8 8\n8 9\n8 20\n9 9\n10 10\n11 11\n12 12\n13 13\n14 7\n14 14\n14 16\n14 25\n15 4\n15 6\n15 15\n15 22\n16 6\n16 16\n17 17\n18 18\n19 6\n19 19\n20 20\n21 21\n22 6\n22 22\n23 23\n24 6\n24 7\n24 8\n24 9\n24 24\n25 1\n25 3\n25 5\n25 7\n25 23\n25 24\n25 25", "output": "7" }, { "input": "55\n1 1\n1 14\n2 2\n2 19\n3 1\n3 3\n3 8\n3 14\n3 23\n4 1\n4 4\n5 5\n5 8\n5 15\n6 2\n6 3\n6 4\n6 6\n7 7\n8 8\n8 21\n9 9\n10 1\n10 10\n11 9\n11 11\n12 12\n13 13\n14 14\n15 15\n15 24\n16 5\n16 16\n17 5\n17 10\n17 17\n17 18\n17 22\n17 27\n18 18\n19 19\n20 20\n21 20\n21 21\n22 22\n23 23\n24 14\n24 24\n25 25\n26 8\n26 11\n26 26\n27 3\n27 27\n28 28", "output": "5" }, { "input": "3\n1 2\n2 1\n2 2", "output": "0" }, { "input": "6\n4 4\n3 4\n5 4\n4 5\n4 3\n3 1", "output": "0" }, { "input": "4\n1 1\n1 2\n2 1\n2 2", "output": "0" }, { "input": "3\n1 1\n2 2\n1 2", "output": "0" }, { "input": "8\n1 3\n1 1\n4 1\n2 2\n2 5\n5 9\n5 1\n5 4", "output": "1" }, { "input": "10\n1 1\n1 2\n1 3\n1 4\n5 5\n6 6\n7 7\n8 8\n9 9\n100 100", "output": "6" }, { "input": "7\n1 1\n2 2\n3 3\n4 4\n1 2\n2 3\n3 4", "output": "0" }, { "input": "6\n1 1\n2 1\n2 2\n2 4\n4 3\n2 3", "output": "0" }, { "input": "4\n3 1\n2 1\n2 2\n1 2", "output": "0" }, { "input": "6\n1 1\n2 2\n2 1\n2 4\n4 3\n2 3", "output": "0" }, { "input": "3\n1 2\n1 3\n1 4", "output": "0" }, { "input": "4\n1 1\n2 2\n1 2\n2 1", "output": "0" }, { "input": "4\n1 3\n2 1\n3 2\n3 1", "output": "1" }, { "input": "7\n1 1\n1 2\n2 2\n3 3\n3 4\n4 4\n1 4", "output": "0" }, { "input": "21\n12 12\n13 12\n12 11\n13 13\n10 10\n11 10\n11 11\n501 500\n501 501\n503 502\n500 500\n503 503\n502 501\n502 502\n700 700\n702 702\n703 702\n701 701\n702 701\n703 703\n701 700", "output": "2" }, { "input": "6\n1 11\n6 8\n11 10\n1 10\n11 11\n6 9", "output": "1" }, { "input": "4\n1 1\n2 2\n3 2\n3 1", "output": "0" }, { "input": "3\n1 2\n3 4\n3 2", "output": "0" }, { "input": "3\n1 1\n1 2\n2 2", "output": "0" }, { "input": "4\n5 5\n5 4\n6 3\n6 4", "output": "0" }, { "input": "3\n1 1\n2 2\n2 1", "output": "0" } ]
1,694,707,261
2,147,483,647
PyPy 3-64
OK
TESTS
76
154
1,638,400
def dfs(i): sn[i] = 1 for j in g[i]: if sn[j] != 1: dfs(j) t = 1 comp = 0 N = 1010 g = [[] for _ in range(N)] gr = [] sn = [0] * N def solve(): global comp n = int(input()) for _ in range(n): a, b = map(int, input().split()) gr.append((a, b)) for i in range(n): for j in range(n): if gr[i][0] == gr[j][0] or gr[i][1] == gr[j][1]: g[i].append(j) if g[i]: g[i].append(-1) for j in range(n): if len(g[j]) > 1: if sn[j] != 1: comp += 1 dfs(j) else: comp += 1 print(comp - 1) if __name__ == "__main__": for _ in range(t): solve()
Title: Ice Skating Time Limit: None seconds Memory Limit: None megabytes Problem Description: Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created. We assume that Bajtek can only heap up snow drifts at integer coordinates. Input Specification: The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift. Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct. Output Specification: Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one. Demo Input: ['2\n2 1\n1 2\n', '2\n2 1\n4 1\n'] Demo Output: ['1\n', '0\n'] Note: none
```python def dfs(i): sn[i] = 1 for j in g[i]: if sn[j] != 1: dfs(j) t = 1 comp = 0 N = 1010 g = [[] for _ in range(N)] gr = [] sn = [0] * N def solve(): global comp n = int(input()) for _ in range(n): a, b = map(int, input().split()) gr.append((a, b)) for i in range(n): for j in range(n): if gr[i][0] == gr[j][0] or gr[i][1] == gr[j][1]: g[i].append(j) if g[i]: g[i].append(-1) for j in range(n): if len(g[j]) > 1: if sn[j] != 1: comp += 1 dfs(j) else: comp += 1 print(comp - 1) if __name__ == "__main__": for _ in range(t): solve() ```
3
0
none
none
none
0
[ "none" ]
null
null
You are given two squares, one with sides parallel to the coordinate axes, and another one with sides at 45 degrees to the coordinate axes. Find whether the two squares intersect. The interior of the square is considered to be part of the square, i.e. if one square is completely inside another, they intersect. If the two squares only share one common point, they are also considered to intersect.
The input data consists of two lines, one for each square, both containing 4 pairs of integers. Each pair represents coordinates of one vertex of the square. Coordinates within each line are either in clockwise or counterclockwise order. The first line contains the coordinates of the square with sides parallel to the coordinate axes, the second line contains the coordinates of the square at 45 degrees. All the values are integer and between $-100$ and $100$.
Print "Yes" if squares intersect, otherwise print "No". You can print each letter in any case (upper or lower).
[ "0 0 6 0 6 6 0 6\n1 3 3 5 5 3 3 1\n", "0 0 6 0 6 6 0 6\n7 3 9 5 11 3 9 1\n", "6 0 6 6 0 6 0 0\n7 4 4 7 7 10 10 7\n" ]
[ "YES\n", "NO\n", "YES\n" ]
In the first example the second square lies entirely within the first square, so they do intersect. In the second sample squares do not have any points in common. Here are images corresponding to the samples:
0
[ { "input": "0 0 6 0 6 6 0 6\n1 3 3 5 5 3 3 1", "output": "YES" }, { "input": "0 0 6 0 6 6 0 6\n7 3 9 5 11 3 9 1", "output": "NO" }, { "input": "6 0 6 6 0 6 0 0\n7 4 4 7 7 10 10 7", "output": "YES" }, { "input": "0 0 6 0 6 6 0 6\n8 4 4 8 8 12 12 8", "output": "YES" }, { "input": "2 2 4 2 4 4 2 4\n0 3 3 6 6 3 3 0", "output": "YES" }, { "input": "-5 -5 5 -5 5 5 -5 5\n-5 7 0 2 5 7 0 12", "output": "YES" }, { "input": "-5 -5 5 -5 5 5 -5 5\n-5 12 0 7 5 12 0 17", "output": "NO" }, { "input": "-5 -5 5 -5 5 5 -5 5\n6 0 0 6 -6 0 0 -6", "output": "YES" }, { "input": "-100 -100 100 -100 100 100 -100 100\n-100 0 0 -100 100 0 0 100", "output": "YES" }, { "input": "92 1 92 98 -5 98 -5 1\n44 60 56 48 44 36 32 48", "output": "YES" }, { "input": "-12 -54 -12 33 -99 33 -99 -54\n-77 -40 -86 -31 -77 -22 -68 -31", "output": "YES" }, { "input": "3 45 19 45 19 61 3 61\n-29 45 -13 29 3 45 -13 61", "output": "YES" }, { "input": "79 -19 79 15 45 15 45 -19\n-1 24 -29 52 -1 80 27 52", "output": "NO" }, { "input": "75 -57 75 -21 39 -21 39 -57\n10 -42 -32 0 10 42 52 0", "output": "NO" }, { "input": "-11 53 9 53 9 73 -11 73\n-10 9 -43 42 -10 75 23 42", "output": "YES" }, { "input": "-10 -36 -10 27 -73 27 -73 -36\n44 -28 71 -55 44 -82 17 -55", "output": "NO" }, { "input": "-63 -15 6 -15 6 54 -63 54\n15 -13 -8 10 15 33 38 10", "output": "YES" }, { "input": "47 15 51 15 51 19 47 19\n19 0 -27 46 19 92 65 46", "output": "NO" }, { "input": "87 -5 87 79 3 79 3 -5\n36 36 78 -6 36 -48 -6 -6", "output": "YES" }, { "input": "-4 56 10 56 10 70 -4 70\n-11 47 -35 71 -11 95 13 71", "output": "YES" }, { "input": "-41 6 -41 8 -43 8 -43 6\n-7 27 43 -23 -7 -73 -57 -23", "output": "NO" }, { "input": "44 -58 44 7 -21 7 -21 -58\n22 19 47 -6 22 -31 -3 -6", "output": "YES" }, { "input": "-37 -63 49 -63 49 23 -37 23\n-52 68 -21 37 -52 6 -83 37", "output": "YES" }, { "input": "93 20 93 55 58 55 58 20\n61 -17 39 5 61 27 83 5", "output": "YES" }, { "input": "-7 4 -7 58 -61 58 -61 4\n-28 45 -17 34 -28 23 -39 34", "output": "YES" }, { "input": "24 -79 87 -79 87 -16 24 -16\n-59 21 -85 47 -59 73 -33 47", "output": "NO" }, { "input": "-68 -15 6 -15 6 59 -68 59\n48 -18 57 -27 48 -36 39 -27", "output": "NO" }, { "input": "25 1 25 91 -65 91 -65 1\n24 3 15 12 24 21 33 12", "output": "YES" }, { "input": "55 24 73 24 73 42 55 42\n49 17 10 56 49 95 88 56", "output": "YES" }, { "input": "69 -65 69 -28 32 -28 32 -65\n-1 50 43 6 -1 -38 -45 6", "output": "NO" }, { "input": "86 -26 86 18 42 18 42 -26\n3 -22 -40 21 3 64 46 21", "output": "YES" }, { "input": "52 -47 52 -30 35 -30 35 -47\n49 -22 64 -37 49 -52 34 -37", "output": "YES" }, { "input": "27 -59 27 9 -41 9 -41 -59\n-10 -17 2 -29 -10 -41 -22 -29", "output": "YES" }, { "input": "-90 2 0 2 0 92 -90 92\n-66 31 -86 51 -66 71 -46 51", "output": "YES" }, { "input": "-93 -86 -85 -86 -85 -78 -93 -78\n-13 61 0 48 -13 35 -26 48", "output": "NO" }, { "input": "-3 -45 85 -45 85 43 -3 43\n-22 0 -66 44 -22 88 22 44", "output": "YES" }, { "input": "-27 -73 72 -73 72 26 -27 26\n58 11 100 -31 58 -73 16 -31", "output": "YES" }, { "input": "-40 -31 8 -31 8 17 -40 17\n0 18 -35 53 0 88 35 53", "output": "NO" }, { "input": "-15 -63 -15 7 -85 7 -85 -63\n-35 -40 -33 -42 -35 -44 -37 -42", "output": "YES" }, { "input": "-100 -100 -100 100 100 100 100 -100\n-100 0 0 100 100 0 0 -100", "output": "YES" }, { "input": "67 33 67 67 33 67 33 33\n43 11 9 45 43 79 77 45", "output": "YES" }, { "input": "14 8 9 8 9 3 14 3\n-2 -13 14 3 30 -13 14 -29", "output": "YES" }, { "input": "4 3 7 3 7 6 4 6\n7 29 20 16 7 3 -6 16", "output": "YES" }, { "input": "14 30 3 30 3 19 14 19\n19 -13 11 -5 19 3 27 -5", "output": "NO" }, { "input": "-54 3 -50 3 -50 -1 -54 -1\n3 -50 -6 -41 -15 -50 -6 -59", "output": "NO" }, { "input": "3 8 3 -10 21 -10 21 8\n-9 2 -21 -10 -9 -22 3 -10", "output": "YES" }, { "input": "-35 3 -21 3 -21 -11 -35 -11\n-8 -10 3 -21 -8 -32 -19 -21", "output": "NO" }, { "input": "-5 -23 -5 -31 3 -31 3 -23\n-7 -23 -2 -28 3 -23 -2 -18", "output": "YES" }, { "input": "3 20 10 20 10 13 3 13\n3 20 21 38 39 20 21 2", "output": "YES" }, { "input": "25 3 16 3 16 12 25 12\n21 -2 16 -7 11 -2 16 3", "output": "YES" }, { "input": "-1 18 -1 3 14 3 14 18\n14 3 19 8 14 13 9 8", "output": "YES" }, { "input": "-44 -17 -64 -17 -64 3 -44 3\n-56 15 -44 27 -32 15 -44 3", "output": "YES" }, { "input": "17 3 2 3 2 18 17 18\n22 23 2 3 -18 23 2 43", "output": "YES" }, { "input": "3 -22 3 -36 -11 -36 -11 -22\n11 -44 19 -36 11 -28 3 -36", "output": "YES" }, { "input": "3 45 3 48 0 48 0 45\n13 38 4 47 13 56 22 47", "output": "NO" }, { "input": "3 -10 2 -10 2 -9 3 -9\n38 -10 20 -28 2 -10 20 8", "output": "YES" }, { "input": "-66 3 -47 3 -47 22 -66 22\n-52 -2 -45 5 -52 12 -59 5", "output": "YES" }, { "input": "3 37 -1 37 -1 41 3 41\n6 31 9 34 6 37 3 34", "output": "NO" }, { "input": "13 1 15 1 15 3 13 3\n13 19 21 11 13 3 5 11", "output": "YES" }, { "input": "20 8 3 8 3 -9 20 -9\n2 -11 3 -10 2 -9 1 -10", "output": "NO" }, { "input": "3 41 3 21 -17 21 -17 41\n26 12 10 28 26 44 42 28", "output": "NO" }, { "input": "11 11 11 3 3 3 3 11\n-12 26 -27 11 -12 -4 3 11", "output": "YES" }, { "input": "-29 3 -29 12 -38 12 -38 3\n-35 9 -29 15 -23 9 -29 3", "output": "YES" }, { "input": "3 -32 1 -32 1 -30 3 -30\n4 -32 -16 -52 -36 -32 -16 -12", "output": "YES" }, { "input": "-16 -10 -16 9 3 9 3 -10\n-8 -1 2 9 12 -1 2 -11", "output": "YES" }, { "input": "3 -42 -5 -42 -5 -34 3 -34\n-8 -54 -19 -43 -8 -32 3 -43", "output": "YES" }, { "input": "-47 3 -37 3 -37 -7 -47 -7\n-37 3 -33 -1 -37 -5 -41 -1", "output": "YES" }, { "input": "10 3 12 3 12 5 10 5\n12 4 20 12 12 20 4 12", "output": "YES" }, { "input": "3 -41 -9 -41 -9 -53 3 -53\n18 -16 38 -36 18 -56 -2 -36", "output": "YES" }, { "input": "3 40 2 40 2 41 3 41\n22 39 13 48 4 39 13 30", "output": "NO" }, { "input": "21 26 21 44 3 44 3 26\n-20 38 -32 26 -20 14 -8 26", "output": "NO" }, { "input": "0 7 3 7 3 10 0 10\n3 9 -17 29 -37 9 -17 -11", "output": "YES" }, { "input": "3 21 3 18 6 18 6 21\n-27 18 -11 2 5 18 -11 34", "output": "YES" }, { "input": "-29 13 -39 13 -39 3 -29 3\n-36 -4 -50 -18 -36 -32 -22 -18", "output": "NO" }, { "input": "3 -26 -2 -26 -2 -21 3 -21\n-5 -37 -16 -26 -5 -15 6 -26", "output": "YES" }, { "input": "3 9 -1 9 -1 13 3 13\n-9 17 -1 9 -9 1 -17 9", "output": "YES" }, { "input": "48 8 43 8 43 3 48 3\n31 -4 43 8 55 -4 43 -16", "output": "YES" }, { "input": "-3 1 3 1 3 -5 -3 -5\n20 -22 3 -5 20 12 37 -5", "output": "YES" }, { "input": "14 3 14 -16 -5 -16 -5 3\n14 2 15 1 14 0 13 1", "output": "YES" }, { "input": "-10 12 -10 -1 3 -1 3 12\n1 10 -2 7 -5 10 -2 13", "output": "YES" }, { "input": "39 21 21 21 21 3 39 3\n27 3 47 -17 27 -37 7 -17", "output": "YES" }, { "input": "3 1 3 17 -13 17 -13 1\n17 20 10 27 3 20 10 13", "output": "NO" }, { "input": "15 -18 3 -18 3 -6 15 -6\n29 -1 16 -14 3 -1 16 12", "output": "YES" }, { "input": "41 -6 41 3 32 3 32 -6\n33 3 35 5 33 7 31 5", "output": "YES" }, { "input": "7 35 3 35 3 39 7 39\n23 15 3 35 23 55 43 35", "output": "YES" }, { "input": "19 19 35 19 35 3 19 3\n25 -9 16 -18 7 -9 16 0", "output": "NO" }, { "input": "-20 3 -20 9 -26 9 -26 3\n-19 4 -21 2 -19 0 -17 2", "output": "YES" }, { "input": "13 3 22 3 22 -6 13 -6\n26 3 22 -1 18 3 22 7", "output": "YES" }, { "input": "-4 -8 -4 -15 3 -15 3 -8\n-10 5 -27 -12 -10 -29 7 -12", "output": "YES" }, { "input": "3 15 7 15 7 19 3 19\n-12 30 -23 19 -12 8 -1 19", "output": "NO" }, { "input": "-12 3 5 3 5 -14 -12 -14\n-14 22 5 3 24 22 5 41", "output": "YES" }, { "input": "-37 3 -17 3 -17 -17 -37 -17\n-9 -41 9 -23 -9 -5 -27 -23", "output": "YES" }, { "input": "3 57 3 45 -9 45 -9 57\n8 50 21 37 8 24 -5 37", "output": "YES" }, { "input": "42 3 42 -6 33 -6 33 3\n42 4 41 3 40 4 41 5", "output": "YES" }, { "input": "3 59 3 45 -11 45 -11 59\n-2 50 -8 44 -2 38 4 44", "output": "YES" }, { "input": "-51 3 -39 3 -39 15 -51 15\n-39 14 -53 0 -39 -14 -25 0", "output": "YES" }, { "input": "-7 -15 -7 3 11 3 11 -15\n15 -1 22 -8 15 -15 8 -8", "output": "YES" }, { "input": "3 -39 14 -39 14 -50 3 -50\n17 -39 5 -27 -7 -39 5 -51", "output": "YES" }, { "input": "91 -27 91 29 35 29 35 -27\n59 39 95 3 59 -33 23 3", "output": "YES" }, { "input": "-81 -60 -31 -60 -31 -10 -81 -10\n-58 -68 -95 -31 -58 6 -21 -31", "output": "YES" }, { "input": "78 -59 78 -2 21 -2 21 -59\n48 1 86 -37 48 -75 10 -37", "output": "YES" }, { "input": "-38 -26 32 -26 32 44 -38 44\n2 -27 -44 19 2 65 48 19", "output": "YES" }, { "input": "73 -54 73 -4 23 -4 23 -54\n47 1 77 -29 47 -59 17 -29", "output": "YES" }, { "input": "-6 -25 46 -25 46 27 -6 27\n21 -43 -21 -1 21 41 63 -1", "output": "YES" }, { "input": "-17 -91 -17 -27 -81 -27 -81 -91\n-48 -21 -12 -57 -48 -93 -84 -57", "output": "YES" }, { "input": "-7 16 43 16 43 66 -7 66\n18 -7 -27 38 18 83 63 38", "output": "YES" }, { "input": "-46 11 16 11 16 73 -46 73\n-18 -8 -67 41 -18 90 31 41", "output": "YES" }, { "input": "-33 -64 25 -64 25 -6 -33 -6\n-5 -74 -51 -28 -5 18 41 -28", "output": "YES" }, { "input": "99 -100 100 -100 100 -99 99 -99\n99 -99 100 -98 99 -97 98 -98", "output": "YES" }, { "input": "-100 -100 -100 -99 -99 -99 -99 -100\n-10 -10 -9 -9 -10 -8 -11 -9", "output": "NO" }, { "input": "-4 3 -3 3 -3 4 -4 4\n0 -4 4 0 0 4 -4 0", "output": "NO" }, { "input": "0 0 10 0 10 10 0 10\n11 9 13 7 15 9 13 11", "output": "NO" }, { "input": "1 1 1 6 6 6 6 1\n5 8 8 11 11 8 8 5", "output": "NO" }, { "input": "99 99 99 100 100 100 100 99\n-100 0 0 100 100 0 0 -100", "output": "NO" }, { "input": "0 0 0 2 2 2 2 0\n5 1 9 5 5 9 1 5", "output": "NO" }, { "input": "3 2 3 3 4 3 4 2\n0 4 4 0 0 -4 -4 0", "output": "NO" }, { "input": "0 0 2 0 2 2 0 2\n4 1 7 4 4 7 1 4", "output": "NO" }, { "input": "3 6 3 8 5 8 5 6\n2 9 4 11 6 9 4 7", "output": "YES" }, { "input": "0 0 10 0 10 10 0 10\n-1 5 5 -1 11 5 5 11", "output": "YES" }, { "input": "0 0 1 0 1 1 0 1\n3 0 6 3 3 6 0 3", "output": "NO" }, { "input": "3 7 4 7 4 6 3 6\n0 0 10 10 20 0 10 -10", "output": "NO" }, { "input": "0 0 0 1 1 1 1 0\n0 3 3 6 6 3 3 0", "output": "NO" }, { "input": "0 0 0 4 4 4 4 0\n3 6 7 10 11 6 7 2", "output": "NO" }, { "input": "0 0 0 1 1 1 1 0\n0 10 10 0 20 10 10 20", "output": "NO" } ]
1,529,559,662
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
7
108
0
s1=list(map(int, input().split())) s2=list(map(int, input().split())) p1=[] p2=[] for i in range(0,8,2): p1.append([s1[i],s1[i+1]]) p2.append([s2[i],s2[i+1]]) # ������, ��� ����� ������� � ������: ru=p1[0] num=0 for i in range(1,4): if p1[i][0]>=ru[0] and p1[i][1]>=ru[1]: ru=p1[i] num=i for k in range(3): num+=1 if num>=4: num=0 if k==0: lu=p1[num] elif k==1: ld=p1[num] else: rd=p1[num] yes=False for t in p2: x, y=t[0], t[1] if ld[0]<=x<=ru[0] and ld[1]<=y<=ru[1]: yes=True if not yes: #!!!!!!!!!!!!!!!!!!!!!!!!!!!!! #up, down, left, right= up=p2[0] num=0 for i in range(1,4): if p2[i][1]>up[1]: up=p2[i] num=i for k in range(3): num+=1 if num>=4: num=0 if k==0: left=p2[num] elif k==1: down=p2[num] else: right=p2[num] if left[0]>right[0]: left,right=right,left def line(t1,t2): x1,x2,y1,y2=t1[0],t2[0], t1[1], t2[1] k=(y1-y2)/(x1-x2) b=y1-k*x1 return k,b l1,l2,l3,l4=line(up, right), line(up,left), line(left, down), line(right, down) for t in p1: x=t[0] y=t[1] if y<=l1[0]*x+l1[1] and y<=l2[0]*x+l2[1] and y>=l3[0]*x+l3[1] and y>=l4[0]*x+l4[1]: yes=True if yes: print('YES') else: print('NO')
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given two squares, one with sides parallel to the coordinate axes, and another one with sides at 45 degrees to the coordinate axes. Find whether the two squares intersect. The interior of the square is considered to be part of the square, i.e. if one square is completely inside another, they intersect. If the two squares only share one common point, they are also considered to intersect. Input Specification: The input data consists of two lines, one for each square, both containing 4 pairs of integers. Each pair represents coordinates of one vertex of the square. Coordinates within each line are either in clockwise or counterclockwise order. The first line contains the coordinates of the square with sides parallel to the coordinate axes, the second line contains the coordinates of the square at 45 degrees. All the values are integer and between $-100$ and $100$. Output Specification: Print "Yes" if squares intersect, otherwise print "No". You can print each letter in any case (upper or lower). Demo Input: ['0 0 6 0 6 6 0 6\n1 3 3 5 5 3 3 1\n', '0 0 6 0 6 6 0 6\n7 3 9 5 11 3 9 1\n', '6 0 6 6 0 6 0 0\n7 4 4 7 7 10 10 7\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n'] Note: In the first example the second square lies entirely within the first square, so they do intersect. In the second sample squares do not have any points in common. Here are images corresponding to the samples:
```python s1=list(map(int, input().split())) s2=list(map(int, input().split())) p1=[] p2=[] for i in range(0,8,2): p1.append([s1[i],s1[i+1]]) p2.append([s2[i],s2[i+1]]) # ������, ��� ����� ������� � ������: ru=p1[0] num=0 for i in range(1,4): if p1[i][0]>=ru[0] and p1[i][1]>=ru[1]: ru=p1[i] num=i for k in range(3): num+=1 if num>=4: num=0 if k==0: lu=p1[num] elif k==1: ld=p1[num] else: rd=p1[num] yes=False for t in p2: x, y=t[0], t[1] if ld[0]<=x<=ru[0] and ld[1]<=y<=ru[1]: yes=True if not yes: #!!!!!!!!!!!!!!!!!!!!!!!!!!!!! #up, down, left, right= up=p2[0] num=0 for i in range(1,4): if p2[i][1]>up[1]: up=p2[i] num=i for k in range(3): num+=1 if num>=4: num=0 if k==0: left=p2[num] elif k==1: down=p2[num] else: right=p2[num] if left[0]>right[0]: left,right=right,left def line(t1,t2): x1,x2,y1,y2=t1[0],t2[0], t1[1], t2[1] k=(y1-y2)/(x1-x2) b=y1-k*x1 return k,b l1,l2,l3,l4=line(up, right), line(up,left), line(left, down), line(right, down) for t in p1: x=t[0] y=t[1] if y<=l1[0]*x+l1[1] and y<=l2[0]*x+l2[1] and y>=l3[0]*x+l3[1] and y>=l4[0]*x+l4[1]: yes=True if yes: print('YES') else: print('NO') ```
0
987
B
High School: Become Human
PROGRAMMING
1,100
[ "math" ]
null
null
Year 2118. Androids are in mass production for decades now, and they do all the work for humans. But androids have to go to school to be able to solve creative tasks. Just like humans before. It turns out that high school struggles are not gone. If someone is not like others, he is bullied. Vasya-8800 is an economy-class android which is produced by a little-known company. His design is not perfect, his characteristics also could be better. So he is bullied by other androids. One of the popular pranks on Vasya is to force him to compare $x^y$ with $y^x$. Other androids can do it in milliseconds while Vasya's memory is too small to store such big numbers. Please help Vasya! Write a fast program to compare $x^y$ with $y^x$ for Vasya, maybe then other androids will respect him.
On the only line of input there are two integers $x$ and $y$ ($1 \le x, y \le 10^{9}$).
If $x^y &lt; y^x$, then print '&lt;' (without quotes). If $x^y &gt; y^x$, then print '&gt;' (without quotes). If $x^y = y^x$, then print '=' (without quotes).
[ "5 8\n", "10 3\n", "6 6\n" ]
[ "&gt;\n", "&lt;\n", "=\n" ]
In the first example $5^8 = 5 \cdot 5 \cdot 5 \cdot 5 \cdot 5 \cdot 5 \cdot 5 \cdot 5 = 390625$, and $8^5 = 8 \cdot 8 \cdot 8 \cdot 8 \cdot 8 = 32768$. So you should print '&gt;'. In the second example $10^3 = 1000 &lt; 3^{10} = 59049$. In the third example $6^6 = 46656 = 6^6$.
1,000
[ { "input": "5 8", "output": ">" }, { "input": "10 3", "output": "<" }, { "input": "6 6", "output": "=" }, { "input": "14 1", "output": ">" }, { "input": "2 4", "output": "=" }, { "input": "987654321 123456987", "output": "<" }, { "input": "1 10", "output": "<" }, { "input": "9 1", "output": ">" }, { "input": "1 1", "output": "=" }, { "input": "2 2", "output": "=" }, { "input": "3 3", "output": "=" }, { "input": "4 4", "output": "=" }, { "input": "5 5", "output": "=" }, { "input": "2 3", "output": "<" }, { "input": "2 5", "output": ">" }, { "input": "3 2", "output": ">" }, { "input": "3 4", "output": ">" }, { "input": "3 5", "output": ">" }, { "input": "4 2", "output": "=" }, { "input": "4 3", "output": "<" }, { "input": "4 5", "output": ">" }, { "input": "5 2", "output": "<" }, { "input": "5 3", "output": "<" }, { "input": "5 4", "output": "<" }, { "input": "100 101", "output": ">" }, { "input": "876543 372647", "output": "<" }, { "input": "1000000000 999999999", "output": "<" }, { "input": "1000000000 2", "output": "<" }, { "input": "1000000000 1", "output": ">" }, { "input": "987654321 123456789", "output": "<" }, { "input": "1000000000 1000000000", "output": "=" }, { "input": "4359435 4396510", "output": ">" }, { "input": "25936809 25936809", "output": "=" }, { "input": "53602896 3", "output": "<" }, { "input": "13208659 1", "output": ">" }, { "input": "620537015 620537016", "output": ">" }, { "input": "56498103 56498102", "output": "<" }, { "input": "4 1000000000", "output": ">" }, { "input": "11 15", "output": ">" }, { "input": "2 6", "output": ">" }, { "input": "1 100", "output": "<" }, { "input": "3 9", "output": ">" }, { "input": "5 25", "output": ">" }, { "input": "17 18", "output": ">" }, { "input": "100 99", "output": "<" }, { "input": "10000035 1000432", "output": "<" }, { "input": "27 3", "output": "<" }, { "input": "15657413 15657414", "output": ">" } ]
1,625,486,127
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
25
1,000
1,945,600
a,b=map(int,input().split()) if len(str(a))>8 and len(str(b))>8: if b>a: print('>') elif b<a: print('<') else: print('=') elif (a**b)>(b**a): print('>') elif (a**b)<(b**a): print('<') else: print('=')
Title: High School: Become Human Time Limit: None seconds Memory Limit: None megabytes Problem Description: Year 2118. Androids are in mass production for decades now, and they do all the work for humans. But androids have to go to school to be able to solve creative tasks. Just like humans before. It turns out that high school struggles are not gone. If someone is not like others, he is bullied. Vasya-8800 is an economy-class android which is produced by a little-known company. His design is not perfect, his characteristics also could be better. So he is bullied by other androids. One of the popular pranks on Vasya is to force him to compare $x^y$ with $y^x$. Other androids can do it in milliseconds while Vasya's memory is too small to store such big numbers. Please help Vasya! Write a fast program to compare $x^y$ with $y^x$ for Vasya, maybe then other androids will respect him. Input Specification: On the only line of input there are two integers $x$ and $y$ ($1 \le x, y \le 10^{9}$). Output Specification: If $x^y &lt; y^x$, then print '&lt;' (without quotes). If $x^y &gt; y^x$, then print '&gt;' (without quotes). If $x^y = y^x$, then print '=' (without quotes). Demo Input: ['5 8\n', '10 3\n', '6 6\n'] Demo Output: ['&gt;\n', '&lt;\n', '=\n'] Note: In the first example $5^8 = 5 \cdot 5 \cdot 5 \cdot 5 \cdot 5 \cdot 5 \cdot 5 \cdot 5 = 390625$, and $8^5 = 8 \cdot 8 \cdot 8 \cdot 8 \cdot 8 = 32768$. So you should print '&gt;'. In the second example $10^3 = 1000 &lt; 3^{10} = 59049$. In the third example $6^6 = 46656 = 6^6$.
```python a,b=map(int,input().split()) if len(str(a))>8 and len(str(b))>8: if b>a: print('>') elif b<a: print('<') else: print('=') elif (a**b)>(b**a): print('>') elif (a**b)<(b**a): print('<') else: print('=') ```
0
556
A
Case of the Zeros and Ones
PROGRAMMING
900
[ "greedy" ]
null
null
Andrewid the Android is a galaxy-famous detective. In his free time he likes to think about strings containing zeros and ones. Once he thought about a string of length *n* consisting of zeroes and ones. Consider the following operation: we choose any two adjacent positions in the string, and if one them contains 0, and the other contains 1, then we are allowed to remove these two digits from the string, obtaining a string of length *n*<=-<=2 as a result. Now Andreid thinks about what is the minimum length of the string that can remain after applying the described operation several times (possibly, zero)? Help him to calculate this number.
First line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=2·105), the length of the string that Andreid has. The second line contains the string of length *n* consisting only from zeros and ones.
Output the minimum length of the string that may remain after applying the described operations several times.
[ "4\n1100\n", "5\n01010\n", "8\n11101111\n" ]
[ "0\n", "1\n", "6\n" ]
In the first sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/10df55364c21c6e8d5da31b6ab6f6294c4fc26b3.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the second sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/19ec5dcd85f0b5cf757aa076ace72df39634de2d.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the third sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/dc34a159e4230375fa325555527ebc748811f188.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
250
[ { "input": "4\n1100", "output": "0" }, { "input": "5\n01010", "output": "1" }, { "input": "8\n11101111", "output": "6" }, { "input": "1\n0", "output": "1" }, { "input": "1\n1", "output": "1" }, { "input": "2\n00", "output": "2" }, { "input": "2\n01", "output": "0" }, { "input": "2\n10", "output": "0" }, { "input": "2\n11", "output": "2" }, { "input": "3\n001", "output": "1" }, { "input": "6\n110110", "output": "2" }, { "input": "7\n0000011", "output": "3" }, { "input": "6\n110010", "output": "0" }, { "input": "6\n110100", "output": "0" }, { "input": "3\n100", "output": "1" }, { "input": "6\n010111", "output": "2" }, { "input": "8\n01011100", "output": "0" }, { "input": "6\n001011", "output": "0" }, { "input": "7\n1110000", "output": "1" }, { "input": "9\n011111101", "output": "5" } ]
1,681,762,201
2,147,483,647
Python 3
OK
TESTS
49
124
716,800
#Complejidad O(n) n = int(input()) p = input() count = 0 aux = 0 if len(p)==n: for char in p: if char == "0": count += 1 elif char == "1": aux += 1 ans = abs(count - aux) #La funcion abs me devuelve el valor absoluto #De una resta print(ans)
Title: Case of the Zeros and Ones Time Limit: None seconds Memory Limit: None megabytes Problem Description: Andrewid the Android is a galaxy-famous detective. In his free time he likes to think about strings containing zeros and ones. Once he thought about a string of length *n* consisting of zeroes and ones. Consider the following operation: we choose any two adjacent positions in the string, and if one them contains 0, and the other contains 1, then we are allowed to remove these two digits from the string, obtaining a string of length *n*<=-<=2 as a result. Now Andreid thinks about what is the minimum length of the string that can remain after applying the described operation several times (possibly, zero)? Help him to calculate this number. Input Specification: First line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=2·105), the length of the string that Andreid has. The second line contains the string of length *n* consisting only from zeros and ones. Output Specification: Output the minimum length of the string that may remain after applying the described operations several times. Demo Input: ['4\n1100\n', '5\n01010\n', '8\n11101111\n'] Demo Output: ['0\n', '1\n', '6\n'] Note: In the first sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/10df55364c21c6e8d5da31b6ab6f6294c4fc26b3.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the second sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/19ec5dcd85f0b5cf757aa076ace72df39634de2d.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the third sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/dc34a159e4230375fa325555527ebc748811f188.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
```python #Complejidad O(n) n = int(input()) p = input() count = 0 aux = 0 if len(p)==n: for char in p: if char == "0": count += 1 elif char == "1": aux += 1 ans = abs(count - aux) #La funcion abs me devuelve el valor absoluto #De una resta print(ans) ```
3
0
none
none
none
0
[ "none" ]
null
null
Dwarfs have planted a very interesting plant, which is a triangle directed "upwards". This plant has an amusing feature. After one year a triangle plant directed "upwards" divides into four triangle plants: three of them will point "upwards" and one will point "downwards". After another year, each triangle plant divides into four triangle plants: three of them will be directed in the same direction as the parent plant, and one of them will be directed in the opposite direction. Then each year the process repeats. The figure below illustrates this process. Help the dwarfs find out how many triangle plants that point "upwards" will be in *n* years.
The first line contains a single integer *n* (0<=≤<=*n*<=≤<=1018) — the number of full years when the plant grew. Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier.
Print a single integer — the remainder of dividing the number of plants that will point "upwards" in *n* years by 1000000007 (109<=+<=7).
[ "1\n", "2\n" ]
[ "3\n", "10\n" ]
The first test sample corresponds to the second triangle on the figure in the statement. The second test sample corresponds to the third one.
0
[ { "input": "1", "output": "3" }, { "input": "2", "output": "10" }, { "input": "385599124", "output": "493875375" }, { "input": "989464295", "output": "31966163" }, { "input": "376367012", "output": "523204186" }, { "input": "529357306", "output": "142578489" }, { "input": "782916801", "output": "51174574" }, { "input": "74859961358140080", "output": "478768275" }, { "input": "0", "output": "1" }, { "input": "252509053898415171", "output": "886314547" }, { "input": "760713016078377938", "output": "79611270" }, { "input": "919845424847912644", "output": "388845650" }, { "input": "585335721566249104", "output": "301383716" }, { "input": "522842183413115087", "output": "556012763" }, { "input": "148049062285906746", "output": "913927498" }, { "input": "84324827171274022", "output": "462535280" }, { "input": "354979172034763159", "output": "239287993" }, { "input": "1312148742261680", "output": "799725655" }, { "input": "269587448053313253", "output": "536645997" }, { "input": "645762257531682045", "output": "543988614" }, { "input": "615812227854199662", "output": "357939938" }, { "input": "819875140559301751", "output": "968653685" }, { "input": "349993003033420740", "output": "709392758" }, { "input": "891351282398722856", "output": "70758467" }, { "input": "563324730406715801", "output": "353494903" }, { "input": "520974001002628386", "output": "164118419" }, { "input": "666729339260489789", "output": "784700006" }, { "input": "856674609788912527", "output": "720540265" }, { "input": "791809296233191092", "output": "369199735" }, { "input": "711066335916901717", "output": "15590358" }, { "input": "931356501703211379", "output": "239824013" }, { "input": "234122431978145893", "output": "905163056" }, { "input": "1000000000000000000", "output": "899770636" }, { "input": "3", "output": "36" }, { "input": "4", "output": "136" }, { "input": "5", "output": "528" }, { "input": "6", "output": "2080" }, { "input": "7", "output": "8256" }, { "input": "8", "output": "32896" }, { "input": "9", "output": "131328" }, { "input": "10", "output": "524800" }, { "input": "11", "output": "2098176" }, { "input": "12", "output": "8390656" }, { "input": "13", "output": "33558528" }, { "input": "14", "output": "134225920" }, { "input": "15", "output": "536887296" }, { "input": "16", "output": "147516402" }, { "input": "0", "output": "1" }, { "input": "6265", "output": "980996097" } ]
1,667,475,279
2,147,483,647
PyPy 3-64
RUNTIME_ERROR
TESTS
8
218
9,420,800
from collections import defaultdict,Counter,deque import math import bisect from itertools import accumulate from math import ceil, log,gcd from functools import lru_cache from sys import stdin, stdout import atexit import io import sys def write(*args, **kwargs): sep = kwargs.get('sep', ' ') end = kwargs.get('end', '\n') stdout.write(sep.join(str(a) for a in args) + end) def read(): return stdin.readline().rstrip() import sys import random from typing import List def primes(n): if n<=2: return [] sieve=[True]*(n+1) for x in range(3,int(n**0.5)+1,2): for y in range(3,(n//x)+1,2): sieve[(x*y)]=False return [2]+[i for i in range(3,n,2) if sieve[i]] def prime_factors(n): i = 2 factors = [] for i in primes(int(n**0.5+1)): while n % i == 0: n //= i factors.append(i) if n > 1: factors.append(n) return factors x = int(read()) def multiply(a, b): # Creating an auxiliary matrix # to store elements of the # multiplication matrix mul = [[0 for x in range(2)] for y in range(2)]; for i in range(2): for j in range(2): for k in range(2): mul[i][j] += a[i][k] * b[k][j]; mul[i][j] %= 10**9+7 return mul def power(F, n): # Multiply it with initial values i.e # with F(0) = 0, F(1) = 1, F(2) = 1 if (n == 1): return F F_ = power(F, int(n / 2)); F_ = multiply(F_, F_); if (n % 2 != 0): F_ = multiply(F_, F); # Multiply it with initial values i.e # with F(0) = 0, F(1) = 1, F(2) = 1 return F_ ; F = [[3,1],[1,3]] a = [1,0] F = power(F,x) print(F[0][0]) # total = int(read()) # n,m= ([*map(int, read().split())]) # d = [{} for i in range(m)] # p = [0]*n # for i in range(m): # x = ([*map(int, read().split())]) # cur = x[0] # for j in x[1:]: # d[i][cur] = j # cur = j # d[i][cur] = -1 # cc = 0 # for i in x: # if p[i-1] == 0: # c = 1 # cur = i # while True: # if cur == -1: # break # # print(cur,c) # cc+=c # p[cur-1] = 1 # n = True # t = d[0][cur] # for j in range(1,m): # # print('!', d[j][cur] ,t) # if d[j][cur] != t: # n= False # # print('!!!') # break # if n : # c+=1 # cur = d[0][cur] # else: # break # print(cc) # total = int(read()) # x = ([*map(int, read().split())]) # # total = 10**5 # # x = sorted([random.randint(1, 10**5) for i in range(total)]) # mx = 0 # p = primes(10**5) # d= defaultdict(lambda:0) # for i in x: # # print(i) # t = [] # m = 0 # p = prime_factors(i) # # print(i,p) # for j in range(len(p)): # if p[j] > i: # break # if i % p[j] == 0: # t.append(j) # m = max(m,d[p[j]]) # for j in t: # d[p[j]] = m + 1 # mx = max(mx,m+1) # write(mx) # a= 1 # b = 1 # for i in range(1,1337): # a,b = 4*a +b, a + 2*b # a,b = a%1000000007,b%1000000007 # print((a+b)%1000000007) # for _ in range(total): # n = int(read()) # x = sorted(x) # o = x.count(1) # while True: # if o ==0: # break # if not check(o): # o-=1 # else: # break # write(o)
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dwarfs have planted a very interesting plant, which is a triangle directed "upwards". This plant has an amusing feature. After one year a triangle plant directed "upwards" divides into four triangle plants: three of them will point "upwards" and one will point "downwards". After another year, each triangle plant divides into four triangle plants: three of them will be directed in the same direction as the parent plant, and one of them will be directed in the opposite direction. Then each year the process repeats. The figure below illustrates this process. Help the dwarfs find out how many triangle plants that point "upwards" will be in *n* years. Input Specification: The first line contains a single integer *n* (0<=≤<=*n*<=≤<=1018) — the number of full years when the plant grew. Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier. Output Specification: Print a single integer — the remainder of dividing the number of plants that will point "upwards" in *n* years by 1000000007 (109<=+<=7). Demo Input: ['1\n', '2\n'] Demo Output: ['3\n', '10\n'] Note: The first test sample corresponds to the second triangle on the figure in the statement. The second test sample corresponds to the third one.
```python from collections import defaultdict,Counter,deque import math import bisect from itertools import accumulate from math import ceil, log,gcd from functools import lru_cache from sys import stdin, stdout import atexit import io import sys def write(*args, **kwargs): sep = kwargs.get('sep', ' ') end = kwargs.get('end', '\n') stdout.write(sep.join(str(a) for a in args) + end) def read(): return stdin.readline().rstrip() import sys import random from typing import List def primes(n): if n<=2: return [] sieve=[True]*(n+1) for x in range(3,int(n**0.5)+1,2): for y in range(3,(n//x)+1,2): sieve[(x*y)]=False return [2]+[i for i in range(3,n,2) if sieve[i]] def prime_factors(n): i = 2 factors = [] for i in primes(int(n**0.5+1)): while n % i == 0: n //= i factors.append(i) if n > 1: factors.append(n) return factors x = int(read()) def multiply(a, b): # Creating an auxiliary matrix # to store elements of the # multiplication matrix mul = [[0 for x in range(2)] for y in range(2)]; for i in range(2): for j in range(2): for k in range(2): mul[i][j] += a[i][k] * b[k][j]; mul[i][j] %= 10**9+7 return mul def power(F, n): # Multiply it with initial values i.e # with F(0) = 0, F(1) = 1, F(2) = 1 if (n == 1): return F F_ = power(F, int(n / 2)); F_ = multiply(F_, F_); if (n % 2 != 0): F_ = multiply(F_, F); # Multiply it with initial values i.e # with F(0) = 0, F(1) = 1, F(2) = 1 return F_ ; F = [[3,1],[1,3]] a = [1,0] F = power(F,x) print(F[0][0]) # total = int(read()) # n,m= ([*map(int, read().split())]) # d = [{} for i in range(m)] # p = [0]*n # for i in range(m): # x = ([*map(int, read().split())]) # cur = x[0] # for j in x[1:]: # d[i][cur] = j # cur = j # d[i][cur] = -1 # cc = 0 # for i in x: # if p[i-1] == 0: # c = 1 # cur = i # while True: # if cur == -1: # break # # print(cur,c) # cc+=c # p[cur-1] = 1 # n = True # t = d[0][cur] # for j in range(1,m): # # print('!', d[j][cur] ,t) # if d[j][cur] != t: # n= False # # print('!!!') # break # if n : # c+=1 # cur = d[0][cur] # else: # break # print(cc) # total = int(read()) # x = ([*map(int, read().split())]) # # total = 10**5 # # x = sorted([random.randint(1, 10**5) for i in range(total)]) # mx = 0 # p = primes(10**5) # d= defaultdict(lambda:0) # for i in x: # # print(i) # t = [] # m = 0 # p = prime_factors(i) # # print(i,p) # for j in range(len(p)): # if p[j] > i: # break # if i % p[j] == 0: # t.append(j) # m = max(m,d[p[j]]) # for j in t: # d[p[j]] = m + 1 # mx = max(mx,m+1) # write(mx) # a= 1 # b = 1 # for i in range(1,1337): # a,b = 4*a +b, a + 2*b # a,b = a%1000000007,b%1000000007 # print((a+b)%1000000007) # for _ in range(total): # n = int(read()) # x = sorted(x) # o = x.count(1) # while True: # if o ==0: # break # if not check(o): # o-=1 # else: # break # write(o) ```
-1
933
B
A Determined Cleanup
PROGRAMMING
2,000
[ "math" ]
null
null
In order to put away old things and welcome a fresh new year, a thorough cleaning of the house is a must. Little Tommy finds an old polynomial and cleaned it up by taking it modulo another. But now he regrets doing this... Given two integers *p* and *k*, find a polynomial *f*(*x*) with non-negative integer coefficients strictly less than *k*, whose remainder is *p* when divided by (*x*<=+<=*k*). That is, *f*(*x*)<==<=*q*(*x*)·(*x*<=+<=*k*)<=+<=*p*, where *q*(*x*) is a polynomial (not necessarily with integer coefficients).
The only line of input contains two space-separated integers *p* and *k* (1<=≤<=*p*<=≤<=1018, 2<=≤<=*k*<=≤<=2<=000).
If the polynomial does not exist, print a single integer -1, or output two lines otherwise. In the first line print a non-negative integer *d* — the number of coefficients in the polynomial. In the second line print *d* space-separated integers *a*0,<=*a*1,<=...,<=*a**d*<=-<=1, describing a polynomial fulfilling the given requirements. Your output should satisfy 0<=≤<=*a**i*<=&lt;<=*k* for all 0<=≤<=*i*<=≤<=*d*<=-<=1, and *a**d*<=-<=1<=≠<=0. If there are many possible solutions, print any of them.
[ "46 2\n", "2018 214\n" ]
[ "7\n0 1 0 0 1 1 1\n", "3\n92 205 1\n" ]
In the first example, *f*(*x*) = *x*<sup class="upper-index">6</sup> + *x*<sup class="upper-index">5</sup> + *x*<sup class="upper-index">4</sup> + *x* = (*x*<sup class="upper-index">5</sup> - *x*<sup class="upper-index">4</sup> + 3*x*<sup class="upper-index">3</sup> - 6*x*<sup class="upper-index">2</sup> + 12*x* - 23)·(*x* + 2) + 46. In the second example, *f*(*x*) = *x*<sup class="upper-index">2</sup> + 205*x* + 92 = (*x* - 9)·(*x* + 214) + 2018.
750
[ { "input": "46 2", "output": "7\n0 1 0 0 1 1 1" }, { "input": "2018 214", "output": "3\n92 205 1" }, { "input": "4 2", "output": "3\n0 0 1" }, { "input": "5 2", "output": "3\n1 0 1" }, { "input": "10 3", "output": "3\n1 0 1" }, { "input": "250 1958", "output": "1\n250" }, { "input": "1000000000000000000 2000", "output": "7\n0 0 0 0 500 1969 1" }, { "input": "1 2", "output": "1\n1" }, { "input": "2 2", "output": "3\n0 1 1" }, { "input": "3 2", "output": "3\n1 1 1" }, { "input": "6 2", "output": "5\n0 1 0 1 1" }, { "input": "7 2", "output": "5\n1 1 0 1 1" }, { "input": "8 2", "output": "5\n0 0 0 1 1" }, { "input": "9 2", "output": "5\n1 0 0 1 1" }, { "input": "10 2", "output": "5\n0 1 1 1 1" }, { "input": "1 3", "output": "1\n1" }, { "input": "2 3", "output": "1\n2" }, { "input": "3 3", "output": "3\n0 2 1" }, { "input": "4 3", "output": "3\n1 2 1" }, { "input": "5 3", "output": "3\n2 2 1" }, { "input": "6 3", "output": "3\n0 1 1" }, { "input": "7 3", "output": "3\n1 1 1" }, { "input": "8 3", "output": "3\n2 1 1" }, { "input": "9 3", "output": "3\n0 0 1" }, { "input": "462 2", "output": "11\n0 1 0 0 1 0 1 1 0 1 1" }, { "input": "462 3", "output": "7\n0 2 1 1 0 1 1" }, { "input": "2018 4", "output": "7\n2 0 2 1 0 2 1" }, { "input": "20180214 5", "output": "11\n4 3 4 4 4 3 2 2 2 0 2" }, { "input": "1317 221", "output": "3\n212 216 1" }, { "input": "1314 520", "output": "3\n274 518 1" }, { "input": "1562 862", "output": "3\n700 861 1" }, { "input": "6666666666666666 3", "output": "35\n0 1 2 0 0 2 2 1 2 2 1 1 2 2 2 2 0 0 0 2 1 2 1 1 1 1 1 2 1 2 0 1 1 2 1" }, { "input": "252525252525252525 252", "output": "9\n189 176 211 80 27 238 231 249 1" }, { "input": "271828182845904523 536", "output": "7\n3 157 21 240 147 288 12" }, { "input": "314159265358979323 846", "output": "7\n553 47 111 353 790 122 1" }, { "input": "393939393939393939 393", "output": "7\n237 191 82 181 11 30 107" }, { "input": "233333333333333333 2000", "output": "7\n1333 1334 1334 1334 584 1993 1" }, { "input": "998244353998244353 2000", "output": "7\n353 878 500 1456 391 1969 1" }, { "input": "1000000000000000000 2", "output": "61\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 1 0 1 0 0 0 1 1 1 1 1 0 0 1 0 1 1 1 1 1 1 0 1 0 0 1 1 1 0 0 0 0 1 0 0 0 1 0 0 1" }, { "input": "1000000000000000000 3", "output": "39\n1 0 0 0 2 0 2 2 0 2 0 0 1 1 1 2 1 1 1 0 1 2 2 0 1 1 1 2 0 0 0 1 0 0 0 1 1 1 1" } ]
1,518,698,484
2,147,483,647
PyPy 3
OK
TESTS
40
77
19,968,000
p,k=input().strip().split(' ') flag=1 p=int(p) k=int(k) A=[] B=[] k=-k while p!=0: A.append(p%k) p//=k if A[-1]<0: p+=1 for i in A: if i<0: B.append(i-k); else: B.append(i); print(len(B)) for i in B: print(i,end=" ")
Title: A Determined Cleanup Time Limit: None seconds Memory Limit: None megabytes Problem Description: In order to put away old things and welcome a fresh new year, a thorough cleaning of the house is a must. Little Tommy finds an old polynomial and cleaned it up by taking it modulo another. But now he regrets doing this... Given two integers *p* and *k*, find a polynomial *f*(*x*) with non-negative integer coefficients strictly less than *k*, whose remainder is *p* when divided by (*x*<=+<=*k*). That is, *f*(*x*)<==<=*q*(*x*)·(*x*<=+<=*k*)<=+<=*p*, where *q*(*x*) is a polynomial (not necessarily with integer coefficients). Input Specification: The only line of input contains two space-separated integers *p* and *k* (1<=≤<=*p*<=≤<=1018, 2<=≤<=*k*<=≤<=2<=000). Output Specification: If the polynomial does not exist, print a single integer -1, or output two lines otherwise. In the first line print a non-negative integer *d* — the number of coefficients in the polynomial. In the second line print *d* space-separated integers *a*0,<=*a*1,<=...,<=*a**d*<=-<=1, describing a polynomial fulfilling the given requirements. Your output should satisfy 0<=≤<=*a**i*<=&lt;<=*k* for all 0<=≤<=*i*<=≤<=*d*<=-<=1, and *a**d*<=-<=1<=≠<=0. If there are many possible solutions, print any of them. Demo Input: ['46 2\n', '2018 214\n'] Demo Output: ['7\n0 1 0 0 1 1 1\n', '3\n92 205 1\n'] Note: In the first example, *f*(*x*) = *x*<sup class="upper-index">6</sup> + *x*<sup class="upper-index">5</sup> + *x*<sup class="upper-index">4</sup> + *x* = (*x*<sup class="upper-index">5</sup> - *x*<sup class="upper-index">4</sup> + 3*x*<sup class="upper-index">3</sup> - 6*x*<sup class="upper-index">2</sup> + 12*x* - 23)·(*x* + 2) + 46. In the second example, *f*(*x*) = *x*<sup class="upper-index">2</sup> + 205*x* + 92 = (*x* - 9)·(*x* + 214) + 2018.
```python p,k=input().strip().split(' ') flag=1 p=int(p) k=int(k) A=[] B=[] k=-k while p!=0: A.append(p%k) p//=k if A[-1]<0: p+=1 for i in A: if i<0: B.append(i-k); else: B.append(i); print(len(B)) for i in B: print(i,end=" ") ```
3
148
A
Insomnia cure
PROGRAMMING
800
[ "constructive algorithms", "implementation", "math" ]
null
null
«One dragon. Two dragon. Three dragon», — the princess was counting. She had trouble falling asleep, and she got bored of counting lambs when she was nine. However, just counting dragons was boring as well, so she entertained herself at best she could. Tonight she imagined that all dragons were here to steal her, and she was fighting them off. Every *k*-th dragon got punched in the face with a frying pan. Every *l*-th dragon got his tail shut into the balcony door. Every *m*-th dragon got his paws trampled with sharp heels. Finally, she threatened every *n*-th dragon to call her mom, and he withdrew in panic. How many imaginary dragons suffered moral or physical damage tonight, if the princess counted a total of *d* dragons?
Input data contains integer numbers *k*,<=*l*,<=*m*,<=*n* and *d*, each number in a separate line (1<=≤<=*k*,<=*l*,<=*m*,<=*n*<=≤<=10, 1<=≤<=*d*<=≤<=105).
Output the number of damaged dragons.
[ "1\n2\n3\n4\n12\n", "2\n3\n4\n5\n24\n" ]
[ "12\n", "17\n" ]
In the first case every first dragon got punched with a frying pan. Some of the dragons suffered from other reasons as well, but the pan alone would be enough. In the second case dragons 1, 7, 11, 13, 17, 19 and 23 escaped unharmed.
1,000
[ { "input": "1\n2\n3\n4\n12", "output": "12" }, { "input": "2\n3\n4\n5\n24", "output": "17" }, { "input": "1\n1\n1\n1\n100000", "output": "100000" }, { "input": "10\n9\n8\n7\n6", "output": "0" }, { "input": "8\n4\n4\n3\n65437", "output": "32718" }, { "input": "8\n4\n1\n10\n59392", "output": "59392" }, { "input": "4\n1\n8\n7\n44835", "output": "44835" }, { "input": "6\n1\n7\n2\n62982", "output": "62982" }, { "input": "2\n7\n4\n9\n56937", "output": "35246" }, { "input": "2\n9\n8\n1\n75083", "output": "75083" }, { "input": "8\n7\n7\n6\n69038", "output": "24656" }, { "input": "4\n4\n2\n3\n54481", "output": "36320" }, { "input": "6\n4\n9\n8\n72628", "output": "28244" }, { "input": "9\n7\n8\n10\n42357", "output": "16540" }, { "input": "5\n6\n4\n3\n60504", "output": "36302" }, { "input": "7\n2\n3\n8\n21754", "output": "15539" }, { "input": "1\n2\n10\n4\n39901", "output": "39901" }, { "input": "3\n4\n7\n1\n58048", "output": "58048" }, { "input": "9\n10\n4\n6\n52003", "output": "21956" }, { "input": "5\n10\n9\n3\n70149", "output": "32736" }, { "input": "5\n5\n5\n10\n55592", "output": "11118" }, { "input": "1\n5\n2\n6\n49547", "output": "49547" }, { "input": "3\n7\n7\n7\n84046", "output": "36019" }, { "input": "10\n2\n1\n8\n63537", "output": "63537" }, { "input": "7\n2\n10\n5\n81684", "output": "53678" }, { "input": "7\n1\n6\n8\n99831", "output": "99831" }, { "input": "3\n9\n3\n3\n61082", "output": "20360" }, { "input": "5\n5\n8\n9\n79228", "output": "29931" }, { "input": "1\n5\n5\n6\n89535", "output": "89535" }, { "input": "5\n5\n2\n1\n7682", "output": "7682" }, { "input": "7\n4\n8\n8\n25829", "output": "9224" }, { "input": "3\n4\n3\n3\n87079", "output": "43539" }, { "input": "5\n8\n4\n9\n5226", "output": "2438" }, { "input": "4\n9\n6\n6\n1070", "output": "415" }, { "input": "10\n10\n10\n10\n100000", "output": "10000" }, { "input": "1\n1\n1\n1\n1", "output": "1" }, { "input": "10\n10\n10\n10\n1", "output": "0" }, { "input": "10\n10\n1\n10\n10", "output": "10" }, { "input": "10\n10\n1\n10\n100", "output": "100" }, { "input": "2\n2\n2\n2\n1", "output": "0" } ]
1,688,562,430
2,147,483,647
PyPy 3-64
RUNTIME_ERROR
TESTS
0
122
2,867,200
""" inp1 = lambda: map(int,input().split()) inp2 = lambda: list(map(int,input().split())) """ """ $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ """ mod = 10**9 + 7 inp1 = lambda: map(int,input().split()) inp2 = lambda: list(map(int,input().split())) def compute_gcd(x, y): while(y): x, y = y, x % y return x def compute_lcm(x, y): lcm = (x*y)//compute_gcd(x,y) return lcm """ $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ """ arr = [] for _ in range(5): arr.append(int(input())) k,l,m,n,d = arr[0],arr[1],arr[2],arr[3],arr[4] setDr = set() for i in range(1, d + 1): if i >= k and i % k == 0: set.add(i) if i >= l and i % l == 0: set.add(i) if i >= m and i % m == 0: set.add(i) if i >= n and i % n == 0: set.add(i) print(len(setDr))
Title: Insomnia cure Time Limit: None seconds Memory Limit: None megabytes Problem Description: «One dragon. Two dragon. Three dragon», — the princess was counting. She had trouble falling asleep, and she got bored of counting lambs when she was nine. However, just counting dragons was boring as well, so she entertained herself at best she could. Tonight she imagined that all dragons were here to steal her, and she was fighting them off. Every *k*-th dragon got punched in the face with a frying pan. Every *l*-th dragon got his tail shut into the balcony door. Every *m*-th dragon got his paws trampled with sharp heels. Finally, she threatened every *n*-th dragon to call her mom, and he withdrew in panic. How many imaginary dragons suffered moral or physical damage tonight, if the princess counted a total of *d* dragons? Input Specification: Input data contains integer numbers *k*,<=*l*,<=*m*,<=*n* and *d*, each number in a separate line (1<=≤<=*k*,<=*l*,<=*m*,<=*n*<=≤<=10, 1<=≤<=*d*<=≤<=105). Output Specification: Output the number of damaged dragons. Demo Input: ['1\n2\n3\n4\n12\n', '2\n3\n4\n5\n24\n'] Demo Output: ['12\n', '17\n'] Note: In the first case every first dragon got punched with a frying pan. Some of the dragons suffered from other reasons as well, but the pan alone would be enough. In the second case dragons 1, 7, 11, 13, 17, 19 and 23 escaped unharmed.
```python """ inp1 = lambda: map(int,input().split()) inp2 = lambda: list(map(int,input().split())) """ """ $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ """ mod = 10**9 + 7 inp1 = lambda: map(int,input().split()) inp2 = lambda: list(map(int,input().split())) def compute_gcd(x, y): while(y): x, y = y, x % y return x def compute_lcm(x, y): lcm = (x*y)//compute_gcd(x,y) return lcm """ $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ """ arr = [] for _ in range(5): arr.append(int(input())) k,l,m,n,d = arr[0],arr[1],arr[2],arr[3],arr[4] setDr = set() for i in range(1, d + 1): if i >= k and i % k == 0: set.add(i) if i >= l and i % l == 0: set.add(i) if i >= m and i % m == 0: set.add(i) if i >= n and i % n == 0: set.add(i) print(len(setDr)) ```
-1
920
B
Tea Queue
PROGRAMMING
1,200
[ "implementation" ]
null
null
Recently *n* students from city S moved to city P to attend a programming camp. They moved there by train. In the evening, all students in the train decided that they want to drink some tea. Of course, no two people can use the same teapot simultaneously, so the students had to form a queue to get their tea. *i*-th student comes to the end of the queue at the beginning of *l**i*-th second. If there are multiple students coming to the queue in the same moment, then the student with greater index comes after the student with lesser index. Students in the queue behave as follows: if there is nobody in the queue before the student, then he uses the teapot for exactly one second and leaves the queue with his tea; otherwise the student waits for the people before him to get their tea. If at the beginning of *r**i*-th second student *i* still cannot get his tea (there is someone before him in the queue), then he leaves the queue without getting any tea. For each student determine the second he will use the teapot and get his tea (if he actually gets it).
The first line contains one integer *t* — the number of test cases to solve (1<=≤<=*t*<=≤<=1000). Then *t* test cases follow. The first line of each test case contains one integer *n* (1<=≤<=*n*<=≤<=1000) — the number of students. Then *n* lines follow. Each line contains two integer *l**i*, *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=5000) — the second *i*-th student comes to the end of the queue, and the second he leaves the queue if he still cannot get his tea. It is guaranteed that for every condition *l**i*<=-<=1<=≤<=*l**i* holds. The sum of *n* over all test cases doesn't exceed 1000. Note that in hacks you have to set *t*<==<=1.
For each test case print *n* integers. *i*-th of them must be equal to the second when *i*-th student gets his tea, or 0 if he leaves without tea.
[ "2\n2\n1 3\n1 4\n3\n1 5\n1 1\n2 3\n" ]
[ "1 2 \n1 0 2 \n" ]
The example contains 2 tests: 1. During 1-st second, students 1 and 2 come to the queue, and student 1 gets his tea. Student 2 gets his tea during 2-nd second. 1. During 1-st second, students 1 and 2 come to the queue, student 1 gets his tea, and student 2 leaves without tea. During 2-nd second, student 3 comes and gets his tea.
0
[ { "input": "2\n2\n1 3\n1 4\n3\n1 5\n1 1\n2 3", "output": "1 2 \n1 0 2 " }, { "input": "19\n1\n1 1\n1\n1 2\n1\n1 1000\n1\n1 2000\n1\n2 2\n1\n2 3\n1\n2 1000\n1\n2 2000\n1\n1999 1999\n1\n1999 2000\n1\n2000 2000\n2\n1 1\n1 1\n2\n1 1\n1 2\n2\n1 2\n1 1\n2\n1 2000\n1 1\n2\n1 1\n1 2000\n2\n1 2000\n2 2\n2\n2 2000\n2 2\n2\n2 2\n2 2000", "output": "1 \n1 \n1 \n1 \n2 \n2 \n2 \n2 \n1999 \n1999 \n2000 \n1 0 \n1 2 \n1 0 \n1 0 \n1 2 \n1 2 \n2 0 \n2 3 " }, { "input": "1\n11\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "1 0 0 0 0 0 0 0 0 0 0 " }, { "input": "1\n5\n1 1\n1 2\n1 5\n1 1\n1 1", "output": "1 2 3 0 0 " } ]
1,689,150,538
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
31
0
t=int(input()) for _ in range(t): n=int(input()) arr=[] d=1 for k in range(n): c,l=map(int,input().split()) if c<l: arr.append(max(c,d)) d+=1 else: arr.append(0) print(*arr)
Title: Tea Queue Time Limit: None seconds Memory Limit: None megabytes Problem Description: Recently *n* students from city S moved to city P to attend a programming camp. They moved there by train. In the evening, all students in the train decided that they want to drink some tea. Of course, no two people can use the same teapot simultaneously, so the students had to form a queue to get their tea. *i*-th student comes to the end of the queue at the beginning of *l**i*-th second. If there are multiple students coming to the queue in the same moment, then the student with greater index comes after the student with lesser index. Students in the queue behave as follows: if there is nobody in the queue before the student, then he uses the teapot for exactly one second and leaves the queue with his tea; otherwise the student waits for the people before him to get their tea. If at the beginning of *r**i*-th second student *i* still cannot get his tea (there is someone before him in the queue), then he leaves the queue without getting any tea. For each student determine the second he will use the teapot and get his tea (if he actually gets it). Input Specification: The first line contains one integer *t* — the number of test cases to solve (1<=≤<=*t*<=≤<=1000). Then *t* test cases follow. The first line of each test case contains one integer *n* (1<=≤<=*n*<=≤<=1000) — the number of students. Then *n* lines follow. Each line contains two integer *l**i*, *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=5000) — the second *i*-th student comes to the end of the queue, and the second he leaves the queue if he still cannot get his tea. It is guaranteed that for every condition *l**i*<=-<=1<=≤<=*l**i* holds. The sum of *n* over all test cases doesn't exceed 1000. Note that in hacks you have to set *t*<==<=1. Output Specification: For each test case print *n* integers. *i*-th of them must be equal to the second when *i*-th student gets his tea, or 0 if he leaves without tea. Demo Input: ['2\n2\n1 3\n1 4\n3\n1 5\n1 1\n2 3\n'] Demo Output: ['1 2 \n1 0 2 \n'] Note: The example contains 2 tests: 1. During 1-st second, students 1 and 2 come to the queue, and student 1 gets his tea. Student 2 gets his tea during 2-nd second. 1. During 1-st second, students 1 and 2 come to the queue, student 1 gets his tea, and student 2 leaves without tea. During 2-nd second, student 3 comes and gets his tea.
```python t=int(input()) for _ in range(t): n=int(input()) arr=[] d=1 for k in range(n): c,l=map(int,input().split()) if c<l: arr.append(max(c,d)) d+=1 else: arr.append(0) print(*arr) ```
0
32
C
Flea
PROGRAMMING
1,700
[ "math" ]
C. Flea
2
256
It is known that fleas in Berland can jump only vertically and horizontally, and the length of the jump is always equal to *s* centimeters. A flea has found herself at the center of some cell of the checked board of the size *n*<=×<=*m* centimeters (each cell is 1<=×<=1 centimeters). She can jump as she wishes for an arbitrary number of times, she can even visit a cell more than once. The only restriction is that she cannot jump out of the board. The flea can count the amount of cells that she can reach from the starting position (*x*,<=*y*). Let's denote this amount by *d**x*,<=*y*. Your task is to find the number of such starting positions (*x*,<=*y*), which have the maximum possible value of *d**x*,<=*y*.
The first line contains three integers *n*, *m*, *s* (1<=≤<=*n*,<=*m*,<=*s*<=≤<=106) — length of the board, width of the board and length of the flea's jump.
Output the only integer — the number of the required starting positions of the flea.
[ "2 3 1000000\n", "3 3 2\n" ]
[ "6\n", "4\n" ]
none
1,500
[ { "input": "2 3 1000000", "output": "6" }, { "input": "3 3 2", "output": "4" }, { "input": "1 2 3", "output": "2" }, { "input": "4 5 6", "output": "20" }, { "input": "9 8 7", "output": "8" }, { "input": "1000 1000 1000", "output": "1000000" }, { "input": "1 1 1", "output": "1" }, { "input": "1 1 2", "output": "1" }, { "input": "1 1 1000000", "output": "1" }, { "input": "1000000 1000000 1", "output": "1000000000000" }, { "input": "1000000 1000000 2", "output": "1000000000000" }, { "input": "1000000 1000000 999999", "output": "4" }, { "input": "1000000 1000000 12345", "output": "20340100" }, { "input": "1000000 1000000 123456", "output": "12358324224" }, { "input": "43496 179847 327622", "output": "7822625112" }, { "input": "105126 379125 460772", "output": "39855894750" }, { "input": "999463 261665 981183", "output": "9566472400" }, { "input": "836832 336228 50", "output": "100850467200" }, { "input": "303307 400683 999941", "output": "121529958681" }, { "input": "40224 890892 54", "output": "31858297920" }, { "input": "109785 447109 990618", "output": "49085861565" }, { "input": "228385 744978 699604", "output": "20725481980" }, { "input": "694117 431924 737", "output": "13934440800" }, { "input": "923179 799988 998430", "output": "738532121852" }, { "input": "61043 55049 998379", "output": "3360356107" }, { "input": "402841 635488 997633", "output": "256000621408" }, { "input": "213927 672636 865", "output": "27867287808" }, { "input": "391814 220151 3756", "output": "16977831150" }, { "input": "313667 778854 999813", "output": "244300797618" }, { "input": "933241 558702 1", "output": "521403613182" }, { "input": "38614 941895 999986", "output": "36370333530" }, { "input": "242366 216591 4", "output": "19685613696" }, { "input": "282798 941695 999998", "output": "266309462610" }, { "input": "43054 191 1", "output": "8223314" } ]
1,639,230,882
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
16
186
0
n, m, s = map(int, input().split()) row_n = n // s + int(n > s and n % s != 0) row_m = m // s + int(m > s and m % s != 0) a = (row_n - 1) * s + 1 b = (row_m - 1) * s + 1 can_move_right = n - a can_move_down = m - b if row_m == 0 or row_n == 0: if row_m == 0 and row_n == 0: print(n * m) elif row_m == 0: print(row_n * n) else: print(row_m * m) else: print(row_m * min(s, n, max(1, can_move_right + 1)) * row_n * min(s, m, max(1, can_move_down + 1))) # print(a, b, can_move_right, can_move_down)
Title: Flea Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: It is known that fleas in Berland can jump only vertically and horizontally, and the length of the jump is always equal to *s* centimeters. A flea has found herself at the center of some cell of the checked board of the size *n*<=×<=*m* centimeters (each cell is 1<=×<=1 centimeters). She can jump as she wishes for an arbitrary number of times, she can even visit a cell more than once. The only restriction is that she cannot jump out of the board. The flea can count the amount of cells that she can reach from the starting position (*x*,<=*y*). Let's denote this amount by *d**x*,<=*y*. Your task is to find the number of such starting positions (*x*,<=*y*), which have the maximum possible value of *d**x*,<=*y*. Input Specification: The first line contains three integers *n*, *m*, *s* (1<=≤<=*n*,<=*m*,<=*s*<=≤<=106) — length of the board, width of the board and length of the flea's jump. Output Specification: Output the only integer — the number of the required starting positions of the flea. Demo Input: ['2 3 1000000\n', '3 3 2\n'] Demo Output: ['6\n', '4\n'] Note: none
```python n, m, s = map(int, input().split()) row_n = n // s + int(n > s and n % s != 0) row_m = m // s + int(m > s and m % s != 0) a = (row_n - 1) * s + 1 b = (row_m - 1) * s + 1 can_move_right = n - a can_move_down = m - b if row_m == 0 or row_n == 0: if row_m == 0 and row_n == 0: print(n * m) elif row_m == 0: print(row_n * n) else: print(row_m * m) else: print(row_m * min(s, n, max(1, can_move_right + 1)) * row_n * min(s, m, max(1, can_move_down + 1))) # print(a, b, can_move_right, can_move_down) ```
0
405
A
Gravity Flip
PROGRAMMING
900
[ "greedy", "implementation", "sortings" ]
null
null
Little Chris is bored during his physics lessons (too easy), so he has built a toy box to keep himself occupied. The box is special, since it has the ability to change gravity. There are *n* columns of toy cubes in the box arranged in a line. The *i*-th column contains *a**i* cubes. At first, the gravity in the box is pulling the cubes downwards. When Chris switches the gravity, it begins to pull all the cubes to the right side of the box. The figure shows the initial and final configurations of the cubes in the box: the cubes that have changed their position are highlighted with orange. Given the initial configuration of the toy cubes in the box, find the amounts of cubes in each of the *n* columns after the gravity switch!
The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=100), the number of the columns in the box. The next line contains *n* space-separated integer numbers. The *i*-th number *a**i* (1<=≤<=*a**i*<=≤<=100) denotes the number of cubes in the *i*-th column.
Output *n* integer numbers separated by spaces, where the *i*-th number is the amount of cubes in the *i*-th column after the gravity switch.
[ "4\n3 2 1 2\n", "3\n2 3 8\n" ]
[ "1 2 2 3 \n", "2 3 8 \n" ]
The first example case is shown on the figure. The top cube of the first column falls to the top of the last column; the top cube of the second column falls to the top of the third column; the middle cube of the first column falls to the top of the second column. In the second example case the gravity switch does not change the heights of the columns.
500
[ { "input": "4\n3 2 1 2", "output": "1 2 2 3 " }, { "input": "3\n2 3 8", "output": "2 3 8 " }, { "input": "5\n2 1 2 1 2", "output": "1 1 2 2 2 " }, { "input": "1\n1", "output": "1 " }, { "input": "2\n4 3", "output": "3 4 " }, { "input": "6\n100 40 60 20 1 80", "output": "1 20 40 60 80 100 " }, { "input": "10\n10 8 6 7 5 3 4 2 9 1", "output": "1 2 3 4 5 6 7 8 9 10 " }, { "input": "10\n1 2 3 4 5 6 7 8 9 10", "output": "1 2 3 4 5 6 7 8 9 10 " }, { "input": "100\n82 51 81 14 37 17 78 92 64 15 8 86 89 8 87 77 66 10 15 12 100 25 92 47 21 78 20 63 13 49 41 36 41 79 16 87 87 69 3 76 80 60 100 49 70 59 72 8 38 71 45 97 71 14 76 54 81 4 59 46 39 29 92 3 49 22 53 99 59 52 74 31 92 43 42 23 44 9 82 47 7 40 12 9 3 55 37 85 46 22 84 52 98 41 21 77 63 17 62 91", "output": "3 3 3 4 7 8 8 8 9 9 10 12 12 13 14 14 15 15 16 17 17 20 21 21 22 22 23 25 29 31 36 37 37 38 39 40 41 41 41 42 43 44 45 46 46 47 47 49 49 49 51 52 52 53 54 55 59 59 59 60 62 63 63 64 66 69 70 71 71 72 74 76 76 77 77 78 78 79 80 81 81 82 82 84 85 86 87 87 87 89 91 92 92 92 92 97 98 99 100 100 " }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 " }, { "input": "10\n1 9 7 6 2 4 7 8 1 3", "output": "1 1 2 3 4 6 7 7 8 9 " }, { "input": "20\n53 32 64 20 41 97 50 20 66 68 22 60 74 61 97 54 80 30 72 59", "output": "20 20 22 30 32 41 50 53 54 59 60 61 64 66 68 72 74 80 97 97 " }, { "input": "30\n7 17 4 18 16 12 14 10 1 13 2 16 13 17 8 16 13 14 9 17 17 5 13 5 1 7 6 20 18 12", "output": "1 1 2 4 5 5 6 7 7 8 9 10 12 12 13 13 13 13 14 14 16 16 16 17 17 17 17 18 18 20 " }, { "input": "40\n22 58 68 58 48 53 52 1 16 78 75 17 63 15 36 32 78 75 49 14 42 46 66 54 49 82 40 43 46 55 12 73 5 45 61 60 1 11 31 84", "output": "1 1 5 11 12 14 15 16 17 22 31 32 36 40 42 43 45 46 46 48 49 49 52 53 54 55 58 58 60 61 63 66 68 73 75 75 78 78 82 84 " }, { "input": "70\n1 3 3 1 3 3 1 1 1 3 3 2 3 3 1 1 1 2 3 1 3 2 3 3 3 2 2 3 1 3 3 2 1 1 2 1 2 1 2 2 1 1 1 3 3 2 3 2 3 2 3 3 2 2 2 3 2 3 3 3 1 1 3 3 1 1 1 1 3 1", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 " }, { "input": "90\n17 75 51 30 100 5 50 95 51 73 66 5 7 76 43 49 23 55 3 24 95 79 10 11 44 93 17 99 53 66 82 66 63 76 19 4 51 71 75 43 27 5 24 19 48 7 91 15 55 21 7 6 27 10 2 91 64 58 18 21 16 71 90 88 21 20 6 6 95 85 11 7 40 65 52 49 92 98 46 88 17 48 85 96 77 46 100 34 67 52", "output": "2 3 4 5 5 5 6 6 6 7 7 7 7 10 10 11 11 15 16 17 17 17 18 19 19 20 21 21 21 23 24 24 27 27 30 34 40 43 43 44 46 46 48 48 49 49 50 51 51 51 52 52 53 55 55 58 63 64 65 66 66 66 67 71 71 73 75 75 76 76 77 79 82 85 85 88 88 90 91 91 92 93 95 95 95 96 98 99 100 100 " }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 " }, { "input": "100\n1 1 1 1 2 1 1 1 1 1 2 2 1 1 2 1 2 1 1 1 2 1 1 2 1 2 1 1 2 2 2 1 1 2 1 1 1 2 2 2 1 1 1 2 1 2 2 1 2 1 1 2 2 1 2 1 2 1 2 2 1 1 1 2 1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 1 1 1 1 2 2 2 2 2 2 2 1 1 1 2 1 2 1", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 " }, { "input": "100\n2 1 1 1 3 2 3 3 2 3 3 1 3 3 1 3 3 1 1 1 2 3 1 2 3 1 2 3 3 1 3 1 1 2 3 2 3 3 2 3 3 1 2 2 1 2 3 2 3 2 2 1 1 3 1 3 2 1 3 1 3 1 3 1 1 3 3 3 2 3 2 2 2 2 1 3 3 3 1 2 1 2 3 2 1 3 1 3 2 1 3 1 2 1 2 3 1 3 2 3", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 " }, { "input": "100\n7 4 5 5 10 10 5 8 5 7 4 5 4 6 8 8 2 6 3 3 10 7 10 8 6 2 7 3 9 7 7 2 4 5 2 4 9 5 10 1 10 5 10 4 1 3 4 2 6 9 9 9 10 6 2 5 6 1 8 10 4 10 3 4 10 5 5 4 10 4 5 3 7 10 2 7 3 6 9 6 1 6 5 5 4 6 6 4 4 1 5 1 6 6 6 8 8 6 2 6", "output": "1 1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7 7 7 7 7 7 8 8 8 8 8 8 8 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 10 10 10 10 " }, { "input": "100\n12 10 5 11 13 12 14 13 7 15 15 12 13 19 12 18 14 10 10 3 1 10 16 11 19 8 10 15 5 10 12 16 11 13 11 15 14 12 16 8 11 8 15 2 18 2 14 13 15 20 8 8 4 12 14 7 10 3 9 1 7 19 6 7 2 14 8 20 7 17 18 20 3 18 18 9 6 10 4 1 4 19 9 13 3 3 12 11 11 20 8 2 13 6 7 12 1 4 17 3", "output": "1 1 1 1 2 2 2 2 3 3 3 3 3 3 4 4 4 4 5 5 6 6 6 7 7 7 7 7 7 8 8 8 8 8 8 8 9 9 9 10 10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 12 12 12 13 13 13 13 13 13 13 14 14 14 14 14 14 15 15 15 15 15 15 16 16 16 17 17 18 18 18 18 18 19 19 19 19 20 20 20 20 " }, { "input": "100\n5 13 1 40 30 10 23 32 33 12 6 4 15 29 31 17 23 5 36 31 32 38 24 11 34 39 19 21 6 19 31 35 1 15 6 29 22 15 17 15 1 17 2 34 20 8 27 2 29 26 13 9 22 27 27 3 20 40 4 40 33 29 36 30 35 16 19 28 26 11 36 24 29 5 40 10 38 34 33 23 34 39 31 7 10 31 22 6 36 24 14 31 34 23 2 4 26 16 2 32", "output": "1 1 1 2 2 2 2 3 4 4 4 5 5 5 6 6 6 6 7 8 9 10 10 10 11 11 12 13 13 14 15 15 15 15 16 16 17 17 17 19 19 19 20 20 21 22 22 22 23 23 23 23 24 24 24 26 26 26 27 27 27 28 29 29 29 29 29 30 30 31 31 31 31 31 31 32 32 32 33 33 33 34 34 34 34 34 35 35 36 36 36 36 38 38 39 39 40 40 40 40 " }, { "input": "100\n72 44 34 74 9 60 26 37 55 77 74 69 28 66 54 55 8 36 57 31 31 48 32 66 40 70 77 43 64 28 37 10 21 58 51 32 60 28 51 52 28 35 7 33 1 68 38 70 57 71 8 20 42 57 59 4 58 10 17 47 22 48 16 3 76 67 32 37 64 47 33 41 75 69 2 76 39 9 27 75 20 21 52 25 71 21 11 29 38 10 3 1 45 55 63 36 27 7 59 41", "output": "1 1 2 3 3 4 7 7 8 8 9 9 10 10 10 11 16 17 20 20 21 21 21 22 25 26 27 27 28 28 28 28 29 31 31 32 32 32 33 33 34 35 36 36 37 37 37 38 38 39 40 41 41 42 43 44 45 47 47 48 48 51 51 52 52 54 55 55 55 57 57 57 58 58 59 59 60 60 63 64 64 66 66 67 68 69 69 70 70 71 71 72 74 74 75 75 76 76 77 77 " }, { "input": "100\n75 18 61 10 56 53 42 57 79 80 31 2 50 45 54 99 84 52 71 21 86 3 19 98 14 37 40 62 63 68 5 10 87 8 81 85 52 52 57 94 2 7 56 96 19 76 1 13 81 6 80 47 22 59 99 32 9 5 36 88 98 91 70 70 12 93 12 22 85 1 97 48 94 16 84 84 51 34 62 7 68 51 30 2 37 82 4 7 27 1 80 9 61 16 59 55 12 96 94 82", "output": "1 1 1 2 2 2 3 4 5 5 6 7 7 7 8 9 9 10 10 12 12 12 13 14 16 16 18 19 19 21 22 22 27 30 31 32 34 36 37 37 40 42 45 47 48 50 51 51 52 52 52 53 54 55 56 56 57 57 59 59 61 61 62 62 63 68 68 70 70 71 75 76 79 80 80 80 81 81 82 82 84 84 84 85 85 86 87 88 91 93 94 94 94 96 96 97 98 98 99 99 " }, { "input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 " }, { "input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 " }, { "input": "100\n50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50", "output": "50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 " }, { "input": "49\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97", "output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 " }, { "input": "30\n1 4 7 10 13 16 19 22 25 28 31 34 37 40 43 46 49 52 55 58 61 64 67 70 73 76 79 82 85 88", "output": "1 4 7 10 13 16 19 22 25 28 31 34 37 40 43 46 49 52 55 58 61 64 67 70 73 76 79 82 85 88 " }, { "input": "100\n100 51 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 51 100 " }, { "input": "10\n100 90 80 70 60 50 40 30 20 10", "output": "10 20 30 40 50 60 70 80 90 100 " }, { "input": "1\n10", "output": "10 " } ]
1,687,101,090
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
30
0
num=input('') x=map(int,input('').split(' ')) arr=[] for k in x: arr.append(k) arr.sort() print(arr)
Title: Gravity Flip Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Chris is bored during his physics lessons (too easy), so he has built a toy box to keep himself occupied. The box is special, since it has the ability to change gravity. There are *n* columns of toy cubes in the box arranged in a line. The *i*-th column contains *a**i* cubes. At first, the gravity in the box is pulling the cubes downwards. When Chris switches the gravity, it begins to pull all the cubes to the right side of the box. The figure shows the initial and final configurations of the cubes in the box: the cubes that have changed their position are highlighted with orange. Given the initial configuration of the toy cubes in the box, find the amounts of cubes in each of the *n* columns after the gravity switch! Input Specification: The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=100), the number of the columns in the box. The next line contains *n* space-separated integer numbers. The *i*-th number *a**i* (1<=≤<=*a**i*<=≤<=100) denotes the number of cubes in the *i*-th column. Output Specification: Output *n* integer numbers separated by spaces, where the *i*-th number is the amount of cubes in the *i*-th column after the gravity switch. Demo Input: ['4\n3 2 1 2\n', '3\n2 3 8\n'] Demo Output: ['1 2 2 3 \n', '2 3 8 \n'] Note: The first example case is shown on the figure. The top cube of the first column falls to the top of the last column; the top cube of the second column falls to the top of the third column; the middle cube of the first column falls to the top of the second column. In the second example case the gravity switch does not change the heights of the columns.
```python num=input('') x=map(int,input('').split(' ')) arr=[] for k in x: arr.append(k) arr.sort() print(arr) ```
0
41
A
Translation
PROGRAMMING
800
[ "implementation", "strings" ]
A. Translation
2
256
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
[ "code\nedoc\n", "abb\naba\n", "code\ncode\n" ]
[ "YES\n", "NO\n", "NO\n" ]
none
500
[ { "input": "code\nedoc", "output": "YES" }, { "input": "abb\naba", "output": "NO" }, { "input": "code\ncode", "output": "NO" }, { "input": "abacaba\nabacaba", "output": "YES" }, { "input": "q\nq", "output": "YES" }, { "input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk", "output": "NO" }, { "input": "z\na", "output": "NO" }, { "input": "asd\ndsa", "output": "YES" }, { "input": "abcdef\nfecdba", "output": "NO" }, { "input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu", "output": "NO" }, { "input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf", "output": "NO" }, { "input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp", "output": "NO" }, { "input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb", "output": "NO" }, { "input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom", "output": "NO" }, { "input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh", "output": "NO" }, { "input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy", "output": "NO" }, { "input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko", "output": "NO" }, { "input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv", "output": "NO" }, { "input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd", "output": "NO" }, { "input": "w\nw", "output": "YES" }, { "input": "vz\nzv", "output": "YES" }, { "input": "ry\nyr", "output": "YES" }, { "input": "xou\nuox", "output": "YES" }, { "input": "axg\ngax", "output": "NO" }, { "input": "zdsl\nlsdz", "output": "YES" }, { "input": "kudl\nldku", "output": "NO" }, { "input": "zzlzwnqlcl\nlclqnwzlzz", "output": "YES" }, { "input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv", "output": "YES" }, { "input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar", "output": "NO" }, { "input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn", "output": "YES" }, { "input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum", "output": "YES" }, { "input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv", "output": "YES" }, { "input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm", "output": "NO" }, { "input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd", "output": "NO" }, { "input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg", "output": "YES" }, { "input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis", "output": "YES" }, { "input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy", "output": "NO" }, { "input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw", "output": "YES" }, { "input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi", "output": "YES" }, { "input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib", "output": "YES" } ]
1,666,855,637
2,147,483,647
PyPy 3-64
OK
TESTS
40
154
0
import math def reverse(string): string = "".join(reversed(string)) return string word1 = input("") word2 = input("") if word1 == reverse(word2): print("YES") else: print("NO")
Title: Translation Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. Input Specification: The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. Output Specification: If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. Demo Input: ['code\nedoc\n', 'abb\naba\n', 'code\ncode\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none
```python import math def reverse(string): string = "".join(reversed(string)) return string word1 = input("") word2 = input("") if word1 == reverse(word2): print("YES") else: print("NO") ```
3.9615
750
C
New Year and Rating
PROGRAMMING
1,600
[ "binary search", "greedy", "math" ]
null
null
Every Codeforces user has rating, described with one integer, possibly negative or zero. Users are divided into two divisions. The first division is for users with rating 1900 or higher. Those with rating 1899 or lower belong to the second division. In every contest, according to one's performance, his or her rating changes by some value, possibly negative or zero. Limak competed in *n* contests in the year 2016. He remembers that in the *i*-th contest he competed in the division *d**i* (i.e. he belonged to this division just before the start of this contest) and his rating changed by *c**i* just after the contest. Note that negative *c**i* denotes the loss of rating. What is the maximum possible rating Limak can have right now, after all *n* contests? If his rating may be arbitrarily big, print "Infinity". If there is no scenario matching the given information, print "Impossible".
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000). The *i*-th of next *n* lines contains two integers *c**i* and *d**i* (<=-<=100<=≤<=*c**i*<=≤<=100, 1<=≤<=*d**i*<=≤<=2), describing Limak's rating change after the *i*-th contest and his division during the *i*-th contest contest.
If Limak's current rating can be arbitrarily big, print "Infinity" (without quotes). If the situation is impossible, print "Impossible" (without quotes). Otherwise print one integer, denoting the maximum possible value of Limak's current rating, i.e. rating after the *n* contests.
[ "3\n-7 1\n5 2\n8 2\n", "2\n57 1\n22 2\n", "1\n-5 1\n", "4\n27 2\n13 1\n-50 1\n8 2\n" ]
[ "1907\n", "Impossible\n", "Infinity\n", "1897\n" ]
In the first sample, the following scenario matches all information Limak remembers and has maximum possible final rating: - Limak has rating 1901 and belongs to the division 1 in the first contest. His rating decreases by 7. - With rating 1894 Limak is in the division 2. His rating increases by 5. - Limak has rating 1899 and is still in the division 2. In the last contest of the year he gets  + 8 and ends the year with rating 1907. In the second sample, it's impossible that Limak is in the division 1, his rating increases by 57 and after that Limak is in the division 2 in the second contest.
1,000
[ { "input": "3\n-7 1\n5 2\n8 2", "output": "1907" }, { "input": "2\n57 1\n22 2", "output": "Impossible" }, { "input": "1\n-5 1", "output": "Infinity" }, { "input": "4\n27 2\n13 1\n-50 1\n8 2", "output": "1897" }, { "input": "6\n8 1\n-22 1\n9 2\n-7 2\n85 2\n77 1", "output": "2054" }, { "input": "7\n-56 1\n-85 2\n-88 2\n-36 1\n-25 2\n8 2\n61 2", "output": "Impossible" }, { "input": "15\n20 2\n-31 2\n80 2\n-18 2\n-44 2\n37 2\n-90 2\n76 2\n14 2\n8 2\n-40 2\n22 2\n21 2\n20 2\n-29 2", "output": "1870" }, { "input": "50\n67 1\n89 2\n83 1\n-26 1\n88 2\n-22 2\n-98 2\n-83 1\n58 2\n26 2\n-37 1\n-43 2\n29 1\n65 2\n-70 1\n81 2\n36 1\n52 2\n93 2\n-12 2\n-12 1\n5 2\n91 1\n3 1\n-27 1\n18 1\n-60 1\n-15 1\n17 1\n-33 1\n-74 2\n5 2\n-62 2\n72 1\n-22 1\n-58 1\n-9 1\n57 1\n-18 2\n-11 2\n-68 2\n74 2\n-20 2\n21 2\n-19 2\n-77 1\n50 2\n93 2\n45 2\n-66 1", "output": "Impossible" }, { "input": "1\n-100 1", "output": "Infinity" }, { "input": "1\n-100 2", "output": "1799" }, { "input": "2\n100 1\n100 1", "output": "Infinity" }, { "input": "2\n100 2\n100 2", "output": "1999" }, { "input": "20\n-94 2\n25 2\n96 2\n23 2\n41 2\n-92 2\n99 2\n-60 1\n29 2\n-50 2\n81 2\n22 1\n45 1\n47 1\n-86 1\n44 1\n-7 1\n82 1\n-30 1\n-17 1", "output": "2006" }, { "input": "40\n-54 1\n-29 1\n55 1\n-46 1\n44 1\n-22 1\n-100 1\n-22 2\n91 2\n58 1\n64 1\n2 1\n47 1\n-3 1\n-56 1\n2 1\n-69 1\n6 1\n-33 1\n-74 1\n-85 2\n-50 2\n-96 2\n-86 2\n-8 2\n21 2\n86 2\n-15 2\n24 2\n81 2\n8 2\n65 2\n-41 2\n-34 2\n-72 2\n-2 2\n-1 2\n6 2\n54 2\n23 2", "output": "1777" }, { "input": "50\n-21 1\n-16 1\n5 1\n-57 1\n-29 1\n94 1\n59 1\n79 1\n-56 1\n43 1\n-21 1\n36 1\n25 1\n41 1\n66 1\n-24 1\n6 1\n51 1\n97 1\n-4 1\n-60 1\n-94 1\n-10 1\n51 1\n98 1\n-100 1\n-20 1\n-69 1\n-43 1\n-38 1\n57 1\n21 1\n-82 1\n-59 1\n2 1\n62 1\n-35 1\n17 1\n-24 1\n44 1\n69 1\n-73 1\n84 1\n-29 1\n35 1\n69 1\n-77 1\n-7 1\n20 1\n45 1", "output": "Infinity" }, { "input": "2\n0 2\n0 1", "output": "Impossible" }, { "input": "2\n0 1\n0 2", "output": "Impossible" }, { "input": "22\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n-1 1\n100 2", "output": "1999" }, { "input": "3\n-1 1\n1 2\n1 2", "output": "Impossible" }, { "input": "25\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2", "output": "1999" }, { "input": "5\n-100 2\n-100 2\n-100 2\n-100 2\n100 2", "output": "1599" }, { "input": "22\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n-98 1\n100 1", "output": "2001" }, { "input": "26\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 1", "output": "2099" }, { "input": "3\n100 2\n-100 1\n-100 1", "output": "Impossible" }, { "input": "21\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n1 2\n0 1", "output": "1900" }, { "input": "23\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 1", "output": "2099" }, { "input": "3\n-10 2\n-20 2\n-30 2", "output": "1839" }, { "input": "3\n1 1\n-1 1\n-1 2", "output": "Impossible" }, { "input": "1\n-100 2", "output": "1799" }, { "input": "1\n0 2", "output": "1899" }, { "input": "21\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 1", "output": "2099" }, { "input": "20\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2\n100 2", "output": "1999" }, { "input": "1\n3 2", "output": "1902" } ]
1,690,591,017
2,147,483,647
PyPy 3-64
OK
TESTS
81
1,138
9,932,800
s, t = -10 ** 8, 10 ** 8 n = int(input()) for i in range(n): c, d = map(int, input().split()) if d == 1: s = max(s, 1900) if d == 2: t = min(t, 1899) if s > t: print('Impossible') exit() s = s + c t = t + c if (t > 4*10**7):print('Infinity') else: print(t)# 1690591017.8006713
Title: New Year and Rating Time Limit: None seconds Memory Limit: None megabytes Problem Description: Every Codeforces user has rating, described with one integer, possibly negative or zero. Users are divided into two divisions. The first division is for users with rating 1900 or higher. Those with rating 1899 or lower belong to the second division. In every contest, according to one's performance, his or her rating changes by some value, possibly negative or zero. Limak competed in *n* contests in the year 2016. He remembers that in the *i*-th contest he competed in the division *d**i* (i.e. he belonged to this division just before the start of this contest) and his rating changed by *c**i* just after the contest. Note that negative *c**i* denotes the loss of rating. What is the maximum possible rating Limak can have right now, after all *n* contests? If his rating may be arbitrarily big, print "Infinity". If there is no scenario matching the given information, print "Impossible". Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000). The *i*-th of next *n* lines contains two integers *c**i* and *d**i* (<=-<=100<=≤<=*c**i*<=≤<=100, 1<=≤<=*d**i*<=≤<=2), describing Limak's rating change after the *i*-th contest and his division during the *i*-th contest contest. Output Specification: If Limak's current rating can be arbitrarily big, print "Infinity" (without quotes). If the situation is impossible, print "Impossible" (without quotes). Otherwise print one integer, denoting the maximum possible value of Limak's current rating, i.e. rating after the *n* contests. Demo Input: ['3\n-7 1\n5 2\n8 2\n', '2\n57 1\n22 2\n', '1\n-5 1\n', '4\n27 2\n13 1\n-50 1\n8 2\n'] Demo Output: ['1907\n', 'Impossible\n', 'Infinity\n', '1897\n'] Note: In the first sample, the following scenario matches all information Limak remembers and has maximum possible final rating: - Limak has rating 1901 and belongs to the division 1 in the first contest. His rating decreases by 7. - With rating 1894 Limak is in the division 2. His rating increases by 5. - Limak has rating 1899 and is still in the division 2. In the last contest of the year he gets  + 8 and ends the year with rating 1907. In the second sample, it's impossible that Limak is in the division 1, his rating increases by 57 and after that Limak is in the division 2 in the second contest.
```python s, t = -10 ** 8, 10 ** 8 n = int(input()) for i in range(n): c, d = map(int, input().split()) if d == 1: s = max(s, 1900) if d == 2: t = min(t, 1899) if s > t: print('Impossible') exit() s = s + c t = t + c if (t > 4*10**7):print('Infinity') else: print(t)# 1690591017.8006713 ```
3
0
none
none
none
0
[ "none" ]
null
null
Theater stage is a rectangular field of size *n*<=×<=*m*. The director gave you the stage's plan which actors will follow. For each cell it is stated in the plan if there would be an actor in this cell or not. You are to place a spotlight on the stage in some good position. The spotlight will project light in one of the four directions (if you look at the stage from above) — left, right, up or down. Thus, the spotlight's position is a cell it is placed to and a direction it shines. A position is good if two conditions hold: - there is no actor in the cell the spotlight is placed to; - there is at least one actor in the direction the spotlight projects. Count the number of good positions for placing the spotlight. Two positions of spotlight are considered to be different if the location cells or projection direction differ.
The first line contains two positive integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of rows and the number of columns in the plan. The next *n* lines contain *m* integers, 0 or 1 each — the description of the plan. Integer 1, means there will be an actor in the corresponding cell, while 0 means the cell will remain empty. It is guaranteed that there is at least one actor in the plan.
Print one integer — the number of good positions for placing the spotlight.
[ "2 4\n0 1 0 0\n1 0 1 0\n", "4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0\n" ]
[ "9\n", "20\n" ]
In the first example the following positions are good: 1. the (1, 1) cell and right direction; 1. the (1, 1) cell and down direction; 1. the (1, 3) cell and left direction; 1. the (1, 3) cell and down direction; 1. the (1, 4) cell and left direction; 1. the (2, 2) cell and left direction; 1. the (2, 2) cell and up direction; 1. the (2, 2) and right direction; 1. the (2, 4) cell and left direction. Therefore, there are 9 good positions in this example.
0
[ { "input": "2 4\n0 1 0 0\n1 0 1 0", "output": "9" }, { "input": "4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0", "output": "20" }, { "input": "1 5\n1 1 0 0 0", "output": "3" }, { "input": "2 10\n0 0 0 0 0 0 0 1 0 0\n1 0 0 0 0 0 0 0 0 0", "output": "20" }, { "input": "3 1\n1\n0\n0", "output": "2" }, { "input": "5 7\n0 0 0 0 0 0 1\n0 0 0 0 0 0 1\n0 0 0 1 0 0 0\n0 0 0 0 0 0 0\n0 0 0 0 0 0 0", "output": "25" }, { "input": "10 20\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "4" }, { "input": "5 7\n0 0 0 0 0 0 0\n0 1 1 1 1 0 1\n0 1 1 1 1 1 1\n0 0 0 0 0 0 0\n0 1 1 1 1 0 1", "output": "26" }, { "input": "10 20\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "121" }, { "input": "1 2\n0 1", "output": "1" }, { "input": "1 2\n1 0", "output": "1" }, { "input": "1 2\n1 1", "output": "0" }, { "input": "2 1\n1\n0", "output": "1" }, { "input": "2 1\n0\n1", "output": "1" }, { "input": "2 1\n1\n1", "output": "0" }, { "input": "1 1\n1", "output": "0" }, { "input": "4 4\n1 1 1 1\n1 0 0 1\n1 0 0 1\n1 1 1 1", "output": "16" } ]
1,479,634,787
2,087
Python 3
TIME_LIMIT_EXCEEDED
TESTS
43
1,000
921,600
n,m = (int(x) for x in input().split()) ups = [-1]*m downs = [-1]*m upbools = [True]*m colcount = [0]*m totalcount = 0 for i in range(n): left = -1 right = -1 lbool = True rowcount = 0 l = [int(x) for x in input().split()] for j in range(m): x = l[j] if x == 1: rowcount += 1 colcount[j] += 1 right = j downs[j] = i if upbools[j]: ups[j] = i upbools[j] = False if lbool: left = j lbool = False if left > -1 and right > -1: totalcount += 2*(m - rowcount) - left - (m-1-right) for j in range(m): if ups[j] > -1 and downs[j] > -1: totalcount += 2*(n - colcount[j]) - ups[j] - (n-1-downs[j]) print(totalcount)
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Theater stage is a rectangular field of size *n*<=×<=*m*. The director gave you the stage's plan which actors will follow. For each cell it is stated in the plan if there would be an actor in this cell or not. You are to place a spotlight on the stage in some good position. The spotlight will project light in one of the four directions (if you look at the stage from above) — left, right, up or down. Thus, the spotlight's position is a cell it is placed to and a direction it shines. A position is good if two conditions hold: - there is no actor in the cell the spotlight is placed to; - there is at least one actor in the direction the spotlight projects. Count the number of good positions for placing the spotlight. Two positions of spotlight are considered to be different if the location cells or projection direction differ. Input Specification: The first line contains two positive integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of rows and the number of columns in the plan. The next *n* lines contain *m* integers, 0 or 1 each — the description of the plan. Integer 1, means there will be an actor in the corresponding cell, while 0 means the cell will remain empty. It is guaranteed that there is at least one actor in the plan. Output Specification: Print one integer — the number of good positions for placing the spotlight. Demo Input: ['2 4\n0 1 0 0\n1 0 1 0\n', '4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0\n'] Demo Output: ['9\n', '20\n'] Note: In the first example the following positions are good: 1. the (1, 1) cell and right direction; 1. the (1, 1) cell and down direction; 1. the (1, 3) cell and left direction; 1. the (1, 3) cell and down direction; 1. the (1, 4) cell and left direction; 1. the (2, 2) cell and left direction; 1. the (2, 2) cell and up direction; 1. the (2, 2) and right direction; 1. the (2, 4) cell and left direction. Therefore, there are 9 good positions in this example.
```python n,m = (int(x) for x in input().split()) ups = [-1]*m downs = [-1]*m upbools = [True]*m colcount = [0]*m totalcount = 0 for i in range(n): left = -1 right = -1 lbool = True rowcount = 0 l = [int(x) for x in input().split()] for j in range(m): x = l[j] if x == 1: rowcount += 1 colcount[j] += 1 right = j downs[j] = i if upbools[j]: ups[j] = i upbools[j] = False if lbool: left = j lbool = False if left > -1 and right > -1: totalcount += 2*(m - rowcount) - left - (m-1-right) for j in range(m): if ups[j] > -1 and downs[j] > -1: totalcount += 2*(n - colcount[j]) - ups[j] - (n-1-downs[j]) print(totalcount) ```
0
593
B
Anton and Lines
PROGRAMMING
1,600
[ "geometry", "sortings" ]
null
null
The teacher gave Anton a large geometry homework, but he didn't do it (as usual) as he participated in a regular round on Codeforces. In the task he was given a set of *n* lines defined by the equations *y*<==<=*k**i*·*x*<=+<=*b**i*. It was necessary to determine whether there is at least one point of intersection of two of these lines, that lays strictly inside the strip between *x*1<=&lt;<=*x*2. In other words, is it true that there are 1<=≤<=*i*<=&lt;<=*j*<=≤<=*n* and *x*',<=*y*', such that: - *y*'<==<=*k**i*<=*<=*x*'<=+<=*b**i*, that is, point (*x*',<=*y*') belongs to the line number *i*; - *y*'<==<=*k**j*<=*<=*x*'<=+<=*b**j*, that is, point (*x*',<=*y*') belongs to the line number *j*; - *x*1<=&lt;<=*x*'<=&lt;<=*x*2, that is, point (*x*',<=*y*') lies inside the strip bounded by *x*1<=&lt;<=*x*2. You can't leave Anton in trouble, can you? Write a program that solves the given task.
The first line of the input contains an integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of lines in the task given to Anton. The second line contains integers *x*1 and *x*2 (<=-<=1<=000<=000<=≤<=*x*1<=&lt;<=*x*2<=≤<=1<=000<=000) defining the strip inside which you need to find a point of intersection of at least two lines. The following *n* lines contain integers *k**i*, *b**i* (<=-<=1<=000<=000<=≤<=*k**i*,<=*b**i*<=≤<=1<=000<=000) — the descriptions of the lines. It is guaranteed that all lines are pairwise distinct, that is, for any two *i*<=≠<=*j* it is true that either *k**i*<=≠<=*k**j*, or *b**i*<=≠<=*b**j*.
Print "Yes" (without quotes), if there is at least one intersection of two distinct lines, located strictly inside the strip. Otherwise print "No" (without quotes).
[ "4\n1 2\n1 2\n1 0\n0 1\n0 2\n", "2\n1 3\n1 0\n-1 3\n", "2\n1 3\n1 0\n0 2\n", "2\n1 3\n1 0\n0 3\n" ]
[ "NO", "YES", "YES", "NO" ]
In the first sample there are intersections located on the border of the strip, but there are no intersections located strictly inside it.
1,000
[ { "input": "4\n1 2\n1 2\n1 0\n0 1\n0 2", "output": "NO" }, { "input": "2\n1 3\n1 0\n-1 3", "output": "YES" }, { "input": "2\n1 3\n1 0\n0 2", "output": "YES" }, { "input": "2\n1 3\n1 0\n0 3", "output": "NO" }, { "input": "2\n0 1\n-1000000 1000000\n1000000 -1000000", "output": "NO" }, { "input": "2\n-1337 1888\n-1000000 1000000\n1000000 -1000000", "output": "YES" }, { "input": "2\n-1337 1888\n-1000000 1000000\n-999999 -1000000", "output": "NO" }, { "input": "15\n30 32\n-45 1\n-22 -81\n4 42\n-83 -19\n97 70\n55 -91\n-45 -64\n0 64\n11 96\n-16 76\n-46 52\n0 91\n31 -90\n6 75\n65 14", "output": "NO" }, { "input": "15\n-1 3\n2 -4\n0 -6\n-2 -5\n0 -1\n-1 -2\n3 6\n4 4\n0 -4\n1 5\n5 -4\n-5 -6\n3 -6\n5 -3\n-1 6\n-3 -1", "output": "YES" }, { "input": "5\n-197 -126\n0 -94\n-130 -100\n-84 233\n-173 -189\n61 -200", "output": "NO" }, { "input": "2\n9 10\n-7 -11\n9 2", "output": "NO" }, { "input": "3\n4 11\n-2 14\n2 -15\n-8 -15", "output": "YES" }, { "input": "2\n1 2\n2 -2\n0 2", "output": "NO" }, { "input": "10\n1 3\n1 5\n1 2\n1 4\n1 6\n1 3\n1 7\n1 -5\n1 -1\n1 1\n1 8", "output": "NO" }, { "input": "10\n22290 75956\n-66905 -22602\n-88719 12654\n-191 -81032\n0 -26057\n-39609 0\n0 51194\n2648 88230\n90584 15544\n0 23060\n-29107 26878", "output": "NO" }, { "input": "2\n-1337 1888\n100000 -100000\n99999 -100000", "output": "YES" }, { "input": "2\n-100000 100000\n100000 100000\n100000 99999", "output": "NO" }, { "input": "2\n-100000 100000\n100000 -100000\n99999 100000", "output": "NO" }, { "input": "2\n-100000 100000\n100000 100000\n100000 99876", "output": "NO" }, { "input": "2\n9 10\n4 -10\n-9 4", "output": "NO" }, { "input": "3\n4 7\n7 9\n0 10\n-7 2", "output": "NO" }, { "input": "4\n-4 -3\n4 -3\n10 -9\n5 -2\n0 9", "output": "NO" }, { "input": "5\n8 9\n0 -3\n0 -6\n-5 0\n-7 -2\n-4 9", "output": "NO" }, { "input": "6\n-7 8\n6 -1\n-10 -9\n4 8\n0 -2\n-6 -1\n3 -10", "output": "YES" }, { "input": "7\n5 7\n6 4\n-9 4\n-7 5\n1 -3\n5 -2\n7 -8\n6 -8", "output": "YES" }, { "input": "8\n-10 -2\n5 10\n9 7\n-8 -2\n0 6\n-9 0\n-6 2\n6 -8\n-3 2", "output": "YES" }, { "input": "9\n9 10\n8 -3\n9 8\n0 5\n10 1\n0 8\n5 -5\n-4 8\n0 10\n3 -10", "output": "NO" }, { "input": "10\n-1 0\n-2 4\n2 4\n-3 -7\n-2 -9\n7 6\n0 2\n1 4\n0 10\n0 -8\n-5 1", "output": "YES" }, { "input": "11\n3 8\n0 -9\n-8 -10\n3 4\n3 5\n2 1\n-5 4\n0 -10\n-7 6\n5 -4\n-9 -3\n5 1", "output": "YES" }, { "input": "3\n0 2\n10 0\n0 0\n8 2", "output": "YES" }, { "input": "2\n0 1000000\n0 0\n1000000 1000000", "output": "NO" }, { "input": "2\n515806 517307\n530512 500306\n520201 504696", "output": "NO" }, { "input": "2\n0 65536\n65536 0\n0 1", "output": "YES" }, { "input": "3\n1 3\n-1 5\n1 1\n0 4", "output": "YES" }, { "input": "2\n0 1000000\n1000000 1\n1 2", "output": "YES" }, { "input": "2\n0 3\n1 1\n2 1", "output": "NO" }, { "input": "2\n0 1\n1 0\n2 0", "output": "NO" }, { "input": "3\n1 3\n1 0\n-1 3\n0 10", "output": "YES" }, { "input": "2\n0 1000000\n1000000 1000000\n0 3", "output": "NO" }, { "input": "2\n0 1\n1 0\n-2 2", "output": "YES" }, { "input": "2\n5 1000000\n1000000 5\n5 5", "output": "NO" }, { "input": "4\n0 1\n0 0\n0 1\n1 0\n-1 1", "output": "YES" }, { "input": "2\n0 1000000\n1000000 1000000\n1 1", "output": "NO" }, { "input": "3\n0 1000000\n1000000 999999\n-1000000 1000000\n1000000 1000000", "output": "YES" }, { "input": "2\n-1000000 1000000\n2 3\n1 3", "output": "YES" }, { "input": "2\n0 1000000\n1000000 1\n2 2", "output": "YES" }, { "input": "2\n-1 1\n1 0\n-1 0", "output": "YES" }, { "input": "2\n0 1000000\n2200 1\n0 0", "output": "NO" }, { "input": "2\n1 999999\n999999 0\n1 0", "output": "NO" }, { "input": "2\n0 1\n1 0\n-1 1", "output": "YES" }, { "input": "2\n0 1000000\n999999 999999\n0 0", "output": "NO" }, { "input": "7\n0 1\n0 -1\n3 0\n5 0\n2 0\n4 0\n1 0\n0 100", "output": "NO" }, { "input": "2\n0 1000000\n1000000 0\n0 100", "output": "YES" }, { "input": "4\n0 1\n-1 2\n0 1\n1 0\n-1 0", "output": "NO" }, { "input": "3\n0 1\n0 1\n0 10\n2 0", "output": "YES" }, { "input": "4\n0 1\n3 0\n2 0\n1 0\n-1 3", "output": "YES" }, { "input": "2\n0 1000000\n10000 0\n100000 1", "output": "NO" }, { "input": "5\n-2 2\n2 0\n0 100000\n0 10000\n0 1000\n0 0", "output": "YES" }, { "input": "2\n0 1000000\n0 0\n2200 1", "output": "NO" }, { "input": "2\n0 1000000\n1 0\n1000000 1", "output": "NO" }, { "input": "2\n2 5\n2 -4\n3 -6", "output": "NO" }, { "input": "2\n-1 1\n0 0\n0 1", "output": "NO" }, { "input": "2\n900000 1000000\n900000 1000000\n1000000 900000", "output": "NO" } ]
1,698,090,931
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
53
748
12,697,600
n = int(input()) x1, x2 = map(int, input().split()) segments = [] for i in range(n): k, b = map(int, input().split()) y1 = x1 * k + b y2 = x2 * k + b segments.append((y1, y2)) #let's just test if they intersect in this interval segments.sort(key= lambda t: t[0]) #print(segments) for i in range(1, n): if segments[i][0] != segments[i - 1][0] and segments[i][1] < segments[i - 1][1]: print("Yes") break else: print("No")
Title: Anton and Lines Time Limit: None seconds Memory Limit: None megabytes Problem Description: The teacher gave Anton a large geometry homework, but he didn't do it (as usual) as he participated in a regular round on Codeforces. In the task he was given a set of *n* lines defined by the equations *y*<==<=*k**i*·*x*<=+<=*b**i*. It was necessary to determine whether there is at least one point of intersection of two of these lines, that lays strictly inside the strip between *x*1<=&lt;<=*x*2. In other words, is it true that there are 1<=≤<=*i*<=&lt;<=*j*<=≤<=*n* and *x*',<=*y*', such that: - *y*'<==<=*k**i*<=*<=*x*'<=+<=*b**i*, that is, point (*x*',<=*y*') belongs to the line number *i*; - *y*'<==<=*k**j*<=*<=*x*'<=+<=*b**j*, that is, point (*x*',<=*y*') belongs to the line number *j*; - *x*1<=&lt;<=*x*'<=&lt;<=*x*2, that is, point (*x*',<=*y*') lies inside the strip bounded by *x*1<=&lt;<=*x*2. You can't leave Anton in trouble, can you? Write a program that solves the given task. Input Specification: The first line of the input contains an integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of lines in the task given to Anton. The second line contains integers *x*1 and *x*2 (<=-<=1<=000<=000<=≤<=*x*1<=&lt;<=*x*2<=≤<=1<=000<=000) defining the strip inside which you need to find a point of intersection of at least two lines. The following *n* lines contain integers *k**i*, *b**i* (<=-<=1<=000<=000<=≤<=*k**i*,<=*b**i*<=≤<=1<=000<=000) — the descriptions of the lines. It is guaranteed that all lines are pairwise distinct, that is, for any two *i*<=≠<=*j* it is true that either *k**i*<=≠<=*k**j*, or *b**i*<=≠<=*b**j*. Output Specification: Print "Yes" (without quotes), if there is at least one intersection of two distinct lines, located strictly inside the strip. Otherwise print "No" (without quotes). Demo Input: ['4\n1 2\n1 2\n1 0\n0 1\n0 2\n', '2\n1 3\n1 0\n-1 3\n', '2\n1 3\n1 0\n0 2\n', '2\n1 3\n1 0\n0 3\n'] Demo Output: ['NO', 'YES', 'YES', 'NO'] Note: In the first sample there are intersections located on the border of the strip, but there are no intersections located strictly inside it.
```python n = int(input()) x1, x2 = map(int, input().split()) segments = [] for i in range(n): k, b = map(int, input().split()) y1 = x1 * k + b y2 = x2 * k + b segments.append((y1, y2)) #let's just test if they intersect in this interval segments.sort(key= lambda t: t[0]) #print(segments) for i in range(1, n): if segments[i][0] != segments[i - 1][0] and segments[i][1] < segments[i - 1][1]: print("Yes") break else: print("No") ```
0
335
B
Palindrome
PROGRAMMING
1,900
[ "constructive algorithms", "dp" ]
null
null
Given a string *s*, determine if it contains any palindrome of length exactly 100 as a subsequence. If it has any, print any one of them. If it doesn't have any, print a palindrome that is a subsequence of *s* and is as long as possible.
The only line of the input contains one string *s* of length *n* (1<=≤<=*n*<=≤<=5·104) containing only lowercase English letters.
If *s* contains a palindrome of length exactly 100 as a subsequence, print any palindrome of length 100 which is a subsequence of *s*. If *s* doesn't contain any palindromes of length exactly 100, print a palindrome that is a subsequence of *s* and is as long as possible. If there exists multiple answers, you are allowed to print any of them.
[ "bbbabcbbb\n", "rquwmzexectvnbanemsmdufrg\n" ]
[ "bbbcbbb\n", "rumenanemur\n" ]
A subsequence of a string is a string that can be derived from it by deleting some characters without changing the order of the remaining characters. A palindrome is a string that reads the same forward or backward.
1,000
[ { "input": "bbbabcbbb", "output": "bbbcbbb" }, { "input": "rquwmzexectvnbanemsmdufrg", "output": "rumenanemur" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa" }, { "input": "ab", "output": "a" }, { "input": "abacaba", "output": "abacaba" }, { "input": "startcup", "output": "trt" }, { "input": "aabccb", "output": "bccb" }, { "input": "abbacc", "output": "abba" }, { "input": "iwlauggytlpahjhteurdyoaulbnnhashwktxlrhpgqnypnuitmfhhbkwysjuhljshaanowhngeaumdovrlvuofzsbhhzdyngntdu", "output": "ugyhhurounhashwkhnpnhkwhsahnuoruhhygu" }, { "input": "zypzepzqni", "output": "zpepz" }, { "input": "a", "output": "a" }, { "input": "oliifeuoyzhkootktyulrxshmboejshoguwgufxpuloouoojovufukdokoeyouzihyaeuucutypfxictojtnfoouoniuyuvkrglsueihpuxsulrrifyuwuyolutotzozsvhoyjxuguecywbfuuqmpzooojergudvwucsocoojfplaulvfpcooxxublcfpguuoouooouo", "output": "ouooouoougpluoovufudooozuucuxjoouoyurlsupuslruyouoojxucuuzooodufuvooulpguoouooouo" }, { "input": "kyzxnaiwjgnotlekhycrnapekfcfxydbvnjboevgdzgigxvijgwrqnacumglzlxkcurmqmxzxxbuxlwruycdhzzdmtvobmvylyibyynjvonmbwvwqzmidfhnndecrwyfxjxwquiubrimmcwoeecotwnkfrojwuxmficzurwaqljfvdcvixcictxfzztzzbvbdypayhay", "output": "yahyapydbvbzixijqauzcurmmbuxwrcdhdmvbmvyybyyvmbvmdhdcrwxubmmruczuaqjixizbvbdypayhay" }, { "input": "carfnnnuxxbntssoxafxxbbxnonpunapjxtxexlptcwqxkjnxaanntriyunvnoxkdxnsxjxxoixyplkvxctuoenxxjixxgyxlgnxhklxqxqzxafxcnealxxwspbpcfgpnnovwrnnaxjcjpnierselogxxcxrxnlpnkbzjnqvrkurhxaxyjxxnxxnpipuntongeuusujf", "output": "fnnuxxnxxxxnnpnxxxlpcjxannrvoxxnxxxxlkxnxxixxnxklxxxxnxxovrnnaxjcplxxxnpnnxxxxnxxunnf" }, { "input": "yggmkggmvkfmmsvijnyvwgswdpwkwvmcmmswksmhwwmmgwzgwkkwogwiglwggwwnmwgkqggkugwmfwawxggrwgwclgwclknltxrkjwogwejgeymtmwziwmskrwsmfmmiwkwwvsgwsdmmkfmggkmpgg", "output": "ggmkggmfmmswgswwkwmmmswksmwwmmgwgwkkwgwgwggwwmwgkggkgwmwwggwgwgwkkwgwgmmwwmskwsmmmwkwwsgwsmmfmggkmgg" }, { "input": "mstmytylsulbuhumamahahbbmmtttmlulhamyhlmbulyylubmlhymahlulmtttmmbbhahamamuhubluslytymtsmxp", "output": "mstmytylsulbuhumamahahbbmmtttmlulhamyhlmbulyylubmlhymahlulmtttmmbbhahamamuhubluslytymtsm" }, { "input": "ouwvwggffgoowjzkzeggbzieagwwznzzzlwvzswfznvozveezgopefecoezfsofqzqfoovaofwzgefzzweggvztzvofgevivgevwwslhofzwopopzzgfvwzeogovvgzdzafgwzshovvrwwwgmooczezivfwgybgezogsmgfgwwzevvwgeehwvegfdzgzwgzoffgteztwvgwfvogeggfogkeovxzzlzzwzzlvifgxzwvrogeeeggeoefhhzoweerwvxofgvwovozwvizofzogozgwevwllexooktoggvoeowgtezffzfdohvgmofofvwzzofwvwsfbwyzzziofvfcofmzgrofzozzgghseafefdpwwwogpzzfowfhlsoeitfogeezfagofqqesocewfpwveozeenwsvffzwozwzlwoeffzonveaivgfebvegveozzfoowzwzkwezjeeuwzgezoovwwgzgzggwzowzevwfgggoozfozfwg", "output": "gzoggwveoggvoegezfzovgofowzzowvswzovfcofzgofosfwozzowfsofogzfocfvozwsvwozzwofogvozfzegeovggoevwggozg" }, { "input": "gamjuklsvzwddaocadujdmvlenyyvlflipneqofeyipmtunbdmbdyhkovnpdetueeiunsipowrhxrhtastjniqdhmehcumdcrghewljvpikcraoouhfwtnoaukbnykjapkvyakdnckkypargamvnsqtchesbmuffqqycnjvolmtpjfykvkeexkpdxjexrvdzpcbthhkxuucermkaebrvcxoovidpqnpkgbhiatyjvumihptrigqxsemqbbxwmyunmmayubqqjaioqmzyekhtqgoockiskyqihopmkastfvqiewtbtbriuyuszlndcweuhnywlkjgerqokxsxfxeaxcuwoocoonstwlxujrynkwzshpretbhlvkxyebnhafxfelpmqfkksurrfqeaykdxihtyqpaiftigdwkraxxzxkqicnfxlxhxwtkkknurzubtkivzpmlfebzduezuqeyequvyrighfzyldxenwxokumxtiieeeuku", "output": "uuemkexdhiyvuqequuzefvitbuzunkkxxfxxxrkwpthxyaeqfrrfqeayxhtpwkrxxxfxxkknuzubtivfezuuqequvyihdxekmeuu" }, { "input": "qpjnbjhmigtgtxolifwoyatdlqtejqovaslcgjufverrnkqxtsrrytqgtuikcseggjnltpggcpjizojthwycibvnvxetibpicujwmyzcojhpftttwvtlxaeefbvbvygouinnjrwuczlplbzahqciptrlrcuamyntvrzqxrnkrczmluocsuthwaptenwysoviwwcnrljuskynomlpslqyjcauagiveunrzognltohqxggprgreezjsqchcgihzbrleuwgnlsqeenybrbsqcnnlbipajlcfmajtchblnxsnegooewupmvufzbipnyjneuwelibvhoghtqpvqjehvpbiclalyzxzqwekemnsjabyzatjgzbrheubuzrcgtxvaokzapejesjntgnriupahoeousszcqprljhhgnqclbsuvvgfudhwmabfbyqjcqqgnnoocqxbyjpmvncmcieavcstjvvzgtbgcjbqnqbpueqlgibtvjpzsan", "output": "nspjvglqeqcgbgsenybqcnncjbwuvublghpqehpinsjazatgruurgtazajsnipheqphglbuvuwbjcnncqbynesgbgcqeqlgvjpsn" }, { "input": "nwgwxgxlbgbgnvqowqqocgwwnbnoqghxwxbbonxxgongqwbbxxbbwiqgnogxxnobmbxwxlgqonbnwhewgoqqwoqngbgbxgxwgwna", "output": "nwgwxgxbgbgnqowqqogwwnbnoqgxwxbbonxxgongqwbbxxbbwqgnogxxnobbxwxgqonbnwwgoqqwoqngbgbxgxwgwn" }, { "input": "vtaavlavalbvbbbccccddddeeeefltfffgvgvgtghlhhhiviiijjjjkkkkmmmmnnnlnooooppppqqvqqrrrrssssluuuvuwwwwtv", "output": "vtvlvlvltgvgvgtlvlvlvtv" }, { "input": "iuaiubcide", "output": "iuiui" }, { "input": "aavaaaadbbbddbbdbccccwvcceveeeedeffvdfvfffdggggvwgghhdhdwdhhhwiiwiiiiwjjjjjjkkkkdkklwvlllllmmmmmmvdnndnwndnndooowoooppppppwqwqdwqwqwdqqrdrwdrrrrsdssssvsttttttuvuuuwuuxxxdwwxwxdxyyyywyddwvdvdvdvvwddddv", "output": "vddddwvvdvdvdvwddwdwwwdwvvddwdqqdwqwqwdqqdwddvvwdwwwdwddwvdvdvdvvwddddv" }, { "input": "ibbbbiabbibbscccocccccdsdyddiddishddffjifhfffjffgggeggeggjgkkkjkkjkkklllaellllhlmymmmmssmmomnnanojennosasoennnjpopaopppspsyphepqaqqqjqqjqqrrjerrerrrrttttttttuuuujuhuiuuwwjwhswwwiwwxixxxyxsosixxxaizzzi", "output": "iiaisosyiishjihjeejjjaehyssoaojnnosasonnjoaossyheajjjeejhijhsiiysosiaii" }, { "input": "ataaaamabbbbtmbbmtmtccctcttcmmcmtdmmmmmddddtdmeetmtmmeteteeftffmfffgmmggggmgmmhmhhhmhhiimtiiititmmjjjtjjjkkmtmtkmkmkklllmllmmtmlnmnnmnnnootooooptpppttppqmqqtqmqqmtmrrrtrrrssssssuuuuuuvvvvvvwwwwwwxxxxx", "output": "tmtmmtmttttmmmtmmmmmtmtmtmmtttmmmgggggmmmtttmmtmtmtmmmmmtmmmttttmtmmtmt" }, { "input": "agqdhdgqgannagbqbbhddddcgngchnhdceeqefqhgfdngfdhiiidhjgqjjndqkgqnkkgqqndlldlqqmddmmnqoqgnoqgqdopnqghdhdgpndpghqrrqdhrsnhgnssgddddhtttqgnnguqgudhuvvdqg", "output": "gqdhdgqgnngqhddddgnghnhdqqhgdngdhdhgqndqgqngqqnddqqddnqqgnqgqdnqghdhdgndghqqdhnhgngddddhqgnngqgdhdqg" }, { "input": "hyhwkyvfpfpykwhchycwcpfppcuvuvupshcwwkwucpkppkpcuwkwwchspuvuvaucppfbpcwcyhchwkypfpfvykwhyh", "output": "hyhwkyvfpfpykwhchycwcpfppcuvuvupshcwwkwucpkppkpcuwkwwchspuvuvucppfpcwcyhchwkypfpfvykwhyh" }, { "input": "dpddpdddddidtddudddddqddddddddddddddddddddddcdddddddddddddddkkdddddgdddddddddjkdovfvvgnnvvvvvvvvvvnvvvvvkvvvvfnvuuvevvvfvvvpvvvkvvvvvvvvvlvvvifvvvvklvbvvovovvvvkvivnvvvvvvulvvvwwmjwtwwbwlwwwwwwwwwwpewewwwwwpwwwwwwwwwwwwwwwwwwlwbtwwwwjwmwwwwwlwwuwnwwwwiwwkwwwwwwwwxxxxxxoxxxoxxxbxxxxlxxxxxxxxxxxxxxxxkxxxxfixlxxxxxkpxfxxxxxxxxxxxxxexxxuuxxxxxxxxxyynyyyyyyyyyyfkyynynyynyyyyyyygyyyyyyyyyyyyyfyyoyyyyyyykyyyyyyjyyyyyyygykyykyyycyyqyzzzzzzzzzzzzzzzzzzuzzzzzzzzzzztzzzizppzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz", "output": "pnuuefpklifklboowwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwooblkfilkpfeuunp" }, { "input": "aaaaaaaaakaaakaaaaaabbbbbbbbbbbxbbxbkbbbkxbcccccccccicccccccccddkdxdddkdkddddddkdddddikekeeeeeeeekeeeeeeeixieeffxfffffffffifffffffgikiigggggggggiggggggxgghhhhhkhhhhhhhhhhxhhhjjjjjiijjjjijjjjjxkjkjjjllllllllllkllllllllmmmmmimmmmmmmmmmmmmnnnnnnnnnnnnnnnknnnoooookooioooxioooooooopppppppppppippppxkpkkkppqqxqqqqqqqqiqiqqqqxiqqkqrrkrrrirrrrrrrrrrrrrssskskskssssssssxsssssiittttittxtttttttktttttuxuuuuuiiuuuuuuuuuuikuuvvvvivvixvvvvvvvvvivvvwxiwwwwwwwwwwwkwkwkwwwiwykyyyyyykyyykyxyyyyyyyzzzzzkzizzzzxkkxxkk", "output": "kxkkxikxkkkikkkixixiikiiixkxiiixkkkikkixippppppppppppppppppixikkikkkxiiixkxiiikiixixikkkikkkxkixkkxk" }, { "input": "aaaaaakaaaaaaaaaaaataaabbbbrbbbbbbbbbxbbbbbxbbbkctcccccccccccccncckcccccnddddrdddddddddddddddddnteeeeeeeeeeneteeneeeeeeeefffffffffnnffffffffnffffgggggggggtrgggrggggggggghhhhhhhhhnhhxhhhhhhhkhhhitiiiiiiiintiiiikiiiiiiiijxjjjjjjxjjjkjjjjjjjtjjjjlllllntllllllllllllkllllmmxmmmmmmmmmmmmmmmmmmmoooooooooooooonoooooooppprpppprppppptppnpppppppqqqqnnqqqqqqqqqqqqqqqqqssnsssssssstssnssssstssssuunuuuuuruunuuuuuuuukuuuuvvvvvvvvvvvvnvvvvvvvvvwwtwwwwwwwwkwwwwwwwwwxwwyyyyyyxyyyyyyyryyyyyyyyzzzzzzzztzzzzzzzkzzzzz", "output": "ktrxxktnknrntntnnnntrrnxktnjjjjjjjjjjkjjjjjjjjjjntkxnrrtnnnntntnrnkntkxxrtk" }, { "input": "afcyfydfxueffbukxgbhfkuufkbubkxiybuuufffkkyyxxbxfbffffbfxbxjxylykkmfffuuubyxkbubkfuukfbxkubffuxfyfyf", "output": "fyfyfxuffbukxbfkuufkbubkxybuuufffkkyyxxbxfbffffbfxbxxyykkfffuuubyxkbubkfuukfbxkubffuxfyfyf" }, { "input": "b", "output": "b" }, { "input": "abababbabbabbabbbbbbbbabbabbaaaaaaaabbbabbabbbabbbabaaabbaba", "output": "ababbaababbbbbbabbabbaaaaaaaabbabbabbbbbbabaabbaba" }, { "input": "ttabacabadabffacavvbaeabacabadabacabafabacabavvvvdabacabzaeabacabadabacttttafba", "output": "abacabadabacabaeabacabadabacabafabacabadabacabaeabacabadabacaba" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccdddddddddddddddeeeeeeeeeeeeeeeeeeeeeeeeee", "output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccdddddddddddddddeeeeeeeeeeeeeeeeeeeeeeeeee", "output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccdddddddddddddddeeeeeeeeeeeeeeeeeeeeeeeeeezzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz", "output": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz" }, { "input": "qwertyuioplkjhgfdsazxcvbnm", "output": "q" }, { "input": "abaabacdefgb", "output": "abaaba" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaazaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa" }, { "input": "gsayhacnaqwakieoeyomukmqueosoeuckuotyadhoniaovwgnbcpczjnibhgyapqmuosbrpqwkckqjakqjeamyqqwskmoueaakfixextmcwyaqdhtlylnowuiaaoraeskkqaohbwcupgsdcngyavctnaqaaaqomimemckzkaagaebucmjuwacaoicyoywkwmogdiknzqiakackvzgrywxfiojdkopsnsifwwcwkwuqqpfpuaeigcfjebbuakkaquajyelivanwewaq", "output": "qwaieyuqueeukodoiwgcznigowkcaawmueaakemaqtynuoakkaounytqamekaaeumwaackwoginzcgwiodokueeuquyeiawq" }, { "input": "amltiwwuisnsaghiiwoaqgdgnpqkfudobascczacwipotugyeairyrcsgsuxxttsxaausijymcceapckvxfqnqdg", "output": "gdnqfcacyisuxttxusiycacfqndg" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa" }, { "input": "abababababababababababababababababababababababababcbababababababababababababababababababababababababa", "output": "abababababababababababababababababababababababababbababababababababababababababababababababababababa" }, { "input": "aaaaaaaaaabbbbbbbbbbccccccccccddddddddddeeeeeeeeeefeeeeeeeeeeddddddddddccccccccccbbbbbbbbbbaaaaaaaaaa", "output": "aaaaaaaaaabbbbbbbbbbccccccccccddddddddddeeeeeeeeeeeeeeeeeeeeddddddddddccccccccccbbbbbbbbbbaaaaaaaaaa" } ]
1,664,456,180
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
62
0
""" Question Link: """ from collections import Counter import sys # the setrecursionlimit function is # used to modify the default recursion # limit set by python. Using this, # we can increase the recursion limit # to satisfy our needs sys.setrecursionlimit(10**6) memo = {} text = "" def get100Palindrome(left, right, collected): if left >= len(text) or right < 0 or collected == 100: return "" if left == right: return text[left] if (left, right) in memo: return memo[(left, right)] if text[left] == text[right]: memo[(left, right)] = text[left] + get100Palindrome(left+1, right - 1, collected + 2) + text[right] return memo[(left, right)] takeRight = get100Palindrome(left + 1, right, collected) takeLeft = get100Palindrome(left, right - 1, collected) if len(takeRight) > len(takeLeft): memo[(left, right)] = takeRight else: memo[(left, right)] = takeLeft return memo[(left, right)] if __name__ == '__main__': # for _ in range(int(input())): text = input() print(len(text)) if len(text) <= 2600: print(get100Palindrome(0, len(text) - 1, 0)) else: count = Counter(text) for i in count: if count[i] >= 100: print(i * 100) break
Title: Palindrome Time Limit: None seconds Memory Limit: None megabytes Problem Description: Given a string *s*, determine if it contains any palindrome of length exactly 100 as a subsequence. If it has any, print any one of them. If it doesn't have any, print a palindrome that is a subsequence of *s* and is as long as possible. Input Specification: The only line of the input contains one string *s* of length *n* (1<=≤<=*n*<=≤<=5·104) containing only lowercase English letters. Output Specification: If *s* contains a palindrome of length exactly 100 as a subsequence, print any palindrome of length 100 which is a subsequence of *s*. If *s* doesn't contain any palindromes of length exactly 100, print a palindrome that is a subsequence of *s* and is as long as possible. If there exists multiple answers, you are allowed to print any of them. Demo Input: ['bbbabcbbb\n', 'rquwmzexectvnbanemsmdufrg\n'] Demo Output: ['bbbcbbb\n', 'rumenanemur\n'] Note: A subsequence of a string is a string that can be derived from it by deleting some characters without changing the order of the remaining characters. A palindrome is a string that reads the same forward or backward.
```python """ Question Link: """ from collections import Counter import sys # the setrecursionlimit function is # used to modify the default recursion # limit set by python. Using this, # we can increase the recursion limit # to satisfy our needs sys.setrecursionlimit(10**6) memo = {} text = "" def get100Palindrome(left, right, collected): if left >= len(text) or right < 0 or collected == 100: return "" if left == right: return text[left] if (left, right) in memo: return memo[(left, right)] if text[left] == text[right]: memo[(left, right)] = text[left] + get100Palindrome(left+1, right - 1, collected + 2) + text[right] return memo[(left, right)] takeRight = get100Palindrome(left + 1, right, collected) takeLeft = get100Palindrome(left, right - 1, collected) if len(takeRight) > len(takeLeft): memo[(left, right)] = takeRight else: memo[(left, right)] = takeLeft return memo[(left, right)] if __name__ == '__main__': # for _ in range(int(input())): text = input() print(len(text)) if len(text) <= 2600: print(get100Palindrome(0, len(text) - 1, 0)) else: count = Counter(text) for i in count: if count[i] >= 100: print(i * 100) break ```
0
215
B
Olympic Medal
PROGRAMMING
1,300
[ "greedy", "math" ]
null
null
The World Programming Olympics Medal is a metal disk, consisting of two parts: the first part is a ring with outer radius of *r*1 cm, inner radius of *r*2 cm, (0<=&lt;<=*r*2<=&lt;<=*r*1) made of metal with density *p*1 g/cm3. The second part is an inner disk with radius *r*2 cm, it is made of metal with density *p*2 g/cm3. The disk is nested inside the ring. The Olympic jury decided that *r*1 will take one of possible values of *x*1,<=*x*2,<=...,<=*x**n*. It is up to jury to decide which particular value *r*1 will take. Similarly, the Olympic jury decided that *p*1 will take one of possible value of *y*1,<=*y*2,<=...,<=*y**m*, and *p*2 will take a value from list *z*1,<=*z*2,<=...,<=*z**k*. According to most ancient traditions the ratio between the outer ring mass *m**out* and the inner disk mass *m**in* must equal , where *A*,<=*B* are constants taken from ancient books. Now, to start making medals, the jury needs to take values for *r*1, *p*1, *p*2 and calculate the suitable value of *r*2. The jury wants to choose the value that would maximize radius *r*2. Help the jury find the sought value of *r*2. Value *r*2 doesn't have to be an integer. Medal has a uniform thickness throughout the area, the thickness of the inner disk is the same as the thickness of the outer ring.
The first input line contains an integer *n* and a sequence of integers *x*1,<=*x*2,<=...,<=*x**n*. The second input line contains an integer *m* and a sequence of integers *y*1,<=*y*2,<=...,<=*y**m*. The third input line contains an integer *k* and a sequence of integers *z*1,<=*z*2,<=...,<=*z**k*. The last line contains two integers *A* and *B*. All numbers given in the input are positive and do not exceed 5000. Each of the three sequences contains distinct numbers. The numbers in the lines are separated by spaces.
Print a single real number — the sought value *r*2 with absolute or relative error of at most 10<=-<=6. It is guaranteed that the solution that meets the problem requirements exists.
[ "3 1 2 3\n1 2\n3 3 2 1\n1 2\n", "4 2 3 6 4\n2 1 2\n3 10 6 8\n2 1\n" ]
[ "2.683281573000\n", "2.267786838055\n" ]
In the first sample the jury should choose the following values: *r*<sub class="lower-index">1</sub> = 3, *p*<sub class="lower-index">1</sub> = 2, *p*<sub class="lower-index">2</sub> = 1.
500
[ { "input": "3 1 2 3\n1 2\n3 3 2 1\n1 2", "output": "2.683281573000" }, { "input": "4 2 3 6 4\n2 1 2\n3 10 6 8\n2 1", "output": "2.267786838055" }, { "input": "1 5\n1 3\n1 7\n515 892", "output": "3.263613058533" }, { "input": "2 3 2\n3 2 3 1\n2 2 1\n733 883", "output": "2.655066678191" }, { "input": "2 4 2\n3 1 2 3\n2 2 3\n676 769", "output": "3.176161549164" }, { "input": "2 4 2\n3 2 3 1\n2 3 1\n772 833", "output": "3.496252962144" }, { "input": "2 1 2\n3 2 3 1\n2 1 3\n452 219", "output": "1.539383784060" }, { "input": "2 3 2\n3 3 2 1\n2 3 2\n417 202", "output": "1.946150045603" }, { "input": "2 1 2\n3 1 2 3\n2 3 2\n596 206", "output": "1.168651298016" }, { "input": "2 1 2\n3 3 1 2\n2 2 3\n306 406", "output": "1.631654093847" }, { "input": "2 3 2\n3 3 1 2\n2 2 1\n881 165", "output": "1.799345811354" }, { "input": "2 2 4\n3 1 2 3\n2 2 1\n618 401", "output": "3.251156175034" }, { "input": "10 24 2621 2533 3148 3544 4273 4921 2950 3780 4483\n10 1687 4906 4246 2814 1874 3020 3039 3971 102 492\n10 3458 2699 2463 4395 3607 550 1608 958 3970 3077\n4 891", "output": "4919.762124668494" }, { "input": "1 5000\n1 5000\n1 1\n1 5000", "output": "4999.999900000003" }, { "input": "1 1\n1 1\n1 5000\n5000 1", "output": "0.000199999996" }, { "input": "3 5000 4999 4998\n3 5000 4999 4998\n4 1 2 3 4\n1 5000", "output": "4999.999900000003" }, { "input": "3 1 2 3\n3 1 2 3\n3 5000 4999 4998\n5000 1", "output": "0.001039438331" }, { "input": "3 1 2 3\n1 2\n3 3 2 1\n54 58", "output": "2.478139719747" }, { "input": "3 1 2 3\n1 2\n3 3 2 1\n52 56", "output": "2.479181611624" }, { "input": "3 1 2 3\n1 2\n3 3 2 1\n51 55", "output": "2.479731502196" }, { "input": "3 1 2 3\n1 2\n3 3 2 1\n55 59", "output": "2.477645721991" }, { "input": "3 1 2 3\n1 2\n3 1 2 3\n53 57", "output": "2.478651362102" }, { "input": "13 1 2 3 4 5 6 7 8 9 10 11 12 13\n1 14\n2 15 16\n17 18", "output": "9.165151389912" } ]
1,620,970,652
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
3
92
6,963,200
import math R1 = input().split(" ") P1 = input().split(" ") P2 = input().split(" ") ab = input().split(" ") a = float(ab[0]) b = float(ab[1]) def maximum(lst): max = -1 for el in lst: if float(el) > max: max = float(el) return max def minimum(lst): min = float('inf') for el in lst: if float(el) < min: min = float(el) return min r1 = maximum( R1[1:] ) p2 = minimum( P2[1:]) r2 = 0 max = -1 for p1i in P1: nominator = b * float(p1i) * r1**2 denominator = a*p2 + b* float(p1i) r2 = math.sqrt(nominator / denominator) if(r2 > max): max = r2 print(r2)
Title: Olympic Medal Time Limit: None seconds Memory Limit: None megabytes Problem Description: The World Programming Olympics Medal is a metal disk, consisting of two parts: the first part is a ring with outer radius of *r*1 cm, inner radius of *r*2 cm, (0<=&lt;<=*r*2<=&lt;<=*r*1) made of metal with density *p*1 g/cm3. The second part is an inner disk with radius *r*2 cm, it is made of metal with density *p*2 g/cm3. The disk is nested inside the ring. The Olympic jury decided that *r*1 will take one of possible values of *x*1,<=*x*2,<=...,<=*x**n*. It is up to jury to decide which particular value *r*1 will take. Similarly, the Olympic jury decided that *p*1 will take one of possible value of *y*1,<=*y*2,<=...,<=*y**m*, and *p*2 will take a value from list *z*1,<=*z*2,<=...,<=*z**k*. According to most ancient traditions the ratio between the outer ring mass *m**out* and the inner disk mass *m**in* must equal , where *A*,<=*B* are constants taken from ancient books. Now, to start making medals, the jury needs to take values for *r*1, *p*1, *p*2 and calculate the suitable value of *r*2. The jury wants to choose the value that would maximize radius *r*2. Help the jury find the sought value of *r*2. Value *r*2 doesn't have to be an integer. Medal has a uniform thickness throughout the area, the thickness of the inner disk is the same as the thickness of the outer ring. Input Specification: The first input line contains an integer *n* and a sequence of integers *x*1,<=*x*2,<=...,<=*x**n*. The second input line contains an integer *m* and a sequence of integers *y*1,<=*y*2,<=...,<=*y**m*. The third input line contains an integer *k* and a sequence of integers *z*1,<=*z*2,<=...,<=*z**k*. The last line contains two integers *A* and *B*. All numbers given in the input are positive and do not exceed 5000. Each of the three sequences contains distinct numbers. The numbers in the lines are separated by spaces. Output Specification: Print a single real number — the sought value *r*2 with absolute or relative error of at most 10<=-<=6. It is guaranteed that the solution that meets the problem requirements exists. Demo Input: ['3 1 2 3\n1 2\n3 3 2 1\n1 2\n', '4 2 3 6 4\n2 1 2\n3 10 6 8\n2 1\n'] Demo Output: ['2.683281573000\n', '2.267786838055\n'] Note: In the first sample the jury should choose the following values: *r*<sub class="lower-index">1</sub> = 3, *p*<sub class="lower-index">1</sub> = 2, *p*<sub class="lower-index">2</sub> = 1.
```python import math R1 = input().split(" ") P1 = input().split(" ") P2 = input().split(" ") ab = input().split(" ") a = float(ab[0]) b = float(ab[1]) def maximum(lst): max = -1 for el in lst: if float(el) > max: max = float(el) return max def minimum(lst): min = float('inf') for el in lst: if float(el) < min: min = float(el) return min r1 = maximum( R1[1:] ) p2 = minimum( P2[1:]) r2 = 0 max = -1 for p1i in P1: nominator = b * float(p1i) * r1**2 denominator = a*p2 + b* float(p1i) r2 = math.sqrt(nominator / denominator) if(r2 > max): max = r2 print(r2) ```
0
195
A
Let's Watch Football
PROGRAMMING
1,000
[ "binary search", "brute force", "math" ]
null
null
Valeric and Valerko missed the last Euro football game, so they decided to watch the game's key moments on the Net. They want to start watching as soon as possible but the connection speed is too low. If they turn on the video right now, it will "hang up" as the size of data to watch per second will be more than the size of downloaded data per second. The guys want to watch the whole video without any pauses, so they have to wait some integer number of seconds for a part of the video to download. After this number of seconds passes, they can start watching. Waiting for the whole video to download isn't necessary as the video can download after the guys started to watch. Let's suppose that video's length is *c* seconds and Valeric and Valerko wait *t* seconds before the watching. Then for any moment of time *t*0, *t*<=≤<=*t*0<=≤<=*c*<=+<=*t*, the following condition must fulfill: the size of data received in *t*0 seconds is not less than the size of data needed to watch *t*0<=-<=*t* seconds of the video. Of course, the guys want to wait as little as possible, so your task is to find the minimum integer number of seconds to wait before turning the video on. The guys must watch the video without pauses.
The first line contains three space-separated integers *a*, *b* and *c* (1<=≤<=*a*,<=*b*,<=*c*<=≤<=1000,<=*a*<=&gt;<=*b*). The first number (*a*) denotes the size of data needed to watch one second of the video. The second number (*b*) denotes the size of data Valeric and Valerko can download from the Net per second. The third number (*c*) denotes the video's length in seconds.
Print a single number — the minimum integer number of seconds that Valeric and Valerko must wait to watch football without pauses.
[ "4 1 1\n", "10 3 2\n", "13 12 1\n" ]
[ "3\n", "5\n", "1\n" ]
In the first sample video's length is 1 second and it is necessary 4 units of data for watching 1 second of video, so guys should download 4 · 1 = 4 units of data to watch the whole video. The most optimal way is to wait 3 seconds till 3 units of data will be downloaded and then start watching. While guys will be watching video 1 second, one unit of data will be downloaded and Valerik and Valerko will have 4 units of data by the end of watching. Also every moment till the end of video guys will have more data then necessary for watching. In the second sample guys need 2 · 10 = 20 units of data, so they have to wait 5 seconds and after that they will have 20 units before the second second ends. However, if guys wait 4 seconds, they will be able to watch first second of video without pauses, but they will download 18 units of data by the end of second second and it is less then necessary.
500
[ { "input": "4 1 1", "output": "3" }, { "input": "10 3 2", "output": "5" }, { "input": "13 12 1", "output": "1" }, { "input": "2 1 3", "output": "3" }, { "input": "6 2 4", "output": "8" }, { "input": "5 2 1", "output": "2" }, { "input": "2 1 1", "output": "1" }, { "input": "2 1 4", "output": "4" }, { "input": "5 1 5", "output": "20" }, { "input": "2 1 2", "output": "2" }, { "input": "60 16 1", "output": "3" }, { "input": "64 12 8", "output": "35" }, { "input": "66 38 4", "output": "3" }, { "input": "70 32 1", "output": "2" }, { "input": "24 12 12", "output": "12" }, { "input": "24 19 9", "output": "3" }, { "input": "244 87 4", "output": "8" }, { "input": "305 203 421", "output": "212" }, { "input": "888 777 1", "output": "1" }, { "input": "888 777 1000", "output": "143" }, { "input": "888 777 888", "output": "127" }, { "input": "5 4 10", "output": "3" }, { "input": "1000 1 1", "output": "999" }, { "input": "1000 1 1000", "output": "999000" }, { "input": "1000 999 1", "output": "1" }, { "input": "1000 999 1000", "output": "2" }, { "input": "945 812 917", "output": "151" }, { "input": "993 992 991", "output": "1" }, { "input": "17 7 10", "output": "15" }, { "input": "17 10 7", "output": "5" }, { "input": "500 300 300", "output": "200" }, { "input": "196 169 144", "output": "24" }, { "input": "7 3 200", "output": "267" }, { "input": "9 3 300", "output": "600" }, { "input": "561 31 917", "output": "15678" }, { "input": "100 10 1", "output": "9" }, { "input": "1000 100 10", "output": "90" }, { "input": "18 14 10", "output": "3" }, { "input": "93 74 831", "output": "214" }, { "input": "960 935 994", "output": "27" }, { "input": "894 1 999", "output": "892107" }, { "input": "767 2 514", "output": "196605" }, { "input": "765 123 45", "output": "235" }, { "input": "1000 1 1000", "output": "999000" }, { "input": "765 123 899", "output": "4693" }, { "input": "759 10 258", "output": "19325" }, { "input": "100 1 10", "output": "990" }, { "input": "99 8 99", "output": "1127" }, { "input": "27 26 1", "output": "1" } ]
1,698,107,546
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
3
92
0
from math import ceil def can_watch_video(a, b, c, t): total_data_needed = a * c downloaded_data = b * t data_left = total_data_needed - downloaded_data time_needed = data_left / b time_covered = ceil(downloaded_data / a) return time_covered >= time_needed def minimum_wait_time(a, b, c): left, right = 0, ((a*c) // b) while left < right: mid = (left + right) // 2 if can_watch_video(a, b, c, mid): right = mid else: left = mid + 1 return left a, b, c = map(int, input().split()) result = minimum_wait_time(a, b, c) print(result)
Title: Let's Watch Football Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valeric and Valerko missed the last Euro football game, so they decided to watch the game's key moments on the Net. They want to start watching as soon as possible but the connection speed is too low. If they turn on the video right now, it will "hang up" as the size of data to watch per second will be more than the size of downloaded data per second. The guys want to watch the whole video without any pauses, so they have to wait some integer number of seconds for a part of the video to download. After this number of seconds passes, they can start watching. Waiting for the whole video to download isn't necessary as the video can download after the guys started to watch. Let's suppose that video's length is *c* seconds and Valeric and Valerko wait *t* seconds before the watching. Then for any moment of time *t*0, *t*<=≤<=*t*0<=≤<=*c*<=+<=*t*, the following condition must fulfill: the size of data received in *t*0 seconds is not less than the size of data needed to watch *t*0<=-<=*t* seconds of the video. Of course, the guys want to wait as little as possible, so your task is to find the minimum integer number of seconds to wait before turning the video on. The guys must watch the video without pauses. Input Specification: The first line contains three space-separated integers *a*, *b* and *c* (1<=≤<=*a*,<=*b*,<=*c*<=≤<=1000,<=*a*<=&gt;<=*b*). The first number (*a*) denotes the size of data needed to watch one second of the video. The second number (*b*) denotes the size of data Valeric and Valerko can download from the Net per second. The third number (*c*) denotes the video's length in seconds. Output Specification: Print a single number — the minimum integer number of seconds that Valeric and Valerko must wait to watch football without pauses. Demo Input: ['4 1 1\n', '10 3 2\n', '13 12 1\n'] Demo Output: ['3\n', '5\n', '1\n'] Note: In the first sample video's length is 1 second and it is necessary 4 units of data for watching 1 second of video, so guys should download 4 · 1 = 4 units of data to watch the whole video. The most optimal way is to wait 3 seconds till 3 units of data will be downloaded and then start watching. While guys will be watching video 1 second, one unit of data will be downloaded and Valerik and Valerko will have 4 units of data by the end of watching. Also every moment till the end of video guys will have more data then necessary for watching. In the second sample guys need 2 · 10 = 20 units of data, so they have to wait 5 seconds and after that they will have 20 units before the second second ends. However, if guys wait 4 seconds, they will be able to watch first second of video without pauses, but they will download 18 units of data by the end of second second and it is less then necessary.
```python from math import ceil def can_watch_video(a, b, c, t): total_data_needed = a * c downloaded_data = b * t data_left = total_data_needed - downloaded_data time_needed = data_left / b time_covered = ceil(downloaded_data / a) return time_covered >= time_needed def minimum_wait_time(a, b, c): left, right = 0, ((a*c) // b) while left < right: mid = (left + right) // 2 if can_watch_video(a, b, c, mid): right = mid else: left = mid + 1 return left a, b, c = map(int, input().split()) result = minimum_wait_time(a, b, c) print(result) ```
0
75
A
Life Without Zeros
PROGRAMMING
1,000
[ "implementation" ]
A. Life Without Zeros
2
256
Can you imagine our life if we removed all zeros from it? For sure we will have many problems. In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros? For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation. But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation.
The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*.
The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise.
[ "101\n102\n", "105\n106\n" ]
[ "YES\n", "NO\n" ]
none
500
[ { "input": "101\n102", "output": "YES" }, { "input": "105\n106", "output": "NO" }, { "input": "544\n397", "output": "YES" }, { "input": "822\n280", "output": "NO" }, { "input": "101\n413", "output": "NO" }, { "input": "309\n139", "output": "NO" }, { "input": "693\n970", "output": "NO" }, { "input": "981\n1", "output": "YES" }, { "input": "352\n276", "output": "YES" }, { "input": "164\n691", "output": "YES" }, { "input": "110036\n43", "output": "YES" }, { "input": "100\n1000", "output": "NO" }, { "input": "1000000000\n1000000000", "output": "YES" }, { "input": "999999999\n999999999", "output": "YES" }, { "input": "6\n4", "output": "NO" }, { "input": "123456\n876543", "output": "YES" }, { "input": "1234567\n9876543", "output": "NO" }, { "input": "1111111\n1119111", "output": "NO" }, { "input": "10502405\n40403403", "output": "YES" }, { "input": "1\n1", "output": "YES" }, { "input": "5\n4", "output": "YES" }, { "input": "1\n6", "output": "YES" }, { "input": "40\n17", "output": "NO" }, { "input": "35\n81", "output": "YES" }, { "input": "347\n908", "output": "NO" }, { "input": "2081\n7450", "output": "NO" }, { "input": "84355694\n373629503", "output": "NO" }, { "input": "885992048\n510468672", "output": "NO" }, { "input": "540144752\n647307841", "output": "NO" }, { "input": "341781108\n784147010", "output": "NO" }, { "input": "960440938\n572334653", "output": "NO" }, { "input": "657414510\n768771903", "output": "NO" }, { "input": "501871728\n725074574", "output": "NO" }, { "input": "968\n851", "output": "YES" }, { "input": "943\n939", "output": "YES" }, { "input": "347\n908", "output": "NO" }, { "input": "611\n41", "output": "YES" }, { "input": "737\n289", "output": "NO" }, { "input": "168\n571", "output": "YES" }, { "input": "868\n463", "output": "YES" }, { "input": "815732007\n913882008", "output": "NO" }, { "input": "459039901\n453033850", "output": "NO" }, { "input": "975305404\n484601256", "output": "NO" } ]
1,558,252,897
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
186
0
import math a = int(input()) b = int(input()) def count(a): i = 0 while(a > 0): x = a%10 if(x != 0): i = i + 1 a = a//10 return i def removedzero(a): s= 0 j = 0 while(a > 0): x = a%10 if(x == 0): s = s + 0 else: s = s + x * pow(10, count(a) - 1) a = a//10 return s s = a + b if(removedzero(a)+removedzero(b )== removedzero(s)): print("YES") else: print("NO")
Title: Life Without Zeros Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Can you imagine our life if we removed all zeros from it? For sure we will have many problems. In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros? For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation. But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation. Input Specification: The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*. Output Specification: The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise. Demo Input: ['101\n102\n', '105\n106\n'] Demo Output: ['YES\n', 'NO\n'] Note: none
```python import math a = int(input()) b = int(input()) def count(a): i = 0 while(a > 0): x = a%10 if(x != 0): i = i + 1 a = a//10 return i def removedzero(a): s= 0 j = 0 while(a > 0): x = a%10 if(x == 0): s = s + 0 else: s = s + x * pow(10, count(a) - 1) a = a//10 return s s = a + b if(removedzero(a)+removedzero(b )== removedzero(s)): print("YES") else: print("NO") ```
0
319
C
Kalila and Dimna in the Logging Industry
PROGRAMMING
2,100
[ "dp", "geometry" ]
null
null
Kalila and Dimna are two jackals living in a huge jungle. One day they decided to join a logging factory in order to make money. The manager of logging factory wants them to go to the jungle and cut *n* trees with heights *a*1,<=*a*2,<=...,<=*a**n*. They bought a chain saw from a shop. Each time they use the chain saw on the tree number *i*, they can decrease the height of this tree by one unit. Each time that Kalila and Dimna use the chain saw, they need to recharge it. Cost of charging depends on the id of the trees which have been cut completely (a tree is cut completely if its height equal to 0). If the maximum id of a tree which has been cut completely is *i* (the tree that have height *a**i* in the beginning), then the cost of charging the chain saw would be *b**i*. If no tree is cut completely, Kalila and Dimna cannot charge the chain saw. The chainsaw is charged in the beginning. We know that for each *i* &lt; *j*, *a**i*<=&lt;<=*a**j* and *b**i*<=&gt;<=*b**j* and also *b**n*<==<=0 and *a*1<==<=1. Kalila and Dimna want to cut all the trees completely, with minimum cost. They want you to help them! Will you?
The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=105). The second line of input contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109). The third line of input contains *n* integers *b*1,<=*b*2,<=...,<=*b**n* (0<=≤<=*b**i*<=≤<=109). It's guaranteed that *a*1<==<=1, *b**n*<==<=0, *a*1<=&lt;<=*a*2<=&lt;<=...<=&lt;<=*a**n* and *b*1<=&gt;<=*b*2<=&gt;<=...<=&gt;<=*b**n*.
The only line of output must contain the minimum cost of cutting all the trees completely. Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
[ "5\n1 2 3 4 5\n5 4 3 2 0\n", "6\n1 2 3 10 20 30\n6 5 4 3 2 0\n" ]
[ "25\n", "138\n" ]
none
1,500
[ { "input": "5\n1 2 3 4 5\n5 4 3 2 0", "output": "25" }, { "input": "6\n1 2 3 10 20 30\n6 5 4 3 2 0", "output": "138" } ]
1,509,295,575
2,147,483,647
PyPy 3
OK
TESTS
24
608
13,312,000
f = lambda: list(map(int, input().split())) g = lambda j: a[i] * b[j] + t[j] h = lambda j, k: (t[i] - t[j]) * (b[j] - b[k]) < (t[j] - t[k]) * (b[i] - b[j]) n = int(input()) a, b = f(), f() t = [0] * n p = [0] for i in range(1, n): while len(p) > 1 and g(p[1]) < g(p[0]): p.pop(0) t[i] = g(p[0]) while len(p) > 1 and h(p[-2], p[-1]): p.pop() p.append(i) print(t[-1])
Title: Kalila and Dimna in the Logging Industry Time Limit: None seconds Memory Limit: None megabytes Problem Description: Kalila and Dimna are two jackals living in a huge jungle. One day they decided to join a logging factory in order to make money. The manager of logging factory wants them to go to the jungle and cut *n* trees with heights *a*1,<=*a*2,<=...,<=*a**n*. They bought a chain saw from a shop. Each time they use the chain saw on the tree number *i*, they can decrease the height of this tree by one unit. Each time that Kalila and Dimna use the chain saw, they need to recharge it. Cost of charging depends on the id of the trees which have been cut completely (a tree is cut completely if its height equal to 0). If the maximum id of a tree which has been cut completely is *i* (the tree that have height *a**i* in the beginning), then the cost of charging the chain saw would be *b**i*. If no tree is cut completely, Kalila and Dimna cannot charge the chain saw. The chainsaw is charged in the beginning. We know that for each *i* &lt; *j*, *a**i*<=&lt;<=*a**j* and *b**i*<=&gt;<=*b**j* and also *b**n*<==<=0 and *a*1<==<=1. Kalila and Dimna want to cut all the trees completely, with minimum cost. They want you to help them! Will you? Input Specification: The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=105). The second line of input contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109). The third line of input contains *n* integers *b*1,<=*b*2,<=...,<=*b**n* (0<=≤<=*b**i*<=≤<=109). It's guaranteed that *a*1<==<=1, *b**n*<==<=0, *a*1<=&lt;<=*a*2<=&lt;<=...<=&lt;<=*a**n* and *b*1<=&gt;<=*b*2<=&gt;<=...<=&gt;<=*b**n*. Output Specification: The only line of output must contain the minimum cost of cutting all the trees completely. Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier. Demo Input: ['5\n1 2 3 4 5\n5 4 3 2 0\n', '6\n1 2 3 10 20 30\n6 5 4 3 2 0\n'] Demo Output: ['25\n', '138\n'] Note: none
```python f = lambda: list(map(int, input().split())) g = lambda j: a[i] * b[j] + t[j] h = lambda j, k: (t[i] - t[j]) * (b[j] - b[k]) < (t[j] - t[k]) * (b[i] - b[j]) n = int(input()) a, b = f(), f() t = [0] * n p = [0] for i in range(1, n): while len(p) > 1 and g(p[1]) < g(p[0]): p.pop(0) t[i] = g(p[0]) while len(p) > 1 and h(p[-2], p[-1]): p.pop() p.append(i) print(t[-1]) ```
3
618
B
Guess the Permutation
PROGRAMMING
1,100
[ "constructive algorithms" ]
null
null
Bob has a permutation of integers from 1 to *n*. Denote this permutation as *p*. The *i*-th element of *p* will be denoted as *p**i*. For all pairs of distinct integers *i*,<=*j* between 1 and *n*, he wrote the number *a**i*,<=*j*<==<=*min*(*p**i*,<=*p**j*). He writes *a**i*,<=*i*<==<=0 for all integer *i* from 1 to *n*. Bob gave you all the values of *a**i*,<=*j* that he wrote down. Your job is to reconstruct any permutation that could have generated these values. The input will be formed so that it is guaranteed that there is at least one solution that is consistent with the information given.
The first line of the input will contain a single integer *n* (2<=≤<=*n*<=≤<=50). The next *n* lines will contain the values of *a**i*,<=*j*. The *j*-th number on the *i*-th line will represent *a**i*,<=*j*. The *i*-th number on the *i*-th line will be 0. It's guaranteed that *a**i*,<=*j*<==<=*a**j*,<=*i* and there is at least one solution consistent with the information given.
Print *n* space separated integers, which represents a permutation that could have generated these values. If there are multiple possible solutions, print any of them.
[ "2\n0 1\n1 0\n", "5\n0 2 2 1 2\n2 0 4 1 3\n2 4 0 1 3\n1 1 1 0 1\n2 3 3 1 0\n" ]
[ "2 1\n", "2 5 4 1 3\n" ]
In the first case, the answer can be {1, 2} or {2, 1}. In the second case, another possible answer is {2, 4, 5, 1, 3}.
1,000
[ { "input": "2\n0 1\n1 0", "output": "2 1" }, { "input": "5\n0 2 2 1 2\n2 0 4 1 3\n2 4 0 1 3\n1 1 1 0 1\n2 3 3 1 0", "output": "2 5 4 1 3" }, { "input": "10\n0 1 5 2 5 3 4 5 5 5\n1 0 1 1 1 1 1 1 1 1\n5 1 0 2 6 3 4 6 6 6\n2 1 2 0 2 2 2 2 2 2\n5 1 6 2 0 3 4 8 8 7\n3 1 3 2 3 0 3 3 3 3\n4 1 4 2 4 3 0 4 4 4\n5 1 6 2 8 3 4 0 9 7\n5 1 6 2 8 3 4 9 0 7\n5 1 6 2 7 3 4 7 7 0", "output": "5 1 6 2 8 3 4 10 9 7" }, { "input": "4\n0 1 3 2\n1 0 1 1\n3 1 0 2\n2 1 2 0", "output": "4 1 3 2" }, { "input": "7\n0 3 2 4 1 4 4\n3 0 2 3 1 3 3\n2 2 0 2 1 2 2\n4 3 2 0 1 5 5\n1 1 1 1 0 1 1\n4 3 2 5 1 0 6\n4 3 2 5 1 6 0", "output": "4 3 2 5 1 7 6" }, { "input": "10\n0 4 4 1 4 4 4 2 3 4\n4 0 5 1 6 8 9 2 3 7\n4 5 0 1 5 5 5 2 3 5\n1 1 1 0 1 1 1 1 1 1\n4 6 5 1 0 6 6 2 3 6\n4 8 5 1 6 0 8 2 3 7\n4 9 5 1 6 8 0 2 3 7\n2 2 2 1 2 2 2 0 2 2\n3 3 3 1 3 3 3 2 0 3\n4 7 5 1 6 7 7 2 3 0", "output": "4 10 5 1 6 8 9 2 3 7" }, { "input": "13\n0 5 5 2 5 4 5 5 3 5 5 5 1\n5 0 6 2 6 4 6 6 3 6 6 6 1\n5 6 0 2 10 4 7 10 3 8 10 9 1\n2 2 2 0 2 2 2 2 2 2 2 2 1\n5 6 10 2 0 4 7 12 3 8 11 9 1\n4 4 4 2 4 0 4 4 3 4 4 4 1\n5 6 7 2 7 4 0 7 3 7 7 7 1\n5 6 10 2 12 4 7 0 3 8 11 9 1\n3 3 3 2 3 3 3 3 0 3 3 3 1\n5 6 8 2 8 4 7 8 3 0 8 8 1\n5 6 10 2 11 4 7 11 3 8 0 9 1\n5 6 9 2 9 4 7 9 3 8 9 0 1\n1 1 1 1 1 1 1 1 1 1 1 1 0", "output": "5 6 10 2 13 4 7 12 3 8 11 9 1" } ]
1,671,478,349
2,147,483,647
Python 3
OK
TESTS
23
61
0
import sys f=sys.stdin n=int(f.readline()) arr=[max(map(int, f.readline().split())) for i in range(n)] arr[arr.index(n-1)]=n print(" ".join(map(str, arr)))
Title: Guess the Permutation Time Limit: None seconds Memory Limit: None megabytes Problem Description: Bob has a permutation of integers from 1 to *n*. Denote this permutation as *p*. The *i*-th element of *p* will be denoted as *p**i*. For all pairs of distinct integers *i*,<=*j* between 1 and *n*, he wrote the number *a**i*,<=*j*<==<=*min*(*p**i*,<=*p**j*). He writes *a**i*,<=*i*<==<=0 for all integer *i* from 1 to *n*. Bob gave you all the values of *a**i*,<=*j* that he wrote down. Your job is to reconstruct any permutation that could have generated these values. The input will be formed so that it is guaranteed that there is at least one solution that is consistent with the information given. Input Specification: The first line of the input will contain a single integer *n* (2<=≤<=*n*<=≤<=50). The next *n* lines will contain the values of *a**i*,<=*j*. The *j*-th number on the *i*-th line will represent *a**i*,<=*j*. The *i*-th number on the *i*-th line will be 0. It's guaranteed that *a**i*,<=*j*<==<=*a**j*,<=*i* and there is at least one solution consistent with the information given. Output Specification: Print *n* space separated integers, which represents a permutation that could have generated these values. If there are multiple possible solutions, print any of them. Demo Input: ['2\n0 1\n1 0\n', '5\n0 2 2 1 2\n2 0 4 1 3\n2 4 0 1 3\n1 1 1 0 1\n2 3 3 1 0\n'] Demo Output: ['2 1\n', '2 5 4 1 3\n'] Note: In the first case, the answer can be {1, 2} or {2, 1}. In the second case, another possible answer is {2, 4, 5, 1, 3}.
```python import sys f=sys.stdin n=int(f.readline()) arr=[max(map(int, f.readline().split())) for i in range(n)] arr[arr.index(n-1)]=n print(" ".join(map(str, arr))) ```
3
433
A
Kitahara Haruki's Gift
PROGRAMMING
1,100
[ "brute force", "implementation" ]
null
null
Kitahara Haruki has bought *n* apples for Touma Kazusa and Ogiso Setsuna. Now he wants to divide all the apples between the friends. Each apple weights 100 grams or 200 grams. Of course Kitahara Haruki doesn't want to offend any of his friend. Therefore the total weight of the apples given to Touma Kazusa must be equal to the total weight of the apples given to Ogiso Setsuna. But unfortunately Kitahara Haruki doesn't have a knife right now, so he cannot split any apple into some parts. Please, tell him: is it possible to divide all the apples in a fair way between his friends?
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of apples. The second line contains *n* integers *w*1,<=*w*2,<=...,<=*w**n* (*w**i*<==<=100 or *w**i*<==<=200), where *w**i* is the weight of the *i*-th apple.
In a single line print "YES" (without the quotes) if it is possible to divide all the apples between his friends. Otherwise print "NO" (without the quotes).
[ "3\n100 200 100\n", "4\n100 100 100 200\n" ]
[ "YES\n", "NO\n" ]
In the first test sample Kitahara Haruki can give the first and the last apple to Ogiso Setsuna and the middle apple to Touma Kazusa.
500
[ { "input": "3\n100 200 100", "output": "YES" }, { "input": "4\n100 100 100 200", "output": "NO" }, { "input": "1\n100", "output": "NO" }, { "input": "1\n200", "output": "NO" }, { "input": "2\n100 100", "output": "YES" }, { "input": "2\n200 200", "output": "YES" }, { "input": "100\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200", "output": "YES" }, { "input": "100\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200", "output": "NO" }, { "input": "52\n200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 100 200 100 200 200 200 100 200 200", "output": "YES" }, { "input": "2\n100 200", "output": "NO" }, { "input": "2\n200 100", "output": "NO" }, { "input": "3\n100 100 100", "output": "NO" }, { "input": "3\n200 200 200", "output": "NO" }, { "input": "3\n200 100 200", "output": "NO" }, { "input": "4\n100 100 100 100", "output": "YES" }, { "input": "4\n200 200 200 200", "output": "YES" }, { "input": "100\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200", "output": "YES" }, { "input": "100\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 100 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200", "output": "NO" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "YES" }, { "input": "100\n100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "NO" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "YES" }, { "input": "100\n100 100 100 100 100 100 100 100 200 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "NO" }, { "input": "99\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200", "output": "NO" }, { "input": "99\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200", "output": "NO" }, { "input": "99\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200", "output": "YES" }, { "input": "99\n200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200", "output": "NO" }, { "input": "99\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "NO" }, { "input": "99\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "YES" }, { "input": "99\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "NO" }, { "input": "100\n100 100 200 100 100 200 200 200 200 100 200 100 100 100 200 100 100 100 100 200 100 100 100 100 100 100 200 100 100 200 200 100 100 100 200 200 200 100 200 200 100 200 100 100 200 100 200 200 100 200 200 100 100 200 200 100 200 200 100 100 200 100 200 100 200 200 200 200 200 100 200 200 200 200 200 200 100 100 200 200 200 100 100 100 200 100 100 200 100 100 100 200 200 100 100 200 200 200 200 100", "output": "YES" }, { "input": "100\n100 100 200 200 100 200 100 100 100 100 100 100 200 100 200 200 200 100 100 200 200 200 200 200 100 200 100 200 100 100 100 200 100 100 200 100 200 100 100 100 200 200 100 100 100 200 200 200 200 200 100 200 200 100 100 100 100 200 100 100 200 100 100 100 100 200 200 200 100 200 100 200 200 200 100 100 200 200 200 200 100 200 100 200 200 100 200 100 200 200 200 200 200 200 100 100 100 200 200 100", "output": "NO" }, { "input": "100\n100 200 100 100 200 200 200 200 100 200 200 200 200 200 200 200 200 200 100 100 100 200 200 200 200 200 100 200 200 200 200 100 200 200 100 100 200 100 100 100 200 100 100 100 200 100 200 100 200 200 200 100 100 200 100 200 100 200 100 100 100 200 100 200 100 100 100 100 200 200 200 200 100 200 200 100 200 100 100 100 200 100 100 100 100 100 200 100 100 100 200 200 200 100 200 100 100 100 200 200", "output": "YES" }, { "input": "99\n100 200 200 200 100 200 100 200 200 100 100 100 100 200 100 100 200 100 200 100 100 200 100 100 200 200 100 100 100 100 200 200 200 200 200 100 100 200 200 100 100 100 100 200 200 100 100 100 100 100 200 200 200 100 100 100 200 200 200 100 200 100 100 100 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 100 200 100 200 200 200 200 100 200 100 100 100 100 100 100 100 100 100", "output": "YES" }, { "input": "99\n100 200 100 100 100 100 200 200 100 200 100 100 200 100 100 100 100 100 100 200 100 100 100 100 100 100 100 200 100 200 100 100 100 100 100 100 100 200 200 200 200 200 200 200 100 200 100 200 100 200 100 200 100 100 200 200 200 100 200 200 200 200 100 200 100 200 200 200 200 100 200 100 200 200 100 200 200 200 200 200 100 100 200 100 100 100 100 200 200 200 100 100 200 200 200 200 200 200 200", "output": "NO" }, { "input": "99\n200 100 100 100 200 200 200 100 100 100 100 100 100 100 100 100 200 200 100 200 200 100 200 100 100 200 200 200 100 200 100 200 200 100 200 100 200 200 200 100 100 200 200 200 200 100 100 100 100 200 200 200 200 100 200 200 200 100 100 100 200 200 200 100 200 100 200 100 100 100 200 100 200 200 100 200 200 200 100 100 100 200 200 200 100 200 200 200 100 100 100 200 100 200 100 100 100 200 200", "output": "YES" }, { "input": "56\n100 200 200 200 200 200 100 200 100 100 200 100 100 100 100 100 200 200 200 100 200 100 100 200 200 200 100 200 100 200 200 100 100 100 100 100 200 100 200 100 200 200 200 100 100 200 200 200 200 200 200 200 200 200 200 100", "output": "YES" }, { "input": "72\n200 100 200 200 200 100 100 200 200 100 100 100 100 200 100 200 100 100 100 100 200 100 200 100 100 200 100 100 200 100 200 100 100 200 100 200 100 100 200 200 200 200 200 100 100 200 200 200 200 100 100 100 200 200 100 100 100 100 100 200 100 100 200 100 100 200 200 100 100 200 100 200", "output": "YES" }, { "input": "32\n200 200 200 100 100 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200", "output": "YES" }, { "input": "48\n200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 100 200 200 200 200 200 200", "output": "NO" }, { "input": "60\n100 100 200 200 100 200 100 200 100 100 100 100 100 100 200 100 100 100 200 100 200 100 100 100 100 100 200 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100", "output": "YES" }, { "input": "24\n200 200 100 100 200 100 200 200 100 200 200 200 200 200 100 200 200 200 200 200 200 200 200 100", "output": "YES" }, { "input": "40\n100 100 200 200 200 200 100 100 100 200 100 100 200 200 100 100 100 100 100 200 100 200 200 100 200 200 200 100 100 100 100 100 200 200 100 200 100 100 200 100", "output": "NO" }, { "input": "5\n200 200 200 200 200", "output": "NO" }, { "input": "9\n100 100 100 200 100 100 200 100 200", "output": "YES" }, { "input": "1\n200", "output": "NO" }, { "input": "7\n200 200 200 100 200 200 200", "output": "NO" }, { "input": "4\n100 100 200 200", "output": "YES" }, { "input": "6\n100 100 100 200 200 200", "output": "NO" }, { "input": "4\n200 100 100 200", "output": "YES" }, { "input": "5\n100 100 100 100 200", "output": "YES" } ]
1,658,121,623
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
46
0
from itertools import combinations n=int(input()) l=list(map(int,input().split())) t=sum(l) if t%2==0: print('YES') else: print('NO')
Title: Kitahara Haruki's Gift Time Limit: None seconds Memory Limit: None megabytes Problem Description: Kitahara Haruki has bought *n* apples for Touma Kazusa and Ogiso Setsuna. Now he wants to divide all the apples between the friends. Each apple weights 100 grams or 200 grams. Of course Kitahara Haruki doesn't want to offend any of his friend. Therefore the total weight of the apples given to Touma Kazusa must be equal to the total weight of the apples given to Ogiso Setsuna. But unfortunately Kitahara Haruki doesn't have a knife right now, so he cannot split any apple into some parts. Please, tell him: is it possible to divide all the apples in a fair way between his friends? Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of apples. The second line contains *n* integers *w*1,<=*w*2,<=...,<=*w**n* (*w**i*<==<=100 or *w**i*<==<=200), where *w**i* is the weight of the *i*-th apple. Output Specification: In a single line print "YES" (without the quotes) if it is possible to divide all the apples between his friends. Otherwise print "NO" (without the quotes). Demo Input: ['3\n100 200 100\n', '4\n100 100 100 200\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first test sample Kitahara Haruki can give the first and the last apple to Ogiso Setsuna and the middle apple to Touma Kazusa.
```python from itertools import combinations n=int(input()) l=list(map(int,input().split())) t=sum(l) if t%2==0: print('YES') else: print('NO') ```
0
810
B
Summer sell-off
PROGRAMMING
1,300
[ "greedy", "sortings" ]
null
null
Summer holidays! Someone is going on trips, someone is visiting grandparents, but someone is trying to get a part-time job. This summer Noora decided that she wants to earn some money, and took a job in a shop as an assistant. Shop, where Noora is working, has a plan on the following *n* days. For each day sales manager knows exactly, that in *i*-th day *k**i* products will be put up for sale and exactly *l**i* clients will come to the shop that day. Also, the manager is sure, that everyone, who comes to the shop, buys exactly one product or, if there aren't any left, leaves the shop without buying anything. Moreover, due to the short shelf-life of the products, manager established the following rule: if some part of the products left on the shelves at the end of the day, that products aren't kept on the next day and are sent to the dump. For advertising purposes manager offered to start a sell-out in the shop. He asked Noora to choose any *f* days from *n* next for sell-outs. On each of *f* chosen days the number of products were put up for sale would be doubled. Thus, if on *i*-th day shop planned to put up for sale *k**i* products and Noora has chosen this day for sell-out, shelves of the shop would keep 2·*k**i* products. Consequently, there is an opportunity to sell two times more products on days of sell-out. Noora's task is to choose *f* days to maximize total number of sold products. She asks you to help her with such a difficult problem.
The first line contains two integers *n* and *f* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*f*<=≤<=*n*) denoting the number of days in shop's plan and the number of days that Noora has to choose for sell-out. Each line of the following *n* subsequent lines contains two integers *k**i*,<=*l**i* (0<=≤<=*k**i*,<=*l**i*<=≤<=109) denoting the number of products on the shelves of the shop on the *i*-th day and the number of clients that will come to the shop on *i*-th day.
Print a single integer denoting the maximal number of products that shop can sell.
[ "4 2\n2 1\n3 5\n2 3\n1 5\n", "4 1\n0 2\n0 3\n3 5\n0 6\n" ]
[ "10", "5" ]
In the first example we can choose days with numbers 2 and 4 for sell-out. In this case new numbers of products for sale would be equal to [2, 6, 2, 2] respectively. So on the first day shop will sell 1 product, on the second — 5, on the third — 2, on the fourth — 2. In total 1 + 5 + 2 + 2 = 10 product units. In the second example it is possible to sell 5 products, if you choose third day for sell-out.
1,000
[ { "input": "4 2\n2 1\n3 5\n2 3\n1 5", "output": "10" }, { "input": "4 1\n0 2\n0 3\n3 5\n0 6", "output": "5" }, { "input": "1 1\n5 8", "output": "8" }, { "input": "2 1\n8 12\n6 11", "output": "19" }, { "input": "2 1\n6 7\n5 7", "output": "13" }, { "input": "2 1\n5 7\n6 7", "output": "13" }, { "input": "2 1\n7 8\n3 6", "output": "13" }, { "input": "2 1\n9 10\n5 8", "output": "17" }, { "input": "2 1\n3 6\n7 8", "output": "13" }, { "input": "1 0\n10 20", "output": "10" }, { "input": "2 1\n99 100\n3 6", "output": "105" }, { "input": "4 2\n2 10\n3 10\n9 9\n5 10", "output": "27" }, { "input": "2 1\n3 4\n2 8", "output": "7" }, { "input": "50 2\n74 90\n68 33\n49 88\n52 13\n73 21\n77 63\n27 62\n8 52\n60 57\n42 83\n98 15\n79 11\n77 46\n55 91\n72 100\n70 86\n50 51\n57 39\n20 54\n64 95\n66 22\n79 64\n31 28\n11 89\n1 36\n13 4\n75 62\n16 62\n100 35\n43 96\n97 54\n86 33\n62 63\n94 24\n19 6\n20 58\n38 38\n11 76\n70 40\n44 24\n32 96\n28 100\n62 45\n41 68\n90 52\n16 0\n98 32\n81 79\n67 82\n28 2", "output": "1889" }, { "input": "2 1\n10 5\n2 4", "output": "9" }, { "input": "2 1\n50 51\n30 40", "output": "90" }, { "input": "3 2\n5 10\n5 10\n7 9", "output": "27" }, { "input": "3 1\n1000 1000\n50 100\n2 2", "output": "1102" }, { "input": "2 1\n2 4\n12 12", "output": "16" }, { "input": "2 1\n4 4\n1 2", "output": "6" }, { "input": "2 1\n4000 4000\n1 2", "output": "4002" }, { "input": "2 1\n5 6\n2 4", "output": "9" }, { "input": "3 2\n10 10\n10 10\n1 2", "output": "22" }, { "input": "10 5\n9 1\n11 1\n12 1\n13 1\n14 1\n2 4\n2 4\n2 4\n2 4\n2 4", "output": "25" }, { "input": "2 1\n30 30\n10 20", "output": "50" }, { "input": "1 1\n1 1", "output": "1" }, { "input": "2 1\n10 2\n2 10", "output": "6" }, { "input": "2 1\n4 5\n3 9", "output": "10" }, { "input": "2 1\n100 100\n5 10", "output": "110" }, { "input": "2 1\n14 28\n15 28", "output": "43" }, { "input": "2 1\n100 1\n20 40", "output": "41" }, { "input": "2 1\n5 10\n6 10", "output": "16" }, { "input": "2 1\n29 30\n10 20", "output": "49" }, { "input": "1 0\n12 12", "output": "12" }, { "input": "2 1\n7 8\n4 7", "output": "14" }, { "input": "2 1\n5 5\n2 4", "output": "9" }, { "input": "2 1\n1 2\n228 2", "output": "4" }, { "input": "2 1\n5 10\n100 20", "output": "30" }, { "input": "2 1\n1000 1001\n2 4", "output": "1004" }, { "input": "2 1\n3 9\n7 7", "output": "13" }, { "input": "2 0\n1 1\n1 1", "output": "2" }, { "input": "4 1\n10 10\n10 10\n10 10\n4 6", "output": "36" }, { "input": "18 13\n63 8\n87 100\n18 89\n35 29\n66 81\n27 85\n64 51\n60 52\n32 94\n74 22\n86 31\n43 78\n12 2\n36 2\n67 23\n2 16\n78 71\n34 64", "output": "772" }, { "input": "2 1\n10 18\n17 19", "output": "35" }, { "input": "3 0\n1 1\n1 1\n1 1", "output": "3" }, { "input": "2 1\n4 7\n8 9", "output": "15" }, { "input": "4 2\n2 10\n3 10\n9 10\n5 10", "output": "27" }, { "input": "2 1\n5 7\n3 6", "output": "11" }, { "input": "2 1\n3 4\n12 12", "output": "16" }, { "input": "2 1\n10 11\n9 20", "output": "28" }, { "input": "2 1\n7 8\n2 4", "output": "11" }, { "input": "2 1\n5 10\n7 10", "output": "17" }, { "input": "4 2\n2 10\n3 10\n5 10\n9 10", "output": "27" }, { "input": "2 1\n99 100\n5 10", "output": "109" }, { "input": "4 2\n2 10\n3 10\n5 10\n9 9", "output": "27" }, { "input": "2 1\n3 7\n5 7", "output": "11" }, { "input": "2 1\n10 10\n3 6", "output": "16" }, { "input": "2 1\n100 1\n2 4", "output": "5" }, { "input": "5 0\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "5" }, { "input": "3 1\n3 7\n4 5\n2 3", "output": "12" }, { "input": "2 1\n3 9\n7 8", "output": "13" }, { "input": "2 1\n10 2\n3 4", "output": "6" }, { "input": "2 1\n40 40\n3 5", "output": "45" }, { "input": "2 1\n5 3\n1 2", "output": "5" }, { "input": "10 5\n9 5\n10 5\n11 5\n12 5\n13 5\n2 4\n2 4\n2 4\n2 4\n2 4", "output": "45" }, { "input": "3 1\n1 5\n1 5\n4 4", "output": "7" }, { "input": "4 0\n1 1\n1 1\n1 1\n1 1", "output": "4" }, { "input": "4 1\n1000 1001\n1000 1001\n2 4\n1 2", "output": "2005" }, { "input": "2 1\n15 30\n50 59", "output": "80" }, { "input": "2 1\n8 8\n3 5", "output": "13" }, { "input": "2 1\n4 5\n2 5", "output": "8" }, { "input": "3 2\n3 3\n1 2\n1 2", "output": "7" }, { "input": "3 1\n2 5\n2 5\n4 4", "output": "10" }, { "input": "2 1\n3 10\n50 51", "output": "56" }, { "input": "4 2\n2 4\n2 4\n9 10\n9 10", "output": "26" }, { "input": "2 1\n3 5\n8 8", "output": "13" }, { "input": "2 1\n100 150\n70 150", "output": "240" }, { "input": "2 1\n4 5\n3 6", "output": "10" }, { "input": "2 1\n20 10\n3 5", "output": "15" }, { "input": "15 13\n76167099 92301116\n83163126 84046805\n45309500 65037149\n29982002 77381688\n76738161 52935441\n37889502 25466134\n55955619 14197941\n31462620 12999429\n64648384 8824773\n3552934 68992494\n2823376 9338427\n86832070 3763091\n67753633 2162190\n302887 92011825\n84894984 410533", "output": "435467000" }, { "input": "2 1\n8 7\n3 6", "output": "13" }, { "input": "2 1\n7 8\n3 5", "output": "12" }, { "input": "2 1\n10 10\n1 3", "output": "12" }, { "input": "2 1\n9 10\n2 4", "output": "13" }, { "input": "3 1\n10 11\n12 13\n8 10", "output": "32" }, { "input": "2 1\n5 10\n7 7", "output": "17" }, { "input": "4 2\n90 91\n2 10\n2 10\n2 10", "output": "100" }, { "input": "2 1\n2 4\n4 4", "output": "8" }, { "input": "2 1\n2 3\n4 3", "output": "6" }, { "input": "2 1\n40 45\n50 52", "output": "95" }, { "input": "3 1\n1 4\n2 4\n3 4", "output": "8" }, { "input": "2 1\n1 2\n1000 1000", "output": "1002" }, { "input": "2 1\n80 100\n70 95", "output": "175" } ]
1,680,186,034
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
6
46
0
days,sales = map(int,input().split()) sale = [] for i in range(days): product,customers = map(int,input().split()) day = [product,customers,customers-product,customers-product*2] sale.append(day) sale.sort(key=lambda x: x[2],reverse=True) sum = 0 for i in sale: if i[0] != 0 and i[1] != 0 and sales != 0: sum+=min(i[0]*2,i[1]) sales-=1 else: sum+=min(i[0],i[1]) print(sum)
Title: Summer sell-off Time Limit: None seconds Memory Limit: None megabytes Problem Description: Summer holidays! Someone is going on trips, someone is visiting grandparents, but someone is trying to get a part-time job. This summer Noora decided that she wants to earn some money, and took a job in a shop as an assistant. Shop, where Noora is working, has a plan on the following *n* days. For each day sales manager knows exactly, that in *i*-th day *k**i* products will be put up for sale and exactly *l**i* clients will come to the shop that day. Also, the manager is sure, that everyone, who comes to the shop, buys exactly one product or, if there aren't any left, leaves the shop without buying anything. Moreover, due to the short shelf-life of the products, manager established the following rule: if some part of the products left on the shelves at the end of the day, that products aren't kept on the next day and are sent to the dump. For advertising purposes manager offered to start a sell-out in the shop. He asked Noora to choose any *f* days from *n* next for sell-outs. On each of *f* chosen days the number of products were put up for sale would be doubled. Thus, if on *i*-th day shop planned to put up for sale *k**i* products and Noora has chosen this day for sell-out, shelves of the shop would keep 2·*k**i* products. Consequently, there is an opportunity to sell two times more products on days of sell-out. Noora's task is to choose *f* days to maximize total number of sold products. She asks you to help her with such a difficult problem. Input Specification: The first line contains two integers *n* and *f* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*f*<=≤<=*n*) denoting the number of days in shop's plan and the number of days that Noora has to choose for sell-out. Each line of the following *n* subsequent lines contains two integers *k**i*,<=*l**i* (0<=≤<=*k**i*,<=*l**i*<=≤<=109) denoting the number of products on the shelves of the shop on the *i*-th day and the number of clients that will come to the shop on *i*-th day. Output Specification: Print a single integer denoting the maximal number of products that shop can sell. Demo Input: ['4 2\n2 1\n3 5\n2 3\n1 5\n', '4 1\n0 2\n0 3\n3 5\n0 6\n'] Demo Output: ['10', '5'] Note: In the first example we can choose days with numbers 2 and 4 for sell-out. In this case new numbers of products for sale would be equal to [2, 6, 2, 2] respectively. So on the first day shop will sell 1 product, on the second — 5, on the third — 2, on the fourth — 2. In total 1 + 5 + 2 + 2 = 10 product units. In the second example it is possible to sell 5 products, if you choose third day for sell-out.
```python days,sales = map(int,input().split()) sale = [] for i in range(days): product,customers = map(int,input().split()) day = [product,customers,customers-product,customers-product*2] sale.append(day) sale.sort(key=lambda x: x[2],reverse=True) sum = 0 for i in sale: if i[0] != 0 and i[1] != 0 and sales != 0: sum+=min(i[0]*2,i[1]) sales-=1 else: sum+=min(i[0],i[1]) print(sum) ```
0
762
A
k-th divisor
PROGRAMMING
1,400
[ "math", "number theory" ]
null
null
You are given two integers *n* and *k*. Find *k*-th smallest divisor of *n*, or report that it doesn't exist. Divisor of *n* is any such natural number, that *n* can be divided by it without remainder.
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=1015, 1<=≤<=*k*<=≤<=109).
If *n* has less than *k* divisors, output -1. Otherwise, output the *k*-th smallest divisor of *n*.
[ "4 2\n", "5 3\n", "12 5\n" ]
[ "2\n", "-1\n", "6\n" ]
In the first example, number 4 has three divisors: 1, 2 and 4. The second one is 2. In the second example, number 5 has only two divisors: 1 and 5. The third divisor doesn't exist, so the answer is -1.
0
[ { "input": "4 2", "output": "2" }, { "input": "5 3", "output": "-1" }, { "input": "12 5", "output": "6" }, { "input": "1 1", "output": "1" }, { "input": "866421317361600 26880", "output": "866421317361600" }, { "input": "866421317361600 26881", "output": "-1" }, { "input": "1000000000000000 1000000000", "output": "-1" }, { "input": "1000000000000000 100", "output": "1953125" }, { "input": "1 2", "output": "-1" }, { "input": "4 3", "output": "4" }, { "input": "4 4", "output": "-1" }, { "input": "9 3", "output": "9" }, { "input": "21 3", "output": "7" }, { "input": "67280421310721 1", "output": "1" }, { "input": "6 3", "output": "3" }, { "input": "3 3", "output": "-1" }, { "input": "16 3", "output": "4" }, { "input": "1 1000", "output": "-1" }, { "input": "16 4", "output": "8" }, { "input": "36 8", "output": "18" }, { "input": "49 4", "output": "-1" }, { "input": "9 4", "output": "-1" }, { "input": "16 1", "output": "1" }, { "input": "16 6", "output": "-1" }, { "input": "16 5", "output": "16" }, { "input": "25 4", "output": "-1" }, { "input": "4010815561 2", "output": "63331" }, { "input": "49 3", "output": "49" }, { "input": "36 6", "output": "9" }, { "input": "36 10", "output": "-1" }, { "input": "25 3", "output": "25" }, { "input": "22876792454961 28", "output": "7625597484987" }, { "input": "1234 2", "output": "2" }, { "input": "179458711 2", "output": "179458711" }, { "input": "900104343024121 100000", "output": "-1" }, { "input": "8 3", "output": "4" }, { "input": "100 6", "output": "20" }, { "input": "15500 26", "output": "-1" }, { "input": "111111 1", "output": "1" }, { "input": "100000000000000 200", "output": "160000000000" }, { "input": "1000000000000 100", "output": "6400000" }, { "input": "100 10", "output": "-1" }, { "input": "1000000000039 2", "output": "1000000000039" }, { "input": "64 5", "output": "16" }, { "input": "999999961946176 33", "output": "63245552" }, { "input": "376219076689 3", "output": "376219076689" }, { "input": "999999961946176 63", "output": "999999961946176" }, { "input": "1048576 12", "output": "2048" }, { "input": "745 21", "output": "-1" }, { "input": "748 6", "output": "22" }, { "input": "999999961946176 50", "output": "161082468097" }, { "input": "10 3", "output": "5" }, { "input": "1099511627776 22", "output": "2097152" }, { "input": "1000000007 100010", "output": "-1" }, { "input": "3 1", "output": "1" }, { "input": "100 8", "output": "50" }, { "input": "100 7", "output": "25" }, { "input": "7 2", "output": "7" }, { "input": "999999961946176 64", "output": "-1" }, { "input": "20 5", "output": "10" }, { "input": "999999999999989 2", "output": "999999999999989" }, { "input": "100000000000000 114", "output": "10240000" }, { "input": "99999640000243 3", "output": "9999991" }, { "input": "999998000001 566", "output": "333332666667" }, { "input": "99999820000081 2", "output": "9999991" }, { "input": "49000042000009 3", "output": "49000042000009" }, { "input": "151491429961 4", "output": "-1" }, { "input": "32416190071 2", "output": "32416190071" }, { "input": "1000 8", "output": "25" }, { "input": "1999967841 15", "output": "1999967841" }, { "input": "26880 26880", "output": "-1" }, { "input": "151491429961 3", "output": "151491429961" }, { "input": "90000000000 300", "output": "100000000" }, { "input": "98765004361 10", "output": "-1" }, { "input": "15 2", "output": "3" }, { "input": "16 2", "output": "2" }, { "input": "1996 2", "output": "2" }, { "input": "1997 2", "output": "1997" }, { "input": "1999 2", "output": "1999" }, { "input": "1998 2", "output": "2" }, { "input": "1998 1", "output": "1" }, { "input": "1998 7", "output": "27" }, { "input": "1998 8", "output": "37" }, { "input": "100000380000361 2", "output": "10000019" }, { "input": "15 1", "output": "1" }, { "input": "100000000000000 226", "output": "-1" }, { "input": "844030857550613 517", "output": "-1" }, { "input": "4567890 14", "output": "430" }, { "input": "123123123 123123123", "output": "-1" }, { "input": "24 4", "output": "4" }, { "input": "999999993568952 17", "output": "31622777" }, { "input": "99999999994190 9", "output": "241656799" }, { "input": "999997874844049 4", "output": "-1" }, { "input": "99999999999931 2", "output": "99999999999931" }, { "input": "2 3", "output": "-1" }, { "input": "67280421310721 2", "output": "67280421310721" } ]
1,679,589,112
2,147,483,647
Python 3
MEMORY_LIMIT_EXCEEDED
TESTS
6
1,419
268,390,400
import math import itertools b, c = map(int, input().split()) def prime_factors(num): l1 = [] while num % 2 == 0: l1.append(2) num = num // 2 for i in range(3, int(math.sqrt(num)) + 1, 2): while num % i == 0: l1.append(i) num = num // i if num > 2: l1.append(int(num)) return l1 factor_list = set() a = prime_factors(b) for y in range(1, len(a)+1): store = list(itertools.combinations(a, y)) for z in store: factor_list.add(z) factors = [1] total = 1 for p in factor_list: for q in p: total *= q factors.append(total) total = 1 factors = sorted(factors) if c > len(factors): print(-1) else: print(factors[c-1])
Title: k-th divisor Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given two integers *n* and *k*. Find *k*-th smallest divisor of *n*, or report that it doesn't exist. Divisor of *n* is any such natural number, that *n* can be divided by it without remainder. Input Specification: The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=1015, 1<=≤<=*k*<=≤<=109). Output Specification: If *n* has less than *k* divisors, output -1. Otherwise, output the *k*-th smallest divisor of *n*. Demo Input: ['4 2\n', '5 3\n', '12 5\n'] Demo Output: ['2\n', '-1\n', '6\n'] Note: In the first example, number 4 has three divisors: 1, 2 and 4. The second one is 2. In the second example, number 5 has only two divisors: 1 and 5. The third divisor doesn't exist, so the answer is -1.
```python import math import itertools b, c = map(int, input().split()) def prime_factors(num): l1 = [] while num % 2 == 0: l1.append(2) num = num // 2 for i in range(3, int(math.sqrt(num)) + 1, 2): while num % i == 0: l1.append(i) num = num // i if num > 2: l1.append(int(num)) return l1 factor_list = set() a = prime_factors(b) for y in range(1, len(a)+1): store = list(itertools.combinations(a, y)) for z in store: factor_list.add(z) factors = [1] total = 1 for p in factor_list: for q in p: total *= q factors.append(total) total = 1 factors = sorted(factors) if c > len(factors): print(-1) else: print(factors[c-1]) ```
0
32
B
Borze
PROGRAMMING
800
[ "expression parsing", "implementation" ]
B. Borze
2
256
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
Output the decoded ternary number. It can have leading zeroes.
[ ".-.--\n", "--.\n", "-..-.--\n" ]
[ "012", "20", "1012" ]
none
1,000
[ { "input": ".-.--", "output": "012" }, { "input": "--.", "output": "20" }, { "input": "-..-.--", "output": "1012" }, { "input": "---..", "output": "210" }, { "input": "..--.---..", "output": "0020210" }, { "input": "-.....----.", "output": "10000220" }, { "input": ".", "output": "0" }, { "input": "-.", "output": "1" }, { "input": "--", "output": "2" }, { "input": "..", "output": "00" }, { "input": "--.", "output": "20" }, { "input": ".--.", "output": "020" }, { "input": ".-.-..", "output": "0110" }, { "input": "----.-.", "output": "2201" }, { "input": "-..--.-.", "output": "10201" }, { "input": "..--..--.", "output": "0020020" }, { "input": "-.-.---.--..-..-.-.-..-..-.--.", "output": "112120010111010120" }, { "input": "---.-.-.------..-..-..-..-.-..-.--.-.-..-.-.-----..-.-.", "output": "21112220010101011012011011221011" }, { "input": "-.-..--.-.-.-.-.-..-.-.-.---------.--.---..--...--.-----.-.-.-...--.-.-.---.------.--..-.--.-----.-...-..------", "output": "11020111110111222212021020002022111100201121222020012022110010222" }, { "input": "-.-..-.--.---..---.-..---.-...-.-.----..-.---.-.---..-.--.---.-.-------.---.--....----.-.---.---.---.----.-----..---.-.-.-.-----.--.-------.-..", "output": "110120210211021100112200121121012021122212120000220121212122022102111122120222110" }, { "input": ".-..-.-.---.-----.--.---...-.--.-.-....-..", "output": "01011212212021001201100010" }, { "input": ".------.-.---..--...-..-..-.-.-.--.--.-..-.--...-.-.---.-.-.------..--..-.---..----.-..-.--.---.-.----.-.---...-.-.-.-----.-.-.---.---.-.....-.-...-----.-...-.---.-..-.-----.--...---.-.-..-.--.-.---..", "output": "022201210200010101112020101200011211122200200121022010120211220121001112211121211000011002211001211012212000211101201210" }, { "input": ".-.--.---.-----.-.-----.-.-..-----..-..----..--.-.--.----..---.---..-.-.-----..-------.----..----.-..---...-----..-..-----...-..-.-.-----....---..---..-.-----...-.--...--.-.---.-.-.-.-.-...---..----.", "output": "01202122112211102210102200201202200212101122102221220022010210022101022100101122100021021012210012000201211111100210220" }, { "input": "..-.-.-.---.-.-.-..-.-..-.-.---.-------.---..-----.---....-.---.--.--.-.---.---------.-..---.-.-.--..---.---.-.---.-.-..-.-..-.-.-.----.--.-....--------.-.---..----.------.-.-.--.--.-----.-----.----", "output": "0011121111011011212221210221210001212020121222211021112002121121110110111220201000222201210220222011202022122122" }, { "input": "-..-------.------.-..--.-.-..--.-.-..-----..-.-.-..-..-..--.---..-----..---..-..--.-..-.-.---...-.....-------.---.-----.-...-.-...-.-.---.---.-----.--.--...-.--..-.-..-...-.-.-.-.---..---.-..-.-.-.-..", "output": "102221222010201102011022101110101020210221021010201011210010000222121221100110011212122120200012001101001111210211011110" }, { "input": ".-.----.-.--..-.-.-.-..----..-.-...--.-.---.---.-------..-.--..-......--.------.--.----.--...-.--.--..-----..-.....--.--.-.-.------..--------.----------..-.---.----.---.-..--..-.....-..------.--.", "output": "012201200111102200110020121212221012001000002022202022020001202002210100002020112220022220222220012122021102001000010222020" }, { "input": "------.-----.-....--.-.----.-.---.-.-..---.-.---.-----..-...-.-.---..-.-.-..-.-.-...-.-.-.----..--.------.----.-..-.--...-.-------...-.-..-.-.--.--.---..--..--------.--.-.-.---.-.-.-...----.--..-.--..", "output": "222022110002012201211102112122101001121011101110011122002022202201012000122210011011202021020022220201121111002202001200" }, { "input": "-.---...----...--.--...-.--.----", "output": "121002200020200012022" }, { "input": "--.--.--.---.--.-.---.-.-..-..--.-..---.-.....-..---.-----.--...-.-.-------.-.--.-.----.-..-.------.", "output": "202020212012111010201021100001021221200011222112012201012220" } ]
1,481,641,183
2,147,483,647
Python 3
OK
TESTS
30
122
0
a = input() res = "" c = 0 while c < len(a): if a[c:c + 2] == "--": res += "2" c += 2 elif a[c:c + 2] == "-.": res += "1" c += 2 else: res += "0" c += 1 print(res)
Title: Borze Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet. Input Specification: The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes). Output Specification: Output the decoded ternary number. It can have leading zeroes. Demo Input: ['.-.--\n', '--.\n', '-..-.--\n'] Demo Output: ['012', '20', '1012'] Note: none
```python a = input() res = "" c = 0 while c < len(a): if a[c:c + 2] == "--": res += "2" c += 2 elif a[c:c + 2] == "-.": res += "1" c += 2 else: res += "0" c += 1 print(res) ```
3.9695
912
A
Tricky Alchemy
PROGRAMMING
800
[ "implementation" ]
null
null
During the winter holidays, the demand for Christmas balls is exceptionally high. Since it's already 2018, the advances in alchemy allow easy and efficient ball creation by utilizing magic crystals. Grisha needs to obtain some yellow, green and blue balls. It's known that to produce a yellow ball one needs two yellow crystals, green — one yellow and one blue, and for a blue ball, three blue crystals are enough. Right now there are *A* yellow and *B* blue crystals in Grisha's disposal. Find out how many additional crystals he should acquire in order to produce the required number of balls.
The first line features two integers *A* and *B* (0<=≤<=*A*,<=*B*<=≤<=109), denoting the number of yellow and blue crystals respectively at Grisha's disposal. The next line contains three integers *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=109) — the respective amounts of yellow, green and blue balls to be obtained.
Print a single integer — the minimum number of crystals that Grisha should acquire in addition.
[ "4 3\n2 1 1\n", "3 9\n1 1 3\n", "12345678 87654321\n43043751 1000000000 53798715\n" ]
[ "2\n", "1\n", "2147483648\n" ]
In the first sample case, Grisha needs five yellow and four blue crystals to create two yellow balls, one green ball, and one blue ball. To do that, Grisha needs to obtain two additional crystals: one yellow and one blue.
500
[ { "input": "4 3\n2 1 1", "output": "2" }, { "input": "3 9\n1 1 3", "output": "1" }, { "input": "12345678 87654321\n43043751 1000000000 53798715", "output": "2147483648" }, { "input": "12 12\n3 5 2", "output": "0" }, { "input": "770 1390\n170 442 311", "output": "12" }, { "input": "3555165 6693472\n1499112 556941 3075290", "output": "3089339" }, { "input": "0 0\n1000000000 1000000000 1000000000", "output": "7000000000" }, { "input": "1 1\n0 1 0", "output": "0" }, { "input": "117708228 562858833\n118004008 360437130 154015822", "output": "738362681" }, { "input": "999998118 700178721\n822106746 82987112 547955384", "output": "1753877029" }, { "input": "566568710 765371101\n60614022 80126928 809950465", "output": "1744607222" }, { "input": "448858599 829062060\n764716760 97644201 203890025", "output": "1178219122" }, { "input": "626115781 966381948\n395190569 820194184 229233367", "output": "1525971878" }, { "input": "803372962 103701834\n394260597 837711458 623172928", "output": "3426388098" }, { "input": "980630143 241021722\n24734406 928857659 312079781", "output": "1624075280" }, { "input": "862920032 378341609\n360240924 241342224 337423122", "output": "974174021" }, { "input": "40177212 515661496\n64343660 963892207 731362684", "output": "3694721078" }, { "input": "217434393 579352456\n694817470 981409480 756706026", "output": "4825785129" }, { "input": "394691574 716672343\n398920207 72555681 150645586", "output": "475704521" }, { "input": "276981463 853992230\n29394015 90072954 839552440", "output": "1754738044" }, { "input": "843552056 919184611\n341530221 423649259 101547519", "output": "263157645" }, { "input": "20809236 56504497\n972004030 441166533 495487081", "output": "4235488636" }, { "input": "198066417 825228166\n602477839 532312735 520830423", "output": "2808777834" }, { "input": "80356306 962548053\n601547868 549830008 914769984", "output": "4004161345" }, { "input": "257613487 394835231\n642087093 567347282 308709545", "output": "2692548667" }, { "input": "139903376 532155119\n641157122 289897263 629020178", "output": "3077110809" }, { "input": "612127849 669475006\n271630930 676010757 22959739", "output": "682559736" }, { "input": "0 0\n0 0 0", "output": "0" }, { "input": "1000000000 1000000000\n499999998 4 333333332", "output": "0" }, { "input": "1000000000 1000000000\n1000000000 1000000000 1000000000", "output": "5000000000" }, { "input": "4 3\n1 0 1", "output": "0" }, { "input": "4 12\n1 2 3", "output": "0" }, { "input": "4 20\n1 2 1", "output": "0" }, { "input": "100 10\n2 3 4", "output": "5" }, { "input": "6 0\n1 1 1", "output": "4" }, { "input": "25 5\n3 3 3", "output": "7" }, { "input": "48 27\n22 39 20", "output": "107" }, { "input": "4 0\n1 1 1", "output": "4" } ]
1,524,720,398
2,147,483,647
Python 3
OK
TESTS
38
93
7,372,800
A, B = [int(x) for x in input().split()] x, y, z = [int(x) for x in input().split()] yellow = x*2 + y blue = y + z*3 if A >= yellow: ans1 = 0 else: ans1 = yellow - A if B >= blue: ans2 = 0 else: ans2 = blue - B print(ans1 + ans2)
Title: Tricky Alchemy Time Limit: None seconds Memory Limit: None megabytes Problem Description: During the winter holidays, the demand for Christmas balls is exceptionally high. Since it's already 2018, the advances in alchemy allow easy and efficient ball creation by utilizing magic crystals. Grisha needs to obtain some yellow, green and blue balls. It's known that to produce a yellow ball one needs two yellow crystals, green — one yellow and one blue, and for a blue ball, three blue crystals are enough. Right now there are *A* yellow and *B* blue crystals in Grisha's disposal. Find out how many additional crystals he should acquire in order to produce the required number of balls. Input Specification: The first line features two integers *A* and *B* (0<=≤<=*A*,<=*B*<=≤<=109), denoting the number of yellow and blue crystals respectively at Grisha's disposal. The next line contains three integers *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=109) — the respective amounts of yellow, green and blue balls to be obtained. Output Specification: Print a single integer — the minimum number of crystals that Grisha should acquire in addition. Demo Input: ['4 3\n2 1 1\n', '3 9\n1 1 3\n', '12345678 87654321\n43043751 1000000000 53798715\n'] Demo Output: ['2\n', '1\n', '2147483648\n'] Note: In the first sample case, Grisha needs five yellow and four blue crystals to create two yellow balls, one green ball, and one blue ball. To do that, Grisha needs to obtain two additional crystals: one yellow and one blue.
```python A, B = [int(x) for x in input().split()] x, y, z = [int(x) for x in input().split()] yellow = x*2 + y blue = y + z*3 if A >= yellow: ans1 = 0 else: ans1 = yellow - A if B >= blue: ans2 = 0 else: ans2 = blue - B print(ans1 + ans2) ```
3
996
A
Hit the Lottery
PROGRAMMING
800
[ "dp", "greedy" ]
null
null
Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance?
The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$).
Output the minimum number of bills that Allen could receive.
[ "125\n", "43\n", "1000000000\n" ]
[ "3\n", "5\n", "10000000\n" ]
In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills. In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills. In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
500
[ { "input": "125", "output": "3" }, { "input": "43", "output": "5" }, { "input": "1000000000", "output": "10000000" }, { "input": "4", "output": "4" }, { "input": "5", "output": "1" }, { "input": "1", "output": "1" }, { "input": "74", "output": "8" }, { "input": "31", "output": "3" }, { "input": "59", "output": "8" }, { "input": "79", "output": "9" }, { "input": "7", "output": "3" }, { "input": "55", "output": "4" }, { "input": "40", "output": "2" }, { "input": "719", "output": "13" }, { "input": "847", "output": "13" }, { "input": "225", "output": "4" }, { "input": "4704", "output": "51" }, { "input": "1132", "output": "15" }, { "input": "7811", "output": "80" }, { "input": "7981", "output": "84" }, { "input": "82655", "output": "830" }, { "input": "6364", "output": "70" }, { "input": "74611", "output": "748" }, { "input": "45391", "output": "459" }, { "input": "620448", "output": "6210" }, { "input": "265145", "output": "2654" }, { "input": "671704", "output": "6721" }, { "input": "365173", "output": "3658" }, { "input": "7130872", "output": "71314" }, { "input": "9628747", "output": "96292" }, { "input": "8898399", "output": "88993" }, { "input": "9497953", "output": "94985" }, { "input": "19070947", "output": "190714" }, { "input": "20185520", "output": "201856" }, { "input": "91402248", "output": "914028" }, { "input": "27035533", "output": "270360" }, { "input": "22717528", "output": "227180" }, { "input": "24403439", "output": "244041" }, { "input": "163565555", "output": "1635659" }, { "input": "152541908", "output": "1525423" }, { "input": "668439837", "output": "6684403" }, { "input": "20", "output": "1" }, { "input": "999999999", "output": "10000009" }, { "input": "10", "output": "1" }, { "input": "7", "output": "3" }, { "input": "6", "output": "2" }, { "input": "99999999", "output": "1000009" }, { "input": "1000001", "output": "10001" }, { "input": "2521", "output": "27" } ]
1,693,164,547
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
6
30
0
n = int(input()) ds = [1,5,10,20,100] ds.sort(reverse=True) i=0 c=0 while n>0: if ds[i]<=n: num = n/ds[i] c+=num n = n%ds[i] i+=1 print(int(c))
Title: Hit the Lottery Time Limit: None seconds Memory Limit: None megabytes Problem Description: Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance? Input Specification: The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$). Output Specification: Output the minimum number of bills that Allen could receive. Demo Input: ['125\n', '43\n', '1000000000\n'] Demo Output: ['3\n', '5\n', '10000000\n'] Note: In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills. In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills. In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
```python n = int(input()) ds = [1,5,10,20,100] ds.sort(reverse=True) i=0 c=0 while n>0: if ds[i]<=n: num = n/ds[i] c+=num n = n%ds[i] i+=1 print(int(c)) ```
0
508
A
Pasha and Pixels
PROGRAMMING
1,100
[ "brute force" ]
null
null
Pasha loves his phone and also putting his hair up... But the hair is now irrelevant. Pasha has installed a new game to his phone. The goal of the game is following. There is a rectangular field consisting of *n* row with *m* pixels in each row. Initially, all the pixels are colored white. In one move, Pasha can choose any pixel and color it black. In particular, he can choose the pixel that is already black, then after the boy's move the pixel does not change, that is, it remains black. Pasha loses the game when a 2<=×<=2 square consisting of black pixels is formed. Pasha has made a plan of *k* moves, according to which he will paint pixels. Each turn in his plan is represented as a pair of numbers *i* and *j*, denoting respectively the row and the column of the pixel to be colored on the current move. Determine whether Pasha loses if he acts in accordance with his plan, and if he does, on what move the 2<=×<=2 square consisting of black pixels is formed.
The first line of the input contains three integers *n*,<=*m*,<=*k* (1<=≤<=*n*,<=*m*<=≤<=1000, 1<=≤<=*k*<=≤<=105) — the number of rows, the number of columns and the number of moves that Pasha is going to perform. The next *k* lines contain Pasha's moves in the order he makes them. Each line contains two integers *i* and *j* (1<=≤<=*i*<=≤<=*n*, 1<=≤<=*j*<=≤<=*m*), representing the row number and column number of the pixel that was painted during a move.
If Pasha loses, print the number of the move when the 2<=×<=2 square consisting of black pixels is formed. If Pasha doesn't lose, that is, no 2<=×<=2 square consisting of black pixels is formed during the given *k* moves, print 0.
[ "2 2 4\n1 1\n1 2\n2 1\n2 2\n", "2 3 6\n2 3\n2 2\n1 3\n2 2\n1 2\n1 1\n", "5 3 7\n2 3\n1 2\n1 1\n4 1\n3 1\n5 3\n3 2\n" ]
[ "4\n", "5\n", "0\n" ]
none
500
[ { "input": "2 2 4\n1 1\n1 2\n2 1\n2 2", "output": "4" }, { "input": "2 3 6\n2 3\n2 2\n1 3\n2 2\n1 2\n1 1", "output": "5" }, { "input": "5 3 7\n2 3\n1 2\n1 1\n4 1\n3 1\n5 3\n3 2", "output": "0" }, { "input": "3 3 11\n2 1\n3 1\n1 1\n1 3\n1 2\n2 3\n3 3\n3 2\n2 2\n1 3\n3 3", "output": "9" }, { "input": "2 2 5\n1 1\n2 1\n2 1\n1 2\n2 2", "output": "5" }, { "input": "518 518 10\n37 97\n47 278\n17 467\n158 66\n483 351\n83 123\n285 219\n513 187\n380 75\n304 352", "output": "0" }, { "input": "1 1 5\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "0" }, { "input": "1 5 5\n1 1\n1 2\n1 3\n1 4\n1 5", "output": "0" }, { "input": "5 1 5\n1 1\n2 1\n3 1\n4 1\n5 1", "output": "0" }, { "input": "1 1 1\n1 1", "output": "0" }, { "input": "10 10 4\n5 9\n6 9\n6 10\n5 10", "output": "4" }, { "input": "1000 1000 4\n999 999\n999 1000\n1000 999\n1000 1000", "output": "4" }, { "input": "2 3 5\n2 3\n1 3\n1 2\n1 1\n2 2", "output": "5" }, { "input": "1000 1000 4\n1000 1000\n999 999\n1000 999\n999 1000", "output": "4" } ]
1,668,439,020
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
7
327
0
n,m,k = map(int,input().split()) a = [[0 for i in range(m+2)]for j in range(n+2)] def check(p,q,alist): if alist[p-1][q-1] + alist[p][q-1] + alist[p-1][q] == 3: return 1 if alist[p][q-1] + alist[p+1][q-1] + alist[p+1][q] == 3: return 1 if alist[p+1][q] + alist[p+1][q+1] + alist[p][q+1] == 3: return 1 if alist[p][q+1] + alist[p-1][q] + alist[p][q+1] == 3: return 1 return 0 for i in range(k): x,y = map(int,input().split()) a[x][y] = 1 if check(x,y,a): print(i+1) break else: print(0)
Title: Pasha and Pixels Time Limit: None seconds Memory Limit: None megabytes Problem Description: Pasha loves his phone and also putting his hair up... But the hair is now irrelevant. Pasha has installed a new game to his phone. The goal of the game is following. There is a rectangular field consisting of *n* row with *m* pixels in each row. Initially, all the pixels are colored white. In one move, Pasha can choose any pixel and color it black. In particular, he can choose the pixel that is already black, then after the boy's move the pixel does not change, that is, it remains black. Pasha loses the game when a 2<=×<=2 square consisting of black pixels is formed. Pasha has made a plan of *k* moves, according to which he will paint pixels. Each turn in his plan is represented as a pair of numbers *i* and *j*, denoting respectively the row and the column of the pixel to be colored on the current move. Determine whether Pasha loses if he acts in accordance with his plan, and if he does, on what move the 2<=×<=2 square consisting of black pixels is formed. Input Specification: The first line of the input contains three integers *n*,<=*m*,<=*k* (1<=≤<=*n*,<=*m*<=≤<=1000, 1<=≤<=*k*<=≤<=105) — the number of rows, the number of columns and the number of moves that Pasha is going to perform. The next *k* lines contain Pasha's moves in the order he makes them. Each line contains two integers *i* and *j* (1<=≤<=*i*<=≤<=*n*, 1<=≤<=*j*<=≤<=*m*), representing the row number and column number of the pixel that was painted during a move. Output Specification: If Pasha loses, print the number of the move when the 2<=×<=2 square consisting of black pixels is formed. If Pasha doesn't lose, that is, no 2<=×<=2 square consisting of black pixels is formed during the given *k* moves, print 0. Demo Input: ['2 2 4\n1 1\n1 2\n2 1\n2 2\n', '2 3 6\n2 3\n2 2\n1 3\n2 2\n1 2\n1 1\n', '5 3 7\n2 3\n1 2\n1 1\n4 1\n3 1\n5 3\n3 2\n'] Demo Output: ['4\n', '5\n', '0\n'] Note: none
```python n,m,k = map(int,input().split()) a = [[0 for i in range(m+2)]for j in range(n+2)] def check(p,q,alist): if alist[p-1][q-1] + alist[p][q-1] + alist[p-1][q] == 3: return 1 if alist[p][q-1] + alist[p+1][q-1] + alist[p+1][q] == 3: return 1 if alist[p+1][q] + alist[p+1][q+1] + alist[p][q+1] == 3: return 1 if alist[p][q+1] + alist[p-1][q] + alist[p][q+1] == 3: return 1 return 0 for i in range(k): x,y = map(int,input().split()) a[x][y] = 1 if check(x,y,a): print(i+1) break else: print(0) ```
0
228
A
Is your horseshoe on the other hoof?
PROGRAMMING
800
[ "implementation" ]
null
null
Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party.
The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has. Consider all possible colors indexed with integers.
Print a single integer — the minimum number of horseshoes Valera needs to buy.
[ "1 7 3 3\n", "7 7 7 7\n" ]
[ "1\n", "3\n" ]
none
500
[ { "input": "1 7 3 3", "output": "1" }, { "input": "7 7 7 7", "output": "3" }, { "input": "81170865 673572653 756938629 995577259", "output": "0" }, { "input": "3491663 217797045 522540872 715355328", "output": "0" }, { "input": "251590420 586975278 916631563 586975278", "output": "1" }, { "input": "259504825 377489979 588153796 377489979", "output": "1" }, { "input": "652588203 931100304 931100304 652588203", "output": "2" }, { "input": "391958720 651507265 391958720 651507265", "output": "2" }, { "input": "90793237 90793237 90793237 90793237", "output": "3" }, { "input": "551651653 551651653 551651653 551651653", "output": "3" }, { "input": "156630260 609654355 668943582 973622757", "output": "0" }, { "input": "17061017 110313588 434481173 796661222", "output": "0" }, { "input": "24975422 256716298 337790533 690960249", "output": "0" }, { "input": "255635360 732742923 798648949 883146723", "output": "0" }, { "input": "133315691 265159773 734556507 265159773", "output": "1" }, { "input": "28442865 741657755 978106882 978106882", "output": "1" }, { "input": "131245479 174845575 497483467 131245479", "output": "1" }, { "input": "139159884 616215581 958341883 616215581", "output": "1" }, { "input": "147784432 947653080 947653080 947653080", "output": "2" }, { "input": "94055790 756126496 756126496 94055790", "output": "2" }, { "input": "240458500 511952208 240458500 511952208", "output": "2" }, { "input": "681828506 972810624 972810624 681828506", "output": "2" }, { "input": "454961014 454961014 454961014 454961014", "output": "3" }, { "input": "915819430 915819430 915819430 915819430", "output": "3" }, { "input": "671645142 671645142 671645142 671645142", "output": "3" }, { "input": "132503558 132503558 132503558 132503558", "output": "3" }, { "input": "5 5 999999 6", "output": "1" }, { "input": "1 1 2 5", "output": "1" }, { "input": "2 1 2 3", "output": "1" }, { "input": "1 1 3 5", "output": "1" }, { "input": "1 1 3 3", "output": "2" }, { "input": "2 2 2 1", "output": "2" }, { "input": "3 1 1 1", "output": "2" }, { "input": "1 2 2 2", "output": "2" } ]
1,689,889,673
2,147,483,647
Python 3
OK
TESTS
34
62
0
herraduras = list(map(int,input().split())) diferentes = set(herraduras) respuesta = 4 - len(diferentes) print(respuesta)
Title: Is your horseshoe on the other hoof? Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party. Input Specification: The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has. Consider all possible colors indexed with integers. Output Specification: Print a single integer — the minimum number of horseshoes Valera needs to buy. Demo Input: ['1 7 3 3\n', '7 7 7 7\n'] Demo Output: ['1\n', '3\n'] Note: none
```python herraduras = list(map(int,input().split())) diferentes = set(herraduras) respuesta = 4 - len(diferentes) print(respuesta) ```
3
962
A
Equator
PROGRAMMING
1,300
[ "implementation" ]
null
null
Polycarp has created his own training plan to prepare for the programming contests. He will train for $n$ days, all days are numbered from $1$ to $n$, beginning from the first. On the $i$-th day Polycarp will necessarily solve $a_i$ problems. One evening Polycarp plans to celebrate the equator. He will celebrate it on the first evening of such a day that from the beginning of the training and to this day inclusive he will solve half or more of all the problems. Determine the index of day when Polycarp will celebrate the equator.
The first line contains a single integer $n$ ($1 \le n \le 200\,000$) — the number of days to prepare for the programming contests. The second line contains a sequence $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10\,000$), where $a_i$ equals to the number of problems, which Polycarp will solve on the $i$-th day.
Print the index of the day when Polycarp will celebrate the equator.
[ "4\n1 3 2 1\n", "6\n2 2 2 2 2 2\n" ]
[ "2\n", "3\n" ]
In the first example Polycarp will celebrate the equator on the evening of the second day, because up to this day (inclusive) he will solve $4$ out of $7$ scheduled problems on four days of the training. In the second example Polycarp will celebrate the equator on the evening of the third day, because up to this day (inclusive) he will solve $6$ out of $12$ scheduled problems on six days of the training.
0
[ { "input": "4\n1 3 2 1", "output": "2" }, { "input": "6\n2 2 2 2 2 2", "output": "3" }, { "input": "1\n10000", "output": "1" }, { "input": "3\n2 1 1", "output": "1" }, { "input": "2\n1 3", "output": "2" }, { "input": "4\n2 1 1 3", "output": "3" }, { "input": "3\n1 1 3", "output": "3" }, { "input": "3\n1 1 1", "output": "2" }, { "input": "2\n1 2", "output": "2" }, { "input": "3\n2 1 2", "output": "2" }, { "input": "5\n1 2 4 3 5", "output": "4" }, { "input": "5\n2 2 2 4 3", "output": "4" }, { "input": "4\n1 2 3 1", "output": "3" }, { "input": "6\n7 3 10 7 3 11", "output": "4" }, { "input": "2\n3 4", "output": "2" }, { "input": "5\n1 1 1 1 1", "output": "3" }, { "input": "4\n1 3 2 3", "output": "3" }, { "input": "2\n2 3", "output": "2" }, { "input": "3\n32 10 23", "output": "2" }, { "input": "7\n1 1 1 1 1 1 1", "output": "4" }, { "input": "3\n1 2 4", "output": "3" }, { "input": "6\n3 3 3 2 4 4", "output": "4" }, { "input": "9\n1 1 1 1 1 1 1 1 1", "output": "5" }, { "input": "5\n1 3 3 1 1", "output": "3" }, { "input": "4\n1 1 1 2", "output": "3" }, { "input": "4\n1 2 1 3", "output": "3" }, { "input": "3\n2 2 1", "output": "2" }, { "input": "4\n2 3 3 3", "output": "3" }, { "input": "4\n3 2 3 3", "output": "3" }, { "input": "4\n2 1 1 1", "output": "2" }, { "input": "3\n2 1 4", "output": "3" }, { "input": "2\n6 7", "output": "2" }, { "input": "4\n3 3 4 3", "output": "3" }, { "input": "4\n1 1 2 5", "output": "4" }, { "input": "4\n1 8 7 3", "output": "3" }, { "input": "6\n2 2 2 2 2 3", "output": "4" }, { "input": "3\n2 2 5", "output": "3" }, { "input": "4\n1 1 2 1", "output": "3" }, { "input": "5\n1 1 2 2 3", "output": "4" }, { "input": "5\n9 5 3 4 8", "output": "3" }, { "input": "3\n3 3 1", "output": "2" }, { "input": "4\n1 2 2 2", "output": "3" }, { "input": "3\n1 3 5", "output": "3" }, { "input": "4\n1 1 3 6", "output": "4" }, { "input": "6\n1 2 1 1 1 1", "output": "3" }, { "input": "3\n3 1 3", "output": "2" }, { "input": "5\n3 4 5 1 2", "output": "3" }, { "input": "11\n1 1 1 1 1 1 1 1 1 1 1", "output": "6" }, { "input": "5\n3 1 2 5 2", "output": "4" }, { "input": "4\n1 1 1 4", "output": "4" }, { "input": "4\n2 6 1 10", "output": "4" }, { "input": "4\n2 2 3 2", "output": "3" }, { "input": "4\n4 2 2 1", "output": "2" }, { "input": "6\n1 1 1 1 1 4", "output": "5" }, { "input": "3\n3 2 2", "output": "2" }, { "input": "6\n1 3 5 1 7 4", "output": "5" }, { "input": "5\n1 2 4 8 16", "output": "5" }, { "input": "5\n1 2 4 4 4", "output": "4" }, { "input": "6\n4 2 1 2 3 1", "output": "3" }, { "input": "4\n3 2 1 5", "output": "3" }, { "input": "1\n1", "output": "1" }, { "input": "3\n2 4 7", "output": "3" }, { "input": "5\n1 1 1 1 3", "output": "4" }, { "input": "3\n3 1 5", "output": "3" }, { "input": "4\n1 2 3 7", "output": "4" }, { "input": "3\n1 4 6", "output": "3" }, { "input": "4\n2 1 2 2", "output": "3" }, { "input": "2\n4 5", "output": "2" }, { "input": "5\n1 2 1 2 1", "output": "3" }, { "input": "3\n2 3 6", "output": "3" }, { "input": "6\n1 1 4 1 1 5", "output": "4" }, { "input": "5\n2 2 2 2 1", "output": "3" }, { "input": "2\n5 6", "output": "2" }, { "input": "4\n2 2 1 4", "output": "3" }, { "input": "5\n2 2 3 4 4", "output": "4" }, { "input": "4\n3 1 1 2", "output": "2" }, { "input": "5\n3 4 1 4 5", "output": "4" }, { "input": "4\n1 3 1 6", "output": "4" }, { "input": "5\n1 1 1 2 2", "output": "4" }, { "input": "4\n1 4 2 4", "output": "3" }, { "input": "10\n1 1 1 1 1 1 1 1 1 8", "output": "9" }, { "input": "4\n1 4 5 1", "output": "3" }, { "input": "5\n1 1 1 1 5", "output": "5" }, { "input": "4\n1 3 4 1", "output": "3" }, { "input": "4\n2 2 2 3", "output": "3" }, { "input": "4\n2 3 2 4", "output": "3" }, { "input": "5\n2 2 1 2 2", "output": "3" }, { "input": "3\n4 3 2", "output": "2" }, { "input": "3\n6 5 2", "output": "2" }, { "input": "69\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "35" }, { "input": "6\n1 1 1 1 1 2", "output": "4" }, { "input": "5\n1 2 5 4 5", "output": "4" }, { "input": "2\n9 10", "output": "2" }, { "input": "3\n1 1 5", "output": "3" }, { "input": "4\n3 4 3 5", "output": "3" }, { "input": "4\n1 4 3 3", "output": "3" }, { "input": "4\n7 1 3 4", "output": "2" }, { "input": "3\n100 100 1", "output": "2" }, { "input": "4\n5 2 2 2", "output": "2" } ]
1,589,284,530
2,147,483,647
Python 3
OK
TESTS
106
171
20,787,200
#ROUNIAAUDI ans=int(input()) list1=list(map(int,input().split())) sum2=sum(list1) s=sum2/2 k=0 i=0 while s>k: k += list1[i] i+=1 print(i)
Title: Equator Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarp has created his own training plan to prepare for the programming contests. He will train for $n$ days, all days are numbered from $1$ to $n$, beginning from the first. On the $i$-th day Polycarp will necessarily solve $a_i$ problems. One evening Polycarp plans to celebrate the equator. He will celebrate it on the first evening of such a day that from the beginning of the training and to this day inclusive he will solve half or more of all the problems. Determine the index of day when Polycarp will celebrate the equator. Input Specification: The first line contains a single integer $n$ ($1 \le n \le 200\,000$) — the number of days to prepare for the programming contests. The second line contains a sequence $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10\,000$), where $a_i$ equals to the number of problems, which Polycarp will solve on the $i$-th day. Output Specification: Print the index of the day when Polycarp will celebrate the equator. Demo Input: ['4\n1 3 2 1\n', '6\n2 2 2 2 2 2\n'] Demo Output: ['2\n', '3\n'] Note: In the first example Polycarp will celebrate the equator on the evening of the second day, because up to this day (inclusive) he will solve $4$ out of $7$ scheduled problems on four days of the training. In the second example Polycarp will celebrate the equator on the evening of the third day, because up to this day (inclusive) he will solve $6$ out of $12$ scheduled problems on six days of the training.
```python #ROUNIAAUDI ans=int(input()) list1=list(map(int,input().split())) sum2=sum(list1) s=sum2/2 k=0 i=0 while s>k: k += list1[i] i+=1 print(i) ```
3
0
none
none
none
0
[ "none" ]
null
null
Efim just received his grade for the last test. He studies in a special school and his grade can be equal to any positive decimal fraction. First he got disappointed, as he expected a way more pleasant result. Then, he developed a tricky plan. Each second, he can ask his teacher to round the grade at any place after the decimal point (also, he can ask to round to the nearest integer). There are *t* seconds left till the end of the break, so Efim has to act fast. Help him find what is the maximum grade he can get in no more than *t* seconds. Note, that he can choose to not use all *t* seconds. Moreover, he can even choose to not round the grade at all. In this problem, classic rounding rules are used: while rounding number to the *n*-th digit one has to take a look at the digit *n*<=+<=1. If it is less than 5 than the *n*-th digit remain unchanged while all subsequent digits are replaced with 0. Otherwise, if the *n*<=+<=1 digit is greater or equal to 5, the digit at the position *n* is increased by 1 (this might also change some other digits, if this one was equal to 9) and all subsequent digits are replaced with 0. At the end, all trailing zeroes are thrown away. For example, if the number 1.14 is rounded to the first decimal place, the result is 1.1, while if we round 1.5 to the nearest integer, the result is 2. Rounding number 1.299996121 in the fifth decimal place will result in number 1.3.
The first line of the input contains two integers *n* and *t* (1<=≤<=*n*<=≤<=200<=000, 1<=≤<=*t*<=≤<=109) — the length of Efim's grade and the number of seconds till the end of the break respectively. The second line contains the grade itself. It's guaranteed that the grade is a positive number, containing at least one digit after the decimal points, and it's representation doesn't finish with 0.
Print the maximum grade that Efim can get in *t* seconds. Do not print trailing zeroes.
[ "6 1\n10.245\n", "6 2\n10.245\n", "3 100\n9.2\n" ]
[ "10.25\n", "10.3\n", "9.2\n" ]
In the first two samples Efim initially has grade 10.245. During the first second Efim can obtain grade 10.25, and then 10.3 during the next second. Note, that the answer 10.30 will be considered incorrect. In the third sample the optimal strategy is to not perform any rounding at all.
0
[ { "input": "6 1\n10.245", "output": "10.25" }, { "input": "6 2\n10.245", "output": "10.3" }, { "input": "3 100\n9.2", "output": "9.2" }, { "input": "12 5\n872.04488525", "output": "872.1" }, { "input": "35 8\n984227318.2031144444444444494637612", "output": "984227318.2031144445" }, { "input": "320 142\n2704701300865535.432223312233434114130011113220102420131323010344144201124303144444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444447444444444444444444444444444444615444444482101673308979557675074444444444444446867245414595534444693160202254444449544495367", "output": "2704701300865535.4322233122334341141300111132201024201313230103441442011243032" }, { "input": "5 10\n1.555", "output": "2" }, { "input": "6 1\n0.9454", "output": "1" }, { "input": "7 1000000000\n239.923", "output": "240" }, { "input": "7 235562\n999.999", "output": "1000" }, { "input": "9 2\n23999.448", "output": "23999.5" }, { "input": "9 3\n23999.448", "output": "24000" }, { "input": "13 1\n761.044449428", "output": "761.04445" }, { "input": "3 1\n0.1", "output": "0.1" }, { "input": "3 1\n9.9", "output": "10" }, { "input": "3 1\n0.9", "output": "1" }, { "input": "31 15\n2707786.24030444444444444724166", "output": "2707786.24031" }, { "input": "4 100\n99.9", "output": "100" }, { "input": "3 10\n9.9", "output": "10" }, { "input": "22 100\n11111111111111111111.5", "output": "11111111111111111112" }, { "input": "3 1\n9.5", "output": "10" }, { "input": "8 100\n9.444445", "output": "10" }, { "input": "6 2\n999.45", "output": "1000" }, { "input": "3 100\n9.9", "output": "10" }, { "input": "18 100\n9.4444444444454444", "output": "10" }, { "input": "16 999\n9595959.95959595", "output": "9595960" }, { "input": "4 100\n99.5", "output": "100" }, { "input": "5 1\n999.9", "output": "1000" }, { "input": "4 1\n5.59", "output": "6" }, { "input": "4 1\n99.5", "output": "100" }, { "input": "4 1\n99.9", "output": "100" }, { "input": "18 6\n102345678999.44449", "output": "102345679000" }, { "input": "3 3\n9.9", "output": "10" }, { "input": "5 1\n99.99", "output": "100" }, { "input": "7 1\n99999.9", "output": "100000" }, { "input": "3 121\n9.9", "output": "10" }, { "input": "8 6\n9.444445", "output": "10" }, { "input": "3 100\n8.9", "output": "9" }, { "input": "10 1\n999.999999", "output": "1000" }, { "input": "5 100\n6.666", "output": "7" }, { "input": "4 100\n9.99", "output": "10" }, { "input": "6 1\n9.9999", "output": "10" }, { "input": "4 10\n99.9", "output": "100" }, { "input": "5 1\n9.999", "output": "10" }, { "input": "3 1231\n9.9", "output": "10" }, { "input": "5 2\n999.9", "output": "1000" }, { "input": "5 100\n144.5", "output": "145" }, { "input": "5 100\n99.45", "output": "100" }, { "input": "10 1\n0.50444445", "output": "1" }, { "input": "7 1\n1.51111", "output": "2" }, { "input": "5 1\n199.9", "output": "200" }, { "input": "3 100\n9.5", "output": "10" }, { "input": "7 1000\n409.659", "output": "410" }, { "input": "4 10\n99.5", "output": "100" }, { "input": "4 10\n10.9", "output": "11" }, { "input": "4 1\n19.5", "output": "20" } ]
1,476,019,886
4,886
Python 3
TIME_LIMIT_EXCEEDED
TESTS
7
1,000
7,168,000
n, t = map(int, input().split()) xs = input() pos = xs.find('.') integer = xs[:pos] decimal = list(map(int, xs[pos+1:])) l = len(decimal) inc = 0 done = False got = False while(l > 0) and t > 0: if done: break got = False for i in range(l): if decimal[i] >= 5: got = True t -= 1 if i == 0: inc = 1 l = 0 done = True break else: decimal[i-1] += 1 l = i for j in reversed(range(i)): if decimal[j] > 9: l -= 1 if j == 0: l = 0 inc = 1 else: decimal[j-1] += 1 break if not got: done = True if inc: print(int(integer)+1) else: print(integer + '.' + str(''.join(map(str, decimal[:l]))))
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Efim just received his grade for the last test. He studies in a special school and his grade can be equal to any positive decimal fraction. First he got disappointed, as he expected a way more pleasant result. Then, he developed a tricky plan. Each second, he can ask his teacher to round the grade at any place after the decimal point (also, he can ask to round to the nearest integer). There are *t* seconds left till the end of the break, so Efim has to act fast. Help him find what is the maximum grade he can get in no more than *t* seconds. Note, that he can choose to not use all *t* seconds. Moreover, he can even choose to not round the grade at all. In this problem, classic rounding rules are used: while rounding number to the *n*-th digit one has to take a look at the digit *n*<=+<=1. If it is less than 5 than the *n*-th digit remain unchanged while all subsequent digits are replaced with 0. Otherwise, if the *n*<=+<=1 digit is greater or equal to 5, the digit at the position *n* is increased by 1 (this might also change some other digits, if this one was equal to 9) and all subsequent digits are replaced with 0. At the end, all trailing zeroes are thrown away. For example, if the number 1.14 is rounded to the first decimal place, the result is 1.1, while if we round 1.5 to the nearest integer, the result is 2. Rounding number 1.299996121 in the fifth decimal place will result in number 1.3. Input Specification: The first line of the input contains two integers *n* and *t* (1<=≤<=*n*<=≤<=200<=000, 1<=≤<=*t*<=≤<=109) — the length of Efim's grade and the number of seconds till the end of the break respectively. The second line contains the grade itself. It's guaranteed that the grade is a positive number, containing at least one digit after the decimal points, and it's representation doesn't finish with 0. Output Specification: Print the maximum grade that Efim can get in *t* seconds. Do not print trailing zeroes. Demo Input: ['6 1\n10.245\n', '6 2\n10.245\n', '3 100\n9.2\n'] Demo Output: ['10.25\n', '10.3\n', '9.2\n'] Note: In the first two samples Efim initially has grade 10.245. During the first second Efim can obtain grade 10.25, and then 10.3 during the next second. Note, that the answer 10.30 will be considered incorrect. In the third sample the optimal strategy is to not perform any rounding at all.
```python n, t = map(int, input().split()) xs = input() pos = xs.find('.') integer = xs[:pos] decimal = list(map(int, xs[pos+1:])) l = len(decimal) inc = 0 done = False got = False while(l > 0) and t > 0: if done: break got = False for i in range(l): if decimal[i] >= 5: got = True t -= 1 if i == 0: inc = 1 l = 0 done = True break else: decimal[i-1] += 1 l = i for j in reversed(range(i)): if decimal[j] > 9: l -= 1 if j == 0: l = 0 inc = 1 else: decimal[j-1] += 1 break if not got: done = True if inc: print(int(integer)+1) else: print(integer + '.' + str(''.join(map(str, decimal[:l])))) ```
0
400
A
Inna and Choose Options
PROGRAMMING
1,000
[ "implementation" ]
null
null
There always is something to choose from! And now, instead of "Noughts and Crosses", Inna choose a very unusual upgrade of this game. The rules of the game are given below: There is one person playing the game. Before the beginning of the game he puts 12 cards in a row on the table. Each card contains a character: "X" or "O". Then the player chooses two positive integers *a* and *b* (*a*·*b*<==<=12), after that he makes a table of size *a*<=×<=*b* from the cards he put on the table as follows: the first *b* cards form the first row of the table, the second *b* cards form the second row of the table and so on, the last *b* cards form the last (number *a*) row of the table. The player wins if some column of the table contain characters "X" on all cards. Otherwise, the player loses. Inna has already put 12 cards on the table in a row. But unfortunately, she doesn't know what numbers *a* and *b* to choose. Help her win the game: print to her all the possible ways of numbers *a*,<=*b* that she can choose and win.
The first line of the input contains integer *t* (1<=≤<=*t*<=≤<=100). This value shows the number of sets of test data in the input. Next follows the description of each of the *t* tests on a separate line. The description of each test is a string consisting of 12 characters, each character is either "X", or "O". The *i*-th character of the string shows the character that is written on the *i*-th card from the start.
For each test, print the answer to the test on a single line. The first number in the line must represent the number of distinct ways to choose the pair *a*,<=*b*. Next, print on this line the pairs in the format *a*x*b*. Print the pairs in the order of increasing first parameter (*a*). Separate the pairs in the line by whitespaces.
[ "4\nOXXXOXOOXOOX\nOXOXOXOXOXOX\nXXXXXXXXXXXX\nOOOOOOOOOOOO\n" ]
[ "3 1x12 2x6 4x3\n4 1x12 2x6 3x4 6x2\n6 1x12 2x6 3x4 4x3 6x2 12x1\n0\n" ]
none
500
[ { "input": "4\nOXXXOXOOXOOX\nOXOXOXOXOXOX\nXXXXXXXXXXXX\nOOOOOOOOOOOO", "output": "3 1x12 2x6 4x3\n4 1x12 2x6 3x4 6x2\n6 1x12 2x6 3x4 4x3 6x2 12x1\n0" }, { "input": "2\nOOOOOOOOOOOO\nXXXXXXXXXXXX", "output": "0\n6 1x12 2x6 3x4 4x3 6x2 12x1" }, { "input": "13\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX", "output": "6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1" } ]
1,597,325,841
1,641
Python 3
WRONG_ANSWER
TESTS
0
93
204,800
for _ in range(int(input())): s=input() s=list(s) n=len(s) ans=[] flag1=0 for i in s: if i=='X': flag1=1 if i=='O': flag2=1 if flag1==1: ans.append((1,12)) if flag2!=1: ans.append((12,1)) flag1=0 flag2=0 #2x6 for i in range(6): if s[i]=='X' and s[i+6]=='X': flag1=1 if flag1==1: ans.append((2,6)) #6x2 s1=s[::2] s2=s[1::2] flag1=0 flag2=0 for i in s1: if i=='O': flag1=1 for i in s2: if i=='O': flag2=1 if flag1==0 or flag2==0: ans.append((6,2)) #3x4 s1=s[::4] s2=s[1::4] s3=s[2::4] s4=s[3::4] flag1=0 flag2=0 flag3=0 flag4=0 for i in s1: if i=='O': flag1=1 for i in s2: if i=='O': flag2=1 for i in s3: if i=='O': flag3=1 for i in s4: if i=='O': flag4=1 if flag1==0 or flag2==0 or flag3==0 or flag4==0: ans.append((3,4)) #4x3 s1=s[::3] s2=s[1::3] s3=s[2::3] flag1=0 flag2=0 flag3=0 for i in s1: if i=='O': flag1=1 for i in s2: if i=='O': flag2=1 for i in s3: if i=='O': flag3=1 if flag1==0 or flag2==0 or flag3==0: ans.append((4,3)) ans.sort() print(f"{len(ans)}",end=' ') for i in range(len(ans)): print(f"{ans[i][0]}x{ans[i][1]}",end=' ') print('')
Title: Inna and Choose Options Time Limit: None seconds Memory Limit: None megabytes Problem Description: There always is something to choose from! And now, instead of "Noughts and Crosses", Inna choose a very unusual upgrade of this game. The rules of the game are given below: There is one person playing the game. Before the beginning of the game he puts 12 cards in a row on the table. Each card contains a character: "X" or "O". Then the player chooses two positive integers *a* and *b* (*a*·*b*<==<=12), after that he makes a table of size *a*<=×<=*b* from the cards he put on the table as follows: the first *b* cards form the first row of the table, the second *b* cards form the second row of the table and so on, the last *b* cards form the last (number *a*) row of the table. The player wins if some column of the table contain characters "X" on all cards. Otherwise, the player loses. Inna has already put 12 cards on the table in a row. But unfortunately, she doesn't know what numbers *a* and *b* to choose. Help her win the game: print to her all the possible ways of numbers *a*,<=*b* that she can choose and win. Input Specification: The first line of the input contains integer *t* (1<=≤<=*t*<=≤<=100). This value shows the number of sets of test data in the input. Next follows the description of each of the *t* tests on a separate line. The description of each test is a string consisting of 12 characters, each character is either "X", or "O". The *i*-th character of the string shows the character that is written on the *i*-th card from the start. Output Specification: For each test, print the answer to the test on a single line. The first number in the line must represent the number of distinct ways to choose the pair *a*,<=*b*. Next, print on this line the pairs in the format *a*x*b*. Print the pairs in the order of increasing first parameter (*a*). Separate the pairs in the line by whitespaces. Demo Input: ['4\nOXXXOXOOXOOX\nOXOXOXOXOXOX\nXXXXXXXXXXXX\nOOOOOOOOOOOO\n'] Demo Output: ['3 1x12 2x6 4x3\n4 1x12 2x6 3x4 6x2\n6 1x12 2x6 3x4 4x3 6x2 12x1\n0\n'] Note: none
```python for _ in range(int(input())): s=input() s=list(s) n=len(s) ans=[] flag1=0 for i in s: if i=='X': flag1=1 if i=='O': flag2=1 if flag1==1: ans.append((1,12)) if flag2!=1: ans.append((12,1)) flag1=0 flag2=0 #2x6 for i in range(6): if s[i]=='X' and s[i+6]=='X': flag1=1 if flag1==1: ans.append((2,6)) #6x2 s1=s[::2] s2=s[1::2] flag1=0 flag2=0 for i in s1: if i=='O': flag1=1 for i in s2: if i=='O': flag2=1 if flag1==0 or flag2==0: ans.append((6,2)) #3x4 s1=s[::4] s2=s[1::4] s3=s[2::4] s4=s[3::4] flag1=0 flag2=0 flag3=0 flag4=0 for i in s1: if i=='O': flag1=1 for i in s2: if i=='O': flag2=1 for i in s3: if i=='O': flag3=1 for i in s4: if i=='O': flag4=1 if flag1==0 or flag2==0 or flag3==0 or flag4==0: ans.append((3,4)) #4x3 s1=s[::3] s2=s[1::3] s3=s[2::3] flag1=0 flag2=0 flag3=0 for i in s1: if i=='O': flag1=1 for i in s2: if i=='O': flag2=1 for i in s3: if i=='O': flag3=1 if flag1==0 or flag2==0 or flag3==0: ans.append((4,3)) ans.sort() print(f"{len(ans)}",end=' ') for i in range(len(ans)): print(f"{ans[i][0]}x{ans[i][1]}",end=' ') print('') ```
0
791
A
Bear and Big Brother
PROGRAMMING
800
[ "implementation" ]
null
null
Bear Limak wants to become the largest of bears, or at least to become larger than his brother Bob. Right now, Limak and Bob weigh *a* and *b* respectively. It's guaranteed that Limak's weight is smaller than or equal to his brother's weight. Limak eats a lot and his weight is tripled after every year, while Bob's weight is doubled after every year. After how many full years will Limak become strictly larger (strictly heavier) than Bob?
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10) — the weight of Limak and the weight of Bob respectively.
Print one integer, denoting the integer number of years after which Limak will become strictly larger than Bob.
[ "4 7\n", "4 9\n", "1 1\n" ]
[ "2\n", "3\n", "1\n" ]
In the first sample, Limak weighs 4 and Bob weighs 7 initially. After one year their weights are 4·3 = 12 and 7·2 = 14 respectively (one weight is tripled while the other one is doubled). Limak isn't larger than Bob yet. After the second year weights are 36 and 28, so the first weight is greater than the second one. Limak became larger than Bob after two years so you should print 2. In the second sample, Limak's and Bob's weights in next years are: 12 and 18, then 36 and 36, and finally 108 and 72 (after three years). The answer is 3. Remember that Limak wants to be larger than Bob and he won't be satisfied with equal weights. In the third sample, Limak becomes larger than Bob after the first year. Their weights will be 3 and 2 then.
500
[ { "input": "4 7", "output": "2" }, { "input": "4 9", "output": "3" }, { "input": "1 1", "output": "1" }, { "input": "4 6", "output": "2" }, { "input": "1 10", "output": "6" }, { "input": "1 1", "output": "1" }, { "input": "1 2", "output": "2" }, { "input": "1 3", "output": "3" }, { "input": "1 4", "output": "4" }, { "input": "1 5", "output": "4" }, { "input": "1 6", "output": "5" }, { "input": "1 7", "output": "5" }, { "input": "1 8", "output": "6" }, { "input": "1 9", "output": "6" }, { "input": "1 10", "output": "6" }, { "input": "2 2", "output": "1" }, { "input": "2 3", "output": "2" }, { "input": "2 4", "output": "2" }, { "input": "2 5", "output": "3" }, { "input": "2 6", "output": "3" }, { "input": "2 7", "output": "4" }, { "input": "2 8", "output": "4" }, { "input": "2 9", "output": "4" }, { "input": "2 10", "output": "4" }, { "input": "3 3", "output": "1" }, { "input": "3 4", "output": "1" }, { "input": "3 5", "output": "2" }, { "input": "3 6", "output": "2" }, { "input": "3 7", "output": "3" }, { "input": "3 8", "output": "3" }, { "input": "3 9", "output": "3" }, { "input": "3 10", "output": "3" }, { "input": "4 4", "output": "1" }, { "input": "4 5", "output": "1" }, { "input": "4 6", "output": "2" }, { "input": "4 7", "output": "2" }, { "input": "4 8", "output": "2" }, { "input": "4 9", "output": "3" }, { "input": "4 10", "output": "3" }, { "input": "5 5", "output": "1" }, { "input": "5 6", "output": "1" }, { "input": "5 7", "output": "1" }, { "input": "5 8", "output": "2" }, { "input": "5 9", "output": "2" }, { "input": "5 10", "output": "2" }, { "input": "6 6", "output": "1" }, { "input": "6 7", "output": "1" }, { "input": "6 8", "output": "1" }, { "input": "6 9", "output": "2" }, { "input": "6 10", "output": "2" }, { "input": "7 7", "output": "1" }, { "input": "7 8", "output": "1" }, { "input": "7 9", "output": "1" }, { "input": "7 10", "output": "1" }, { "input": "8 8", "output": "1" }, { "input": "8 9", "output": "1" }, { "input": "8 10", "output": "1" }, { "input": "9 9", "output": "1" }, { "input": "9 10", "output": "1" }, { "input": "10 10", "output": "1" }, { "input": "10 10", "output": "1" }, { "input": "1 2", "output": "2" } ]
1,698,331,635
2,147,483,647
Python 3
OK
TESTS
62
46
0
a,b = map(int, input().split()) i = 0 while True: a=a*3 b=b*2 i=i+1 if a > b: print(i) break
Title: Bear and Big Brother Time Limit: None seconds Memory Limit: None megabytes Problem Description: Bear Limak wants to become the largest of bears, or at least to become larger than his brother Bob. Right now, Limak and Bob weigh *a* and *b* respectively. It's guaranteed that Limak's weight is smaller than or equal to his brother's weight. Limak eats a lot and his weight is tripled after every year, while Bob's weight is doubled after every year. After how many full years will Limak become strictly larger (strictly heavier) than Bob? Input Specification: The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10) — the weight of Limak and the weight of Bob respectively. Output Specification: Print one integer, denoting the integer number of years after which Limak will become strictly larger than Bob. Demo Input: ['4 7\n', '4 9\n', '1 1\n'] Demo Output: ['2\n', '3\n', '1\n'] Note: In the first sample, Limak weighs 4 and Bob weighs 7 initially. After one year their weights are 4·3 = 12 and 7·2 = 14 respectively (one weight is tripled while the other one is doubled). Limak isn't larger than Bob yet. After the second year weights are 36 and 28, so the first weight is greater than the second one. Limak became larger than Bob after two years so you should print 2. In the second sample, Limak's and Bob's weights in next years are: 12 and 18, then 36 and 36, and finally 108 and 72 (after three years). The answer is 3. Remember that Limak wants to be larger than Bob and he won't be satisfied with equal weights. In the third sample, Limak becomes larger than Bob after the first year. Their weights will be 3 and 2 then.
```python a,b = map(int, input().split()) i = 0 while True: a=a*3 b=b*2 i=i+1 if a > b: print(i) break ```
3
476
B
Dreamoon and WiFi
PROGRAMMING
1,300
[ "bitmasks", "brute force", "combinatorics", "dp", "math", "probabilities" ]
null
null
Dreamoon is standing at the position 0 on a number line. Drazil is sending a list of commands through Wi-Fi to Dreamoon's smartphone and Dreamoon follows them. Each command is one of the following two types: 1. Go 1 unit towards the positive direction, denoted as '+' 1. Go 1 unit towards the negative direction, denoted as '-' But the Wi-Fi condition is so poor that Dreamoon's smartphone reports some of the commands can't be recognized and Dreamoon knows that some of them might even be wrong though successfully recognized. Dreamoon decides to follow every recognized command and toss a fair coin to decide those unrecognized ones (that means, he moves to the 1 unit to the negative or positive direction with the same probability 0.5). You are given an original list of commands sent by Drazil and list received by Dreamoon. What is the probability that Dreamoon ends in the position originally supposed to be final by Drazil's commands?
The first line contains a string *s*1 — the commands Drazil sends to Dreamoon, this string consists of only the characters in the set {'+', '-'}. The second line contains a string *s*2 — the commands Dreamoon's smartphone recognizes, this string consists of only the characters in the set {'+', '-', '?'}. '?' denotes an unrecognized command. Lengths of two strings are equal and do not exceed 10.
Output a single real number corresponding to the probability. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=9.
[ "++-+-\n+-+-+\n", "+-+-\n+-??\n", "+++\n??-\n" ]
[ "1.000000000000\n", "0.500000000000\n", "0.000000000000\n" ]
For the first sample, both *s*<sub class="lower-index">1</sub> and *s*<sub class="lower-index">2</sub> will lead Dreamoon to finish at the same position  + 1. For the second sample, *s*<sub class="lower-index">1</sub> will lead Dreamoon to finish at position 0, while there are four possibilites for *s*<sub class="lower-index">2</sub>: {"+-++", "+-+-", "+--+", "+---"} with ending position {+2, 0, 0, -2} respectively. So there are 2 correct cases out of 4, so the probability of finishing at the correct position is 0.5. For the third sample, *s*<sub class="lower-index">2</sub> could only lead us to finish at positions {+1, -1, -3}, so the probability to finish at the correct position  + 3 is 0.
1,500
[ { "input": "++-+-\n+-+-+", "output": "1.000000000000" }, { "input": "+-+-\n+-??", "output": "0.500000000000" }, { "input": "+++\n??-", "output": "0.000000000000" }, { "input": "++++++++++\n+++??++?++", "output": "0.125000000000" }, { "input": "--+++---+-\n??????????", "output": "0.205078125000" }, { "input": "+--+++--+-\n??????????", "output": "0.246093750000" }, { "input": "+\n+", "output": "1.000000000000" }, { "input": "-\n?", "output": "0.500000000000" }, { "input": "+\n-", "output": "0.000000000000" }, { "input": "-\n-", "output": "1.000000000000" }, { "input": "-\n+", "output": "0.000000000000" }, { "input": "+\n?", "output": "0.500000000000" }, { "input": "++++++++++\n++++++++++", "output": "1.000000000000" }, { "input": "++++++++++\n++++-+++++", "output": "0.000000000000" }, { "input": "----------\n++++++++++", "output": "0.000000000000" }, { "input": "++++++++++\n++++??++++", "output": "0.250000000000" }, { "input": "----------\n+++?++++-+", "output": "0.000000000000" }, { "input": "++++++++++\n++++++++?+", "output": "0.500000000000" }, { "input": "--++++--+\n?-+?-??+-", "output": "0.250000000000" }, { "input": "----------\n??????????", "output": "0.000976562500" }, { "input": "+--++\n+--+-", "output": "0.000000000000" }, { "input": "-----++---\n????????+?", "output": "0.017578125000" }, { "input": "------+--+\n??????????", "output": "0.043945312500" }, { "input": "---++--\n???????", "output": "0.164062500000" }, { "input": "-----++\n???????", "output": "0.164062500000" }, { "input": "+---+--\n???????", "output": "0.164062500000" }, { "input": "---+-+\n??????", "output": "0.234375000000" }, { "input": "+++-+\n---++", "output": "0.000000000000" }, { "input": "++-+--+\n?-?+??+", "output": "0.375000000000" }, { "input": "----+++--\n-+?+++?--", "output": "0.000000000000" }, { "input": "+-----\n+?----", "output": "0.500000000000" } ]
1,694,424,722
2,147,483,647
PyPy 3
RUNTIME_ERROR
TESTS
0
93
2,150,400
from math import comb import sys input = sys.stdin.readline s1, s2 = input(), input() q = s2.count('?') d = s1.count('+') - s2.count('+') print(0 if q < d or d < 0 else comb(q, d) / (2**q))
Title: Dreamoon and WiFi Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dreamoon is standing at the position 0 on a number line. Drazil is sending a list of commands through Wi-Fi to Dreamoon's smartphone and Dreamoon follows them. Each command is one of the following two types: 1. Go 1 unit towards the positive direction, denoted as '+' 1. Go 1 unit towards the negative direction, denoted as '-' But the Wi-Fi condition is so poor that Dreamoon's smartphone reports some of the commands can't be recognized and Dreamoon knows that some of them might even be wrong though successfully recognized. Dreamoon decides to follow every recognized command and toss a fair coin to decide those unrecognized ones (that means, he moves to the 1 unit to the negative or positive direction with the same probability 0.5). You are given an original list of commands sent by Drazil and list received by Dreamoon. What is the probability that Dreamoon ends in the position originally supposed to be final by Drazil's commands? Input Specification: The first line contains a string *s*1 — the commands Drazil sends to Dreamoon, this string consists of only the characters in the set {'+', '-'}. The second line contains a string *s*2 — the commands Dreamoon's smartphone recognizes, this string consists of only the characters in the set {'+', '-', '?'}. '?' denotes an unrecognized command. Lengths of two strings are equal and do not exceed 10. Output Specification: Output a single real number corresponding to the probability. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=9. Demo Input: ['++-+-\n+-+-+\n', '+-+-\n+-??\n', '+++\n??-\n'] Demo Output: ['1.000000000000\n', '0.500000000000\n', '0.000000000000\n'] Note: For the first sample, both *s*<sub class="lower-index">1</sub> and *s*<sub class="lower-index">2</sub> will lead Dreamoon to finish at the same position  + 1. For the second sample, *s*<sub class="lower-index">1</sub> will lead Dreamoon to finish at position 0, while there are four possibilites for *s*<sub class="lower-index">2</sub>: {"+-++", "+-+-", "+--+", "+---"} with ending position {+2, 0, 0, -2} respectively. So there are 2 correct cases out of 4, so the probability of finishing at the correct position is 0.5. For the third sample, *s*<sub class="lower-index">2</sub> could only lead us to finish at positions {+1, -1, -3}, so the probability to finish at the correct position  + 3 is 0.
```python from math import comb import sys input = sys.stdin.readline s1, s2 = input(), input() q = s2.count('?') d = s1.count('+') - s2.count('+') print(0 if q < d or d < 0 else comb(q, d) / (2**q)) ```
-1
136
A
Presents
PROGRAMMING
800
[ "implementation" ]
null
null
Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there. If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift. Now Petya wants to know for each friend *i* the number of a friend who has given him a gift.
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves.
Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*.
[ "4\n2 3 4 1\n", "3\n1 3 2\n", "2\n1 2\n" ]
[ "4 1 2 3\n", "1 3 2\n", "1 2\n" ]
none
500
[ { "input": "4\n2 3 4 1", "output": "4 1 2 3" }, { "input": "3\n1 3 2", "output": "1 3 2" }, { "input": "2\n1 2", "output": "1 2" }, { "input": "1\n1", "output": "1" }, { "input": "10\n1 3 2 6 4 5 7 9 8 10", "output": "1 3 2 5 6 4 7 9 8 10" }, { "input": "5\n5 4 3 2 1", "output": "5 4 3 2 1" }, { "input": "20\n2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19" }, { "input": "21\n3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19", "output": "3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19" }, { "input": "10\n3 4 5 6 7 8 9 10 1 2", "output": "9 10 1 2 3 4 5 6 7 8" }, { "input": "8\n1 5 3 7 2 6 4 8", "output": "1 5 3 7 2 6 4 8" }, { "input": "50\n49 22 4 2 20 46 7 32 5 19 48 24 26 15 45 21 44 11 50 43 39 17 31 1 42 34 3 27 36 25 12 30 13 33 28 35 18 6 8 37 38 14 10 9 29 16 40 23 41 47", "output": "24 4 27 3 9 38 7 39 44 43 18 31 33 42 14 46 22 37 10 5 16 2 48 12 30 13 28 35 45 32 23 8 34 26 36 29 40 41 21 47 49 25 20 17 15 6 50 11 1 19" }, { "input": "34\n13 20 33 30 15 11 27 4 8 2 29 25 24 7 3 22 18 10 26 16 5 1 32 9 34 6 12 14 28 19 31 21 23 17", "output": "22 10 15 8 21 26 14 9 24 18 6 27 1 28 5 20 34 17 30 2 32 16 33 13 12 19 7 29 11 4 31 23 3 25" }, { "input": "92\n23 1 6 4 84 54 44 76 63 34 61 20 48 13 28 78 26 46 90 72 24 55 91 89 53 38 82 5 79 92 29 32 15 64 11 88 60 70 7 66 18 59 8 57 19 16 42 21 80 71 62 27 75 86 36 9 83 73 74 50 43 31 56 30 17 33 40 81 49 12 10 41 22 77 25 68 51 2 47 3 58 69 87 67 39 37 35 65 14 45 52 85", "output": "2 78 80 4 28 3 39 43 56 71 35 70 14 89 33 46 65 41 45 12 48 73 1 21 75 17 52 15 31 64 62 32 66 10 87 55 86 26 85 67 72 47 61 7 90 18 79 13 69 60 77 91 25 6 22 63 44 81 42 37 11 51 9 34 88 40 84 76 82 38 50 20 58 59 53 8 74 16 29 49 68 27 57 5 92 54 83 36 24 19 23 30" }, { "input": "49\n30 24 33 48 7 3 17 2 8 35 10 39 23 40 46 32 18 21 26 22 1 16 47 45 41 28 31 6 12 43 27 11 13 37 19 15 44 5 29 42 4 38 20 34 14 9 25 36 49", "output": "21 8 6 41 38 28 5 9 46 11 32 29 33 45 36 22 7 17 35 43 18 20 13 2 47 19 31 26 39 1 27 16 3 44 10 48 34 42 12 14 25 40 30 37 24 15 23 4 49" }, { "input": "12\n3 8 7 4 6 5 2 1 11 9 10 12", "output": "8 7 1 4 6 5 3 2 10 11 9 12" }, { "input": "78\n16 56 36 78 21 14 9 77 26 57 70 61 41 47 18 44 5 31 50 74 65 52 6 39 22 62 67 69 43 7 64 29 24 40 48 51 73 54 72 12 19 34 4 25 55 33 17 35 23 53 10 8 27 32 42 68 20 63 3 2 1 71 58 46 13 30 49 11 37 66 38 60 28 75 15 59 45 76", "output": "61 60 59 43 17 23 30 52 7 51 68 40 65 6 75 1 47 15 41 57 5 25 49 33 44 9 53 73 32 66 18 54 46 42 48 3 69 71 24 34 13 55 29 16 77 64 14 35 67 19 36 22 50 38 45 2 10 63 76 72 12 26 58 31 21 70 27 56 28 11 62 39 37 20 74 78 8 4" }, { "input": "64\n64 57 40 3 15 8 62 18 33 59 51 19 22 13 4 37 47 45 50 35 63 11 58 42 46 21 7 2 41 48 32 23 28 38 17 12 24 27 49 31 60 6 30 25 61 52 26 54 9 14 29 20 44 39 55 10 34 16 5 56 1 36 53 43", "output": "61 28 4 15 59 42 27 6 49 56 22 36 14 50 5 58 35 8 12 52 26 13 32 37 44 47 38 33 51 43 40 31 9 57 20 62 16 34 54 3 29 24 64 53 18 25 17 30 39 19 11 46 63 48 55 60 2 23 10 41 45 7 21 1" }, { "input": "49\n38 20 49 32 14 41 39 45 25 48 40 19 26 43 34 12 10 3 35 42 5 7 46 47 4 2 13 22 16 24 33 15 11 18 29 31 23 9 44 36 6 17 37 1 30 28 8 21 27", "output": "44 26 18 25 21 41 22 47 38 17 33 16 27 5 32 29 42 34 12 2 48 28 37 30 9 13 49 46 35 45 36 4 31 15 19 40 43 1 7 11 6 20 14 39 8 23 24 10 3" }, { "input": "78\n17 50 30 48 33 12 42 4 18 53 76 67 38 3 20 72 51 55 60 63 46 10 57 45 54 32 24 62 8 11 35 44 65 74 58 28 2 6 56 52 39 23 47 49 61 1 66 41 15 77 7 27 78 13 14 34 5 31 37 21 40 16 29 69 59 43 64 36 70 19 25 73 71 75 9 68 26 22", "output": "46 37 14 8 57 38 51 29 75 22 30 6 54 55 49 62 1 9 70 15 60 78 42 27 71 77 52 36 63 3 58 26 5 56 31 68 59 13 41 61 48 7 66 32 24 21 43 4 44 2 17 40 10 25 18 39 23 35 65 19 45 28 20 67 33 47 12 76 64 69 73 16 72 34 74 11 50 53" }, { "input": "29\n14 21 27 1 4 18 10 17 20 23 2 24 7 9 28 22 8 25 12 15 11 6 16 29 3 26 19 5 13", "output": "4 11 25 5 28 22 13 17 14 7 21 19 29 1 20 23 8 6 27 9 2 16 10 12 18 26 3 15 24" }, { "input": "82\n6 1 10 75 28 66 61 81 78 63 17 19 58 34 49 12 67 50 41 44 3 15 59 38 51 72 36 11 46 29 18 64 27 23 13 53 56 68 2 25 47 40 69 54 42 5 60 55 4 16 24 79 57 20 7 73 32 80 76 52 82 37 26 31 65 8 39 62 33 71 30 9 77 43 48 74 70 22 14 45 35 21", "output": "2 39 21 49 46 1 55 66 72 3 28 16 35 79 22 50 11 31 12 54 82 78 34 51 40 63 33 5 30 71 64 57 69 14 81 27 62 24 67 42 19 45 74 20 80 29 41 75 15 18 25 60 36 44 48 37 53 13 23 47 7 68 10 32 65 6 17 38 43 77 70 26 56 76 4 59 73 9 52 58 8 61" }, { "input": "82\n74 18 15 69 71 77 19 26 80 20 66 7 30 82 22 48 21 44 52 65 64 61 35 49 12 8 53 81 54 16 11 9 40 46 13 1 29 58 5 41 55 4 78 60 6 51 56 2 38 36 34 62 63 25 17 67 45 14 32 37 75 79 10 47 27 39 31 68 59 24 50 43 72 70 42 28 76 23 57 3 73 33", "output": "36 48 80 42 39 45 12 26 32 63 31 25 35 58 3 30 55 2 7 10 17 15 78 70 54 8 65 76 37 13 67 59 82 51 23 50 60 49 66 33 40 75 72 18 57 34 64 16 24 71 46 19 27 29 41 47 79 38 69 44 22 52 53 21 20 11 56 68 4 74 5 73 81 1 61 77 6 43 62 9 28 14" }, { "input": "45\n2 32 34 13 3 15 16 33 22 12 31 38 42 14 27 7 36 8 4 19 45 41 5 35 10 11 39 20 29 44 17 9 6 40 37 28 25 21 1 30 24 18 43 26 23", "output": "39 1 5 19 23 33 16 18 32 25 26 10 4 14 6 7 31 42 20 28 38 9 45 41 37 44 15 36 29 40 11 2 8 3 24 17 35 12 27 34 22 13 43 30 21" }, { "input": "45\n4 32 33 39 43 21 22 35 45 7 14 5 16 9 42 31 24 36 17 29 41 25 37 34 27 20 11 44 3 13 19 2 1 10 26 30 38 18 6 8 15 23 40 28 12", "output": "33 32 29 1 12 39 10 40 14 34 27 45 30 11 41 13 19 38 31 26 6 7 42 17 22 35 25 44 20 36 16 2 3 24 8 18 23 37 4 43 21 15 5 28 9" }, { "input": "74\n48 72 40 67 17 4 27 53 11 32 25 9 74 2 41 24 56 22 14 21 33 5 18 55 20 7 29 36 69 13 52 19 38 30 68 59 66 34 63 6 47 45 54 44 62 12 50 71 16 10 8 64 57 73 46 26 49 42 3 23 35 1 61 39 70 60 65 43 15 28 37 51 58 31", "output": "62 14 59 6 22 40 26 51 12 50 9 46 30 19 69 49 5 23 32 25 20 18 60 16 11 56 7 70 27 34 74 10 21 38 61 28 71 33 64 3 15 58 68 44 42 55 41 1 57 47 72 31 8 43 24 17 53 73 36 66 63 45 39 52 67 37 4 35 29 65 48 2 54 13" }, { "input": "47\n9 26 27 10 6 34 28 42 39 22 45 21 11 43 14 47 38 15 40 32 46 1 36 29 17 25 2 23 31 5 24 4 7 8 12 19 16 44 37 20 18 33 30 13 35 41 3", "output": "22 27 47 32 30 5 33 34 1 4 13 35 44 15 18 37 25 41 36 40 12 10 28 31 26 2 3 7 24 43 29 20 42 6 45 23 39 17 9 19 46 8 14 38 11 21 16" }, { "input": "49\n14 38 6 29 9 49 36 43 47 3 44 20 34 15 7 11 1 28 12 40 16 37 31 10 42 41 33 21 18 30 5 27 17 35 25 26 45 19 2 13 23 32 4 22 46 48 24 39 8", "output": "17 39 10 43 31 3 15 49 5 24 16 19 40 1 14 21 33 29 38 12 28 44 41 47 35 36 32 18 4 30 23 42 27 13 34 7 22 2 48 20 26 25 8 11 37 45 9 46 6" }, { "input": "100\n78 56 31 91 90 95 16 65 58 77 37 89 33 61 10 76 62 47 35 67 69 7 63 83 22 25 49 8 12 30 39 44 57 64 48 42 32 11 70 43 55 50 99 24 85 73 45 14 54 21 98 84 74 2 26 18 9 36 80 53 75 46 66 86 59 93 87 68 94 13 72 28 79 88 92 29 52 82 34 97 19 38 1 41 27 4 40 5 96 100 51 6 20 23 81 15 17 3 60 71", "output": "83 54 98 86 88 92 22 28 57 15 38 29 70 48 96 7 97 56 81 93 50 25 94 44 26 55 85 72 76 30 3 37 13 79 19 58 11 82 31 87 84 36 40 32 47 62 18 35 27 42 91 77 60 49 41 2 33 9 65 99 14 17 23 34 8 63 20 68 21 39 100 71 46 53 61 16 10 1 73 59 95 78 24 52 45 64 67 74 12 5 4 75 66 69 6 89 80 51 43 90" }, { "input": "22\n12 8 11 2 16 7 13 6 22 21 20 10 4 14 18 1 5 15 3 19 17 9", "output": "16 4 19 13 17 8 6 2 22 12 3 1 7 14 18 5 21 15 20 11 10 9" }, { "input": "72\n16 11 49 51 3 27 60 55 23 40 66 7 53 70 13 5 15 32 18 72 33 30 8 31 46 12 28 67 25 38 50 22 69 34 71 52 58 39 24 35 42 9 41 26 62 1 63 65 36 64 68 61 37 14 45 47 6 57 54 20 17 2 56 59 29 10 4 48 21 43 19 44", "output": "46 62 5 67 16 57 12 23 42 66 2 26 15 54 17 1 61 19 71 60 69 32 9 39 29 44 6 27 65 22 24 18 21 34 40 49 53 30 38 10 43 41 70 72 55 25 56 68 3 31 4 36 13 59 8 63 58 37 64 7 52 45 47 50 48 11 28 51 33 14 35 20" }, { "input": "63\n21 56 11 10 62 24 20 42 28 52 38 2 37 43 48 22 7 8 40 14 13 46 53 1 23 4 60 63 51 36 25 12 39 32 49 16 58 44 31 61 33 50 55 54 45 6 47 41 9 57 30 29 26 18 19 27 15 34 3 35 59 5 17", "output": "24 12 59 26 62 46 17 18 49 4 3 32 21 20 57 36 63 54 55 7 1 16 25 6 31 53 56 9 52 51 39 34 41 58 60 30 13 11 33 19 48 8 14 38 45 22 47 15 35 42 29 10 23 44 43 2 50 37 61 27 40 5 28" }, { "input": "18\n2 16 8 4 18 12 3 6 5 9 10 15 11 17 14 13 1 7", "output": "17 1 7 4 9 8 18 3 10 11 13 6 16 15 12 2 14 5" }, { "input": "47\n6 9 10 41 25 3 4 37 20 1 36 22 29 27 11 24 43 31 12 17 34 42 38 39 13 2 7 21 18 5 15 35 44 26 33 46 19 40 30 14 28 23 47 32 45 8 16", "output": "10 26 6 7 30 1 27 46 2 3 15 19 25 40 31 47 20 29 37 9 28 12 42 16 5 34 14 41 13 39 18 44 35 21 32 11 8 23 24 38 4 22 17 33 45 36 43" }, { "input": "96\n41 91 48 88 29 57 1 19 44 43 37 5 10 75 25 63 30 78 76 53 8 92 18 70 39 17 49 60 9 16 3 34 86 59 23 79 55 45 72 51 28 33 96 40 26 54 6 32 89 61 85 74 7 82 52 31 64 66 94 95 11 22 2 73 35 13 42 71 14 47 84 69 50 67 58 12 77 46 38 68 15 36 20 93 27 90 83 56 87 4 21 24 81 62 80 65", "output": "7 63 31 90 12 47 53 21 29 13 61 76 66 69 81 30 26 23 8 83 91 62 35 92 15 45 85 41 5 17 56 48 42 32 65 82 11 79 25 44 1 67 10 9 38 78 70 3 27 73 40 55 20 46 37 88 6 75 34 28 50 94 16 57 96 58 74 80 72 24 68 39 64 52 14 19 77 18 36 95 93 54 87 71 51 33 89 4 49 86 2 22 84 59 60 43" }, { "input": "73\n67 24 39 22 23 20 48 34 42 40 19 70 65 69 64 21 53 11 59 15 26 10 30 33 72 29 55 25 56 71 8 9 57 49 41 61 13 12 6 27 66 36 47 50 73 60 2 37 7 4 51 17 1 46 14 62 35 3 45 63 43 58 54 32 31 5 28 44 18 52 68 38 16", "output": "53 47 58 50 66 39 49 31 32 22 18 38 37 55 20 73 52 69 11 6 16 4 5 2 28 21 40 67 26 23 65 64 24 8 57 42 48 72 3 10 35 9 61 68 59 54 43 7 34 44 51 70 17 63 27 29 33 62 19 46 36 56 60 15 13 41 1 71 14 12 30 25 45" }, { "input": "81\n25 2 78 40 12 80 69 13 49 43 17 33 23 54 32 61 77 66 27 71 24 26 42 55 60 9 5 30 7 37 45 63 53 11 38 44 68 34 28 52 67 22 57 46 47 50 8 16 79 62 4 36 20 14 73 64 6 76 35 74 58 10 29 81 59 31 19 1 75 39 70 18 41 21 72 65 3 48 15 56 51", "output": "68 2 77 51 27 57 29 47 26 62 34 5 8 54 79 48 11 72 67 53 74 42 13 21 1 22 19 39 63 28 66 15 12 38 59 52 30 35 70 4 73 23 10 36 31 44 45 78 9 46 81 40 33 14 24 80 43 61 65 25 16 50 32 56 76 18 41 37 7 71 20 75 55 60 69 58 17 3 49 6 64" }, { "input": "12\n12 3 1 5 11 6 7 10 2 8 9 4", "output": "3 9 2 12 4 6 7 10 11 8 5 1" }, { "input": "47\n7 21 41 18 40 31 12 28 24 14 43 23 33 10 19 38 26 8 34 15 29 44 5 13 39 25 3 27 20 42 35 9 2 1 30 46 36 32 4 22 37 45 6 47 11 16 17", "output": "34 33 27 39 23 43 1 18 32 14 45 7 24 10 20 46 47 4 15 29 2 40 12 9 26 17 28 8 21 35 6 38 13 19 31 37 41 16 25 5 3 30 11 22 42 36 44" }, { "input": "8\n1 3 5 2 4 8 6 7", "output": "1 4 2 5 3 7 8 6" }, { "input": "38\n28 8 2 33 20 32 26 29 23 31 15 38 11 37 18 21 22 19 4 34 1 35 16 7 17 6 27 30 36 12 9 24 25 13 5 3 10 14", "output": "21 3 36 19 35 26 24 2 31 37 13 30 34 38 11 23 25 15 18 5 16 17 9 32 33 7 27 1 8 28 10 6 4 20 22 29 14 12" }, { "input": "10\n2 9 4 6 10 1 7 5 3 8", "output": "6 1 9 3 8 4 7 10 2 5" }, { "input": "23\n20 11 15 1 5 12 23 9 2 22 13 19 16 14 7 4 8 21 6 17 18 10 3", "output": "4 9 23 16 5 19 15 17 8 22 2 6 11 14 3 13 20 21 12 1 18 10 7" }, { "input": "10\n2 4 9 3 6 8 10 5 1 7", "output": "9 1 4 2 8 5 10 6 3 7" }, { "input": "55\n9 48 23 49 11 24 4 22 34 32 17 45 39 13 14 21 19 25 2 31 37 7 55 36 20 51 5 12 54 10 35 40 43 1 46 18 53 41 38 26 29 50 3 42 52 27 8 28 47 33 6 16 30 44 15", "output": "34 19 43 7 27 51 22 47 1 30 5 28 14 15 55 52 11 36 17 25 16 8 3 6 18 40 46 48 41 53 20 10 50 9 31 24 21 39 13 32 38 44 33 54 12 35 49 2 4 42 26 45 37 29 23" }, { "input": "58\n49 13 12 54 2 38 56 11 33 25 26 19 28 8 23 41 20 36 46 55 15 35 9 7 32 37 58 6 3 14 47 31 40 30 53 44 4 50 29 34 10 43 39 57 5 22 27 45 51 42 24 16 18 21 52 17 48 1", "output": "58 5 29 37 45 28 24 14 23 41 8 3 2 30 21 52 56 53 12 17 54 46 15 51 10 11 47 13 39 34 32 25 9 40 22 18 26 6 43 33 16 50 42 36 48 19 31 57 1 38 49 55 35 4 20 7 44 27" }, { "input": "34\n20 25 2 3 33 29 1 16 14 7 21 9 32 31 6 26 22 4 27 23 24 10 34 12 19 15 5 18 28 17 13 8 11 30", "output": "7 3 4 18 27 15 10 32 12 22 33 24 31 9 26 8 30 28 25 1 11 17 20 21 2 16 19 29 6 34 14 13 5 23" }, { "input": "53\n47 29 46 25 23 13 7 31 33 4 38 11 35 16 42 14 15 43 34 39 28 18 6 45 30 1 40 20 2 37 5 32 24 12 44 26 27 3 19 51 36 21 22 9 10 50 41 48 49 53 8 17 52", "output": "26 29 38 10 31 23 7 51 44 45 12 34 6 16 17 14 52 22 39 28 42 43 5 33 4 36 37 21 2 25 8 32 9 19 13 41 30 11 20 27 47 15 18 35 24 3 1 48 49 46 40 53 50" }, { "input": "99\n77 87 90 48 53 38 68 6 28 57 35 82 63 71 60 41 3 12 86 65 10 59 22 67 33 74 93 27 24 1 61 43 25 4 51 52 15 88 9 31 30 42 89 49 23 21 29 32 46 73 37 16 5 69 56 26 92 64 20 54 75 14 98 13 94 2 95 7 36 66 58 8 50 78 84 45 11 96 76 62 97 80 40 39 47 85 34 79 83 17 91 72 19 44 70 81 55 99 18", "output": "30 66 17 34 53 8 68 72 39 21 77 18 64 62 37 52 90 99 93 59 46 23 45 29 33 56 28 9 47 41 40 48 25 87 11 69 51 6 84 83 16 42 32 94 76 49 85 4 44 73 35 36 5 60 97 55 10 71 22 15 31 80 13 58 20 70 24 7 54 95 14 92 50 26 61 79 1 74 88 82 96 12 89 75 86 19 2 38 43 3 91 57 27 65 67 78 81 63 98" }, { "input": "32\n17 29 2 6 30 8 26 7 1 27 10 9 13 24 31 21 15 19 22 18 4 11 25 28 32 3 23 12 5 14 20 16", "output": "9 3 26 21 29 4 8 6 12 11 22 28 13 30 17 32 1 20 18 31 16 19 27 14 23 7 10 24 2 5 15 25" }, { "input": "65\n18 40 1 60 17 19 4 6 12 49 28 58 2 25 13 14 64 56 61 34 62 30 59 51 26 8 33 63 36 48 46 7 43 21 31 27 11 44 29 5 32 23 35 9 53 57 52 50 15 38 42 3 54 65 55 41 20 24 22 47 45 10 39 16 37", "output": "3 13 52 7 40 8 32 26 44 62 37 9 15 16 49 64 5 1 6 57 34 59 42 58 14 25 36 11 39 22 35 41 27 20 43 29 65 50 63 2 56 51 33 38 61 31 60 30 10 48 24 47 45 53 55 18 46 12 23 4 19 21 28 17 54" }, { "input": "71\n35 50 55 58 25 32 26 40 63 34 44 53 24 18 37 7 64 27 56 65 1 19 2 43 42 14 57 47 22 13 59 61 39 67 30 45 54 38 33 48 6 5 3 69 36 21 41 4 16 46 20 17 15 12 10 70 68 23 60 31 52 29 66 28 51 49 62 11 8 9 71", "output": "21 23 43 48 42 41 16 69 70 55 68 54 30 26 53 49 52 14 22 51 46 29 58 13 5 7 18 64 62 35 60 6 39 10 1 45 15 38 33 8 47 25 24 11 36 50 28 40 66 2 65 61 12 37 3 19 27 4 31 59 32 67 9 17 20 63 34 57 44 56 71" }, { "input": "74\n33 8 42 63 64 61 31 74 11 50 68 14 36 25 57 30 7 44 21 15 6 9 23 59 46 3 73 16 62 51 40 60 41 54 5 39 35 28 48 4 58 12 66 69 13 26 71 1 24 19 29 52 37 2 20 43 18 72 17 56 34 38 65 67 27 10 47 70 53 32 45 55 49 22", "output": "48 54 26 40 35 21 17 2 22 66 9 42 45 12 20 28 59 57 50 55 19 74 23 49 14 46 65 38 51 16 7 70 1 61 37 13 53 62 36 31 33 3 56 18 71 25 67 39 73 10 30 52 69 34 72 60 15 41 24 32 6 29 4 5 63 43 64 11 44 68 47 58 27 8" }, { "input": "96\n78 10 82 46 38 91 77 69 2 27 58 80 79 44 59 41 6 31 76 11 42 48 51 37 19 87 43 25 52 32 1 39 63 29 21 65 53 74 92 16 15 95 90 83 30 73 71 5 50 17 96 33 86 60 67 64 20 26 61 40 55 88 94 93 9 72 47 57 14 45 22 3 54 68 13 24 4 7 56 81 89 70 49 8 84 28 18 62 35 36 75 23 66 85 34 12", "output": "31 9 72 77 48 17 78 84 65 2 20 96 75 69 41 40 50 87 25 57 35 71 92 76 28 58 10 86 34 45 18 30 52 95 89 90 24 5 32 60 16 21 27 14 70 4 67 22 83 49 23 29 37 73 61 79 68 11 15 54 59 88 33 56 36 93 55 74 8 82 47 66 46 38 91 19 7 1 13 12 80 3 44 85 94 53 26 62 81 43 6 39 64 63 42 51" }, { "input": "7\n2 1 5 7 3 4 6", "output": "2 1 5 6 3 7 4" }, { "input": "51\n8 33 37 2 16 22 24 30 4 9 5 15 27 3 18 39 31 26 10 17 46 41 25 14 6 1 29 48 36 20 51 49 21 43 19 13 38 50 47 34 11 23 28 12 42 7 32 40 44 45 35", "output": "26 4 14 9 11 25 46 1 10 19 41 44 36 24 12 5 20 15 35 30 33 6 42 7 23 18 13 43 27 8 17 47 2 40 51 29 3 37 16 48 22 45 34 49 50 21 39 28 32 38 31" }, { "input": "27\n12 14 7 3 20 21 25 13 22 15 23 4 2 24 10 17 19 8 26 11 27 18 9 5 6 1 16", "output": "26 13 4 12 24 25 3 18 23 15 20 1 8 2 10 27 16 22 17 5 6 9 11 14 7 19 21" }, { "input": "71\n51 13 20 48 54 23 24 64 14 62 71 67 57 53 3 30 55 43 33 25 39 40 66 6 46 18 5 19 61 16 32 68 70 41 60 44 29 49 27 69 50 38 10 17 45 56 9 21 26 63 28 35 7 59 1 65 2 15 8 11 12 34 37 47 58 22 31 4 36 42 52", "output": "55 57 15 68 27 24 53 59 47 43 60 61 2 9 58 30 44 26 28 3 48 66 6 7 20 49 39 51 37 16 67 31 19 62 52 69 63 42 21 22 34 70 18 36 45 25 64 4 38 41 1 71 14 5 17 46 13 65 54 35 29 10 50 8 56 23 12 32 40 33 11" }, { "input": "9\n8 5 2 6 1 9 4 7 3", "output": "5 3 9 7 2 4 8 1 6" }, { "input": "29\n10 24 11 5 26 25 2 9 22 15 8 14 29 21 4 1 23 17 3 12 13 16 18 28 19 20 7 6 27", "output": "16 7 19 15 4 28 27 11 8 1 3 20 21 12 10 22 18 23 25 26 14 9 17 2 6 5 29 24 13" }, { "input": "60\n39 25 42 4 55 60 16 18 47 1 11 40 7 50 19 35 49 54 12 3 30 38 2 58 17 26 45 6 33 43 37 32 52 36 15 23 27 59 24 20 28 14 8 9 13 29 44 46 41 21 5 48 51 22 31 56 57 53 10 34", "output": "10 23 20 4 51 28 13 43 44 59 11 19 45 42 35 7 25 8 15 40 50 54 36 39 2 26 37 41 46 21 55 32 29 60 16 34 31 22 1 12 49 3 30 47 27 48 9 52 17 14 53 33 58 18 5 56 57 24 38 6" }, { "input": "50\n37 45 22 5 12 21 28 24 18 47 20 25 8 50 14 2 34 43 11 16 49 41 48 1 19 31 39 46 32 23 15 42 3 35 38 30 44 26 10 9 40 36 7 17 33 4 27 6 13 29", "output": "24 16 33 46 4 48 43 13 40 39 19 5 49 15 31 20 44 9 25 11 6 3 30 8 12 38 47 7 50 36 26 29 45 17 34 42 1 35 27 41 22 32 18 37 2 28 10 23 21 14" }, { "input": "30\n8 29 28 16 17 25 27 15 21 11 6 20 2 13 1 30 5 4 24 10 14 3 23 18 26 9 12 22 19 7", "output": "15 13 22 18 17 11 30 1 26 20 10 27 14 21 8 4 5 24 29 12 9 28 23 19 6 25 7 3 2 16" }, { "input": "46\n15 2 44 43 38 19 31 42 4 37 29 30 24 45 27 41 8 20 33 7 35 3 18 46 36 26 1 28 21 40 16 22 32 11 14 13 12 9 25 39 10 6 23 17 5 34", "output": "27 2 22 9 45 42 20 17 38 41 34 37 36 35 1 31 44 23 6 18 29 32 43 13 39 26 15 28 11 12 7 33 19 46 21 25 10 5 40 30 16 8 4 3 14 24" }, { "input": "9\n4 8 6 5 3 9 2 7 1", "output": "9 7 5 1 4 3 8 2 6" }, { "input": "46\n31 30 33 23 45 7 36 8 11 3 32 39 41 20 1 28 6 27 18 24 17 5 16 37 26 13 22 14 2 38 15 46 9 4 19 21 12 44 10 35 25 34 42 43 40 29", "output": "15 29 10 34 22 17 6 8 33 39 9 37 26 28 31 23 21 19 35 14 36 27 4 20 41 25 18 16 46 2 1 11 3 42 40 7 24 30 12 45 13 43 44 38 5 32" }, { "input": "66\n27 12 37 48 46 21 34 58 38 28 66 2 64 32 44 31 13 36 40 15 19 11 22 5 30 29 6 7 61 39 20 42 23 54 51 33 50 9 60 8 57 45 49 10 62 41 59 3 55 63 52 24 25 26 43 56 65 4 16 14 1 35 18 17 53 47", "output": "61 12 48 58 24 27 28 40 38 44 22 2 17 60 20 59 64 63 21 31 6 23 33 52 53 54 1 10 26 25 16 14 36 7 62 18 3 9 30 19 46 32 55 15 42 5 66 4 43 37 35 51 65 34 49 56 41 8 47 39 29 45 50 13 57 11" }, { "input": "13\n3 12 9 2 8 5 13 4 11 1 10 7 6", "output": "10 4 1 8 6 13 12 5 3 11 9 2 7" }, { "input": "80\n21 25 56 50 20 61 7 74 51 69 8 2 46 57 45 71 14 52 17 43 9 30 70 78 31 10 38 13 23 15 37 79 6 16 77 73 80 4 49 48 18 28 26 58 33 41 64 22 54 72 59 60 40 63 53 27 1 5 75 67 62 34 19 39 68 65 44 55 3 32 11 42 76 12 35 47 66 36 24 29", "output": "57 12 69 38 58 33 7 11 21 26 71 74 28 17 30 34 19 41 63 5 1 48 29 79 2 43 56 42 80 22 25 70 45 62 75 78 31 27 64 53 46 72 20 67 15 13 76 40 39 4 9 18 55 49 68 3 14 44 51 52 6 61 54 47 66 77 60 65 10 23 16 50 36 8 59 73 35 24 32 37" }, { "input": "63\n9 49 53 25 40 46 43 51 54 22 58 16 23 26 10 47 5 27 2 8 61 59 19 35 63 56 28 20 34 4 62 38 6 55 36 31 57 15 29 33 1 48 50 37 7 30 18 42 32 52 12 41 14 21 45 11 24 17 39 13 44 60 3", "output": "41 19 63 30 17 33 45 20 1 15 56 51 60 53 38 12 58 47 23 28 54 10 13 57 4 14 18 27 39 46 36 49 40 29 24 35 44 32 59 5 52 48 7 61 55 6 16 42 2 43 8 50 3 9 34 26 37 11 22 62 21 31 25" }, { "input": "26\n11 4 19 13 17 9 2 24 6 5 22 23 14 15 3 25 16 8 18 10 21 1 12 26 7 20", "output": "22 7 15 2 10 9 25 18 6 20 1 23 4 13 14 17 5 19 3 26 21 11 12 8 16 24" }, { "input": "69\n40 22 11 66 4 27 31 29 64 53 37 55 51 2 7 36 18 52 6 1 30 21 17 20 14 9 59 62 49 68 3 50 65 57 44 5 67 46 33 13 34 15 24 48 63 58 38 25 41 35 16 54 32 10 60 61 39 12 69 8 23 45 26 47 56 43 28 19 42", "output": "20 14 31 5 36 19 15 60 26 54 3 58 40 25 42 51 23 17 68 24 22 2 61 43 48 63 6 67 8 21 7 53 39 41 50 16 11 47 57 1 49 69 66 35 62 38 64 44 29 32 13 18 10 52 12 65 34 46 27 55 56 28 45 9 33 4 37 30 59" }, { "input": "6\n4 3 6 5 1 2", "output": "5 6 2 1 4 3" }, { "input": "9\n7 8 5 3 1 4 2 9 6", "output": "5 7 4 6 3 9 1 2 8" }, { "input": "41\n27 24 16 30 25 8 32 2 26 20 39 33 41 22 40 14 36 9 28 4 34 11 31 23 19 18 17 35 3 10 6 13 5 15 29 38 7 21 1 12 37", "output": "39 8 29 20 33 31 37 6 18 30 22 40 32 16 34 3 27 26 25 10 38 14 24 2 5 9 1 19 35 4 23 7 12 21 28 17 41 36 11 15 13" }, { "input": "1\n1", "output": "1" }, { "input": "20\n2 6 4 18 7 10 17 13 16 8 14 9 20 5 19 12 1 3 15 11", "output": "17 1 18 3 14 2 5 10 12 6 20 16 8 11 19 9 7 4 15 13" }, { "input": "2\n2 1", "output": "2 1" }, { "input": "60\n2 4 31 51 11 7 34 20 3 14 18 23 48 54 15 36 38 60 49 40 5 33 41 26 55 58 10 8 13 9 27 30 37 1 21 59 44 57 35 19 46 43 42 45 12 22 39 32 24 16 6 56 53 52 25 17 47 29 50 28", "output": "34 1 9 2 21 51 6 28 30 27 5 45 29 10 15 50 56 11 40 8 35 46 12 49 55 24 31 60 58 32 3 48 22 7 39 16 33 17 47 20 23 43 42 37 44 41 57 13 19 59 4 54 53 14 25 52 38 26 36 18" }, { "input": "14\n14 6 3 12 11 2 7 1 10 9 8 5 4 13", "output": "8 6 3 13 12 2 7 11 10 9 5 4 14 1" }, { "input": "81\n13 43 79 8 7 21 73 46 63 4 62 78 56 11 70 68 61 53 60 49 16 27 59 47 69 5 22 44 77 57 52 48 1 9 72 81 28 55 58 33 51 18 31 17 41 20 42 3 32 54 19 2 75 34 64 10 65 50 30 29 67 12 71 66 74 15 26 23 6 38 25 35 37 24 80 76 40 45 39 36 14", "output": "33 52 48 10 26 69 5 4 34 56 14 62 1 81 66 21 44 42 51 46 6 27 68 74 71 67 22 37 60 59 43 49 40 54 72 80 73 70 79 77 45 47 2 28 78 8 24 32 20 58 41 31 18 50 38 13 30 39 23 19 17 11 9 55 57 64 61 16 25 15 63 35 7 65 53 76 29 12 3 75 36" }, { "input": "42\n41 11 10 8 21 37 32 19 31 25 1 15 36 5 6 27 4 3 13 7 16 17 2 23 34 24 38 28 12 20 30 42 18 26 39 35 33 40 9 14 22 29", "output": "11 23 18 17 14 15 20 4 39 3 2 29 19 40 12 21 22 33 8 30 5 41 24 26 10 34 16 28 42 31 9 7 37 25 36 13 6 27 35 38 1 32" }, { "input": "97\n20 6 76 42 4 18 35 59 39 63 27 7 66 47 61 52 15 36 88 93 19 33 10 92 1 34 46 86 78 57 51 94 77 29 26 73 41 2 58 97 43 65 17 74 21 49 25 3 91 82 95 12 96 13 84 90 69 24 72 37 16 55 54 71 64 62 48 89 11 70 80 67 30 40 44 85 53 83 79 9 56 45 75 87 22 14 81 68 8 38 60 50 28 23 31 32 5", "output": "25 38 48 5 97 2 12 89 80 23 69 52 54 86 17 61 43 6 21 1 45 85 94 58 47 35 11 93 34 73 95 96 22 26 7 18 60 90 9 74 37 4 41 75 82 27 14 67 46 92 31 16 77 63 62 81 30 39 8 91 15 66 10 65 42 13 72 88 57 70 64 59 36 44 83 3 33 29 79 71 87 50 78 55 76 28 84 19 68 56 49 24 20 32 51 53 40" }, { "input": "62\n15 27 46 6 8 51 14 56 23 48 42 49 52 22 20 31 29 12 47 3 62 34 37 35 32 57 19 25 5 60 61 38 18 10 11 55 45 53 17 30 9 36 4 50 41 16 44 28 40 59 24 1 13 39 26 7 33 58 2 43 21 54", "output": "52 59 20 43 29 4 56 5 41 34 35 18 53 7 1 46 39 33 27 15 61 14 9 51 28 55 2 48 17 40 16 25 57 22 24 42 23 32 54 49 45 11 60 47 37 3 19 10 12 44 6 13 38 62 36 8 26 58 50 30 31 21" }, { "input": "61\n35 27 4 61 52 32 41 46 14 37 17 54 55 31 11 26 44 49 15 30 9 50 45 39 7 38 53 3 58 40 13 56 18 19 28 6 43 5 21 42 20 34 2 25 36 12 33 57 16 60 1 8 59 10 22 23 24 48 51 47 29", "output": "51 43 28 3 38 36 25 52 21 54 15 46 31 9 19 49 11 33 34 41 39 55 56 57 44 16 2 35 61 20 14 6 47 42 1 45 10 26 24 30 7 40 37 17 23 8 60 58 18 22 59 5 27 12 13 32 48 29 53 50 4" }, { "input": "59\n31 26 36 15 17 19 10 53 11 34 13 46 55 9 44 7 8 37 32 52 47 25 51 22 35 39 41 4 43 24 5 27 20 57 6 38 3 28 21 40 50 18 14 56 33 45 12 2 49 59 54 29 16 48 42 58 1 30 23", "output": "57 48 37 28 31 35 16 17 14 7 9 47 11 43 4 53 5 42 6 33 39 24 59 30 22 2 32 38 52 58 1 19 45 10 25 3 18 36 26 40 27 55 29 15 46 12 21 54 49 41 23 20 8 51 13 44 34 56 50" }, { "input": "10\n2 10 7 4 1 5 8 6 3 9", "output": "5 1 9 4 6 8 3 7 10 2" }, { "input": "14\n14 2 1 8 6 12 11 10 9 7 3 4 5 13", "output": "3 2 11 12 13 5 10 4 9 8 7 6 14 1" }, { "input": "43\n28 38 15 14 31 42 27 30 19 33 43 26 22 29 18 32 3 13 1 8 35 34 4 12 11 17 41 21 5 25 39 37 20 23 7 24 16 10 40 9 6 36 2", "output": "19 43 17 23 29 41 35 20 40 38 25 24 18 4 3 37 26 15 9 33 28 13 34 36 30 12 7 1 14 8 5 16 10 22 21 42 32 2 31 39 27 6 11" }, { "input": "86\n39 11 20 31 28 76 29 64 35 21 41 71 12 82 5 37 80 73 38 26 79 75 23 15 59 45 47 6 3 62 50 49 51 22 2 65 86 60 70 42 74 17 1 30 55 44 8 66 81 27 57 77 43 13 54 32 72 46 48 56 14 34 78 52 36 85 24 19 69 83 25 61 7 4 84 33 63 58 18 40 68 10 67 9 16 53", "output": "43 35 29 74 15 28 73 47 84 82 2 13 54 61 24 85 42 79 68 3 10 34 23 67 71 20 50 5 7 44 4 56 76 62 9 65 16 19 1 80 11 40 53 46 26 58 27 59 32 31 33 64 86 55 45 60 51 78 25 38 72 30 77 8 36 48 83 81 69 39 12 57 18 41 22 6 52 63 21 17 49 14 70 75 66 37" }, { "input": "99\n65 78 56 98 33 24 61 40 29 93 1 64 57 22 25 52 67 95 50 3 31 15 90 68 71 83 38 36 6 46 89 26 4 87 14 88 72 37 23 43 63 12 80 96 5 34 73 86 9 48 92 62 99 10 16 20 66 27 28 2 82 70 30 94 49 8 84 69 18 60 58 59 44 39 21 7 91 76 54 19 75 85 74 47 55 32 97 77 51 13 35 79 45 42 11 41 17 81 53", "output": "11 60 20 33 45 29 76 66 49 54 95 42 90 35 22 55 97 69 80 56 75 14 39 6 15 32 58 59 9 63 21 86 5 46 91 28 38 27 74 8 96 94 40 73 93 30 84 50 65 19 89 16 99 79 85 3 13 71 72 70 7 52 41 12 1 57 17 24 68 62 25 37 47 83 81 78 88 2 92 43 98 61 26 67 82 48 34 36 31 23 77 51 10 64 18 44 87 4 53" }, { "input": "100\n42 23 48 88 36 6 18 70 96 1 34 40 46 22 39 55 85 93 45 67 71 75 59 9 21 3 86 63 65 68 20 38 73 31 84 90 50 51 56 95 72 33 49 19 83 76 54 74 100 30 17 98 15 94 4 97 5 99 81 27 92 32 89 12 13 91 87 29 60 11 52 43 35 58 10 25 16 80 28 2 44 61 8 82 66 69 41 24 57 62 78 37 79 77 53 7 14 47 26 64", "output": "10 80 26 55 57 6 96 83 24 75 70 64 65 97 53 77 51 7 44 31 25 14 2 88 76 99 60 79 68 50 34 62 42 11 73 5 92 32 15 12 87 1 72 81 19 13 98 3 43 37 38 71 95 47 16 39 89 74 23 69 82 90 28 100 29 85 20 30 86 8 21 41 33 48 22 46 94 91 93 78 59 84 45 35 17 27 67 4 63 36 66 61 18 54 40 9 56 52 58 49" }, { "input": "99\n8 68 94 75 71 60 57 58 6 11 5 48 65 41 49 12 46 72 95 59 13 70 74 7 84 62 17 36 55 76 38 79 2 85 23 10 32 99 87 50 83 28 54 91 53 51 1 3 97 81 21 89 93 78 61 26 82 96 4 98 25 40 31 44 24 47 30 52 14 16 39 27 9 29 45 18 67 63 37 43 90 66 19 69 88 22 92 77 34 42 73 80 56 64 20 35 15 33 86", "output": "47 33 48 59 11 9 24 1 73 36 10 16 21 69 97 70 27 76 83 95 51 86 35 65 61 56 72 42 74 67 63 37 98 89 96 28 79 31 71 62 14 90 80 64 75 17 66 12 15 40 46 68 45 43 29 93 7 8 20 6 55 26 78 94 13 82 77 2 84 22 5 18 91 23 4 30 88 54 32 92 50 57 41 25 34 99 39 85 52 81 44 87 53 3 19 58 49 60 38" }, { "input": "99\n12 99 88 13 7 19 74 47 23 90 16 29 26 11 58 60 64 98 37 18 82 67 72 46 51 85 17 92 87 20 77 36 78 71 57 35 80 54 73 15 14 62 97 45 31 79 94 56 76 96 28 63 8 44 38 86 49 2 52 66 61 59 10 43 55 50 22 34 83 53 95 40 81 21 30 42 27 3 5 41 1 70 69 25 93 48 65 6 24 89 91 33 39 68 9 4 32 84 75", "output": "81 58 78 96 79 88 5 53 95 63 14 1 4 41 40 11 27 20 6 30 74 67 9 89 84 13 77 51 12 75 45 97 92 68 36 32 19 55 93 72 80 76 64 54 44 24 8 86 57 66 25 59 70 38 65 48 35 15 62 16 61 42 52 17 87 60 22 94 83 82 34 23 39 7 99 49 31 33 46 37 73 21 69 98 26 56 29 3 90 10 91 28 85 47 71 50 43 18 2" }, { "input": "99\n20 79 26 75 99 69 98 47 93 62 18 42 43 38 90 66 67 8 13 84 76 58 81 60 64 46 56 23 78 17 86 36 19 52 85 39 48 27 96 49 37 95 5 31 10 24 12 1 80 35 92 33 16 68 57 54 32 29 45 88 72 77 4 87 97 89 59 3 21 22 61 94 83 15 44 34 70 91 55 9 51 50 73 11 14 6 40 7 63 25 2 82 41 65 28 74 71 30 53", "output": "48 91 68 63 43 86 88 18 80 45 84 47 19 85 74 53 30 11 33 1 69 70 28 46 90 3 38 95 58 98 44 57 52 76 50 32 41 14 36 87 93 12 13 75 59 26 8 37 40 82 81 34 99 56 79 27 55 22 67 24 71 10 89 25 94 16 17 54 6 77 97 61 83 96 4 21 62 29 2 49 23 92 73 20 35 31 64 60 66 15 78 51 9 72 42 39 65 7 5" }, { "input": "99\n74 20 9 1 60 85 65 13 4 25 40 99 5 53 64 3 36 31 73 44 55 50 45 63 98 51 68 6 47 37 71 82 88 34 84 18 19 12 93 58 86 7 11 46 90 17 33 27 81 69 42 59 56 32 95 52 76 61 96 62 78 43 66 21 49 97 75 14 41 72 89 16 30 79 22 23 15 83 91 38 48 2 87 26 28 80 94 70 54 92 57 10 8 35 67 77 29 24 39", "output": "4 82 16 9 13 28 42 93 3 92 43 38 8 68 77 72 46 36 37 2 64 75 76 98 10 84 48 85 97 73 18 54 47 34 94 17 30 80 99 11 69 51 62 20 23 44 29 81 65 22 26 56 14 89 21 53 91 40 52 5 58 60 24 15 7 63 95 27 50 88 31 70 19 1 67 57 96 61 74 86 49 32 78 35 6 41 83 33 71 45 79 90 39 87 55 59 66 25 12" }, { "input": "99\n50 94 2 18 69 90 59 83 75 68 77 97 39 78 25 7 16 9 49 4 42 89 44 48 17 96 61 70 3 10 5 81 56 57 88 6 98 1 46 67 92 37 11 30 85 41 8 36 51 29 20 71 19 79 74 93 43 34 55 40 38 21 64 63 32 24 72 14 12 86 82 15 65 23 66 22 28 53 13 26 95 99 91 52 76 27 60 45 47 33 73 84 31 35 54 80 58 62 87", "output": "38 3 29 20 31 36 16 47 18 30 43 69 79 68 72 17 25 4 53 51 62 76 74 66 15 80 86 77 50 44 93 65 90 58 94 48 42 61 13 60 46 21 57 23 88 39 89 24 19 1 49 84 78 95 59 33 34 97 7 87 27 98 64 63 73 75 40 10 5 28 52 67 91 55 9 85 11 14 54 96 32 71 8 92 45 70 99 35 22 6 83 41 56 2 81 26 12 37 82" }, { "input": "99\n19 93 14 34 39 37 33 15 52 88 7 43 69 27 9 77 94 31 48 22 63 70 79 17 50 6 81 8 76 58 23 74 86 11 57 62 41 87 75 51 12 18 68 56 95 3 80 83 84 29 24 61 71 78 59 96 20 85 90 28 45 36 38 97 1 49 40 98 44 67 13 73 72 91 47 10 30 54 35 42 4 2 92 26 64 60 53 21 5 82 46 32 55 66 16 89 99 65 25", "output": "65 82 46 81 89 26 11 28 15 76 34 41 71 3 8 95 24 42 1 57 88 20 31 51 99 84 14 60 50 77 18 92 7 4 79 62 6 63 5 67 37 80 12 69 61 91 75 19 66 25 40 9 87 78 93 44 35 30 55 86 52 36 21 85 98 94 70 43 13 22 53 73 72 32 39 29 16 54 23 47 27 90 48 49 58 33 38 10 96 59 74 83 2 17 45 56 64 68 97" }, { "input": "99\n86 25 50 51 62 39 41 67 44 20 45 14 80 88 66 7 36 59 13 84 78 58 96 75 2 43 48 47 69 12 19 98 22 38 28 55 11 76 68 46 53 70 85 34 16 33 91 30 8 40 74 60 94 82 87 32 37 4 5 10 89 73 90 29 35 26 23 57 27 65 24 3 9 83 77 72 6 31 15 92 93 79 64 18 63 42 56 1 52 97 17 81 71 21 49 99 54 95 61", "output": "88 25 72 58 59 77 16 49 73 60 37 30 19 12 79 45 91 84 31 10 94 33 67 71 2 66 69 35 64 48 78 56 46 44 65 17 57 34 6 50 7 86 26 9 11 40 28 27 95 3 4 89 41 97 36 87 68 22 18 52 99 5 85 83 70 15 8 39 29 42 93 76 62 51 24 38 75 21 82 13 92 54 74 20 43 1 55 14 61 63 47 80 81 53 98 23 90 32 96" }, { "input": "100\n66 44 99 15 43 79 28 33 88 90 49 68 82 38 9 74 4 58 29 81 31 94 10 42 89 21 63 40 62 61 18 6 84 72 48 25 67 69 71 85 98 34 83 70 65 78 91 77 93 41 23 24 87 11 55 12 59 73 36 97 7 14 26 39 30 27 45 20 50 17 53 2 57 47 95 56 75 19 37 96 16 35 8 3 76 60 13 86 5 32 64 80 46 51 54 100 1 22 52 92", "output": "97 72 84 17 89 32 61 83 15 23 54 56 87 62 4 81 70 31 78 68 26 98 51 52 36 63 66 7 19 65 21 90 8 42 82 59 79 14 64 28 50 24 5 2 67 93 74 35 11 69 94 99 71 95 55 76 73 18 57 86 30 29 27 91 45 1 37 12 38 44 39 34 58 16 77 85 48 46 6 92 20 13 43 33 40 88 53 9 25 10 47 100 49 22 75 80 60 41 3 96" }, { "input": "99\n3 73 32 37 25 15 93 63 85 8 91 78 80 5 39 48 46 7 83 70 23 96 9 29 77 53 30 20 56 50 13 45 21 76 87 99 65 31 16 18 14 72 51 28 43 2 81 34 38 40 66 54 74 26 71 4 61 17 58 24 22 33 49 36 42 11 12 55 60 27 62 90 79 92 94 68 1 52 84 41 86 35 69 75 47 10 64 88 97 98 67 19 89 95 59 82 57 44 6", "output": "77 46 1 56 14 99 18 10 23 86 66 67 31 41 6 39 58 40 92 28 33 61 21 60 5 54 70 44 24 27 38 3 62 48 82 64 4 49 15 50 80 65 45 98 32 17 85 16 63 30 43 78 26 52 68 29 97 59 95 69 57 71 8 87 37 51 91 76 83 20 55 42 2 53 84 34 25 12 73 13 47 96 19 79 9 81 35 88 93 72 11 74 7 75 94 22 89 90 36" }, { "input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1" } ]
1,685,879,005
2,147,483,647
Python 3
OK
TESTS
101
92
0
n = int(input()) givers = list(map(int, input().split())) result = [0] * n for i in range(n): friend = i + 1 giver = givers[i] result[giver - 1] = friend print(' '.join(map(str, result)))
Title: Presents Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there. If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift. Now Petya wants to know for each friend *i* the number of a friend who has given him a gift. Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves. Output Specification: Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*. Demo Input: ['4\n2 3 4 1\n', '3\n1 3 2\n', '2\n1 2\n'] Demo Output: ['4 1 2 3\n', '1 3 2\n', '1 2\n'] Note: none
```python n = int(input()) givers = list(map(int, input().split())) result = [0] * n for i in range(n): friend = i + 1 giver = givers[i] result[giver - 1] = friend print(' '.join(map(str, result))) ```
3
653
A
Bear and Three Balls
PROGRAMMING
900
[ "brute force", "implementation", "sortings" ]
null
null
Limak is a little polar bear. He has *n* balls, the *i*-th ball has size *t**i*. Limak wants to give one ball to each of his three friends. Giving gifts isn't easy — there are two rules Limak must obey to make friends happy: - No two friends can get balls of the same size. - No two friends can get balls of sizes that differ by more than 2. For example, Limak can choose balls with sizes 4, 5 and 3, or balls with sizes 90, 91 and 92. But he can't choose balls with sizes 5, 5 and 6 (two friends would get balls of the same size), and he can't choose balls with sizes 30, 31 and 33 (because sizes 30 and 33 differ by more than 2). Your task is to check whether Limak can choose three balls that satisfy conditions above.
The first line of the input contains one integer *n* (3<=≤<=*n*<=≤<=50) — the number of balls Limak has. The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000) where *t**i* denotes the size of the *i*-th ball.
Print "YES" (without quotes) if Limak can choose three balls of distinct sizes, such that any two of them differ by no more than 2. Otherwise, print "NO" (without quotes).
[ "4\n18 55 16 17\n", "6\n40 41 43 44 44 44\n", "8\n5 972 3 4 1 4 970 971\n" ]
[ "YES\n", "NO\n", "YES\n" ]
In the first sample, there are 4 balls and Limak is able to choose three of them to satisfy the rules. He must must choose balls with sizes 18, 16 and 17. In the second sample, there is no way to give gifts to three friends without breaking the rules. In the third sample, there is even more than one way to choose balls: 1. Choose balls with sizes 3, 4 and 5. 1. Choose balls with sizes 972, 970, 971.
500
[ { "input": "4\n18 55 16 17", "output": "YES" }, { "input": "6\n40 41 43 44 44 44", "output": "NO" }, { "input": "8\n5 972 3 4 1 4 970 971", "output": "YES" }, { "input": "3\n959 747 656", "output": "NO" }, { "input": "4\n1 2 2 3", "output": "YES" }, { "input": "50\n998 30 384 289 505 340 872 223 663 31 929 625 864 699 735 589 676 399 745 635 963 381 75 97 324 612 597 797 103 382 25 894 219 458 337 572 201 355 294 275 278 311 586 573 965 704 936 237 715 543", "output": "NO" }, { "input": "50\n941 877 987 982 966 979 984 810 811 909 872 980 957 897 845 995 924 905 984 914 824 840 868 910 815 808 872 858 883 952 823 835 860 874 959 972 931 867 866 987 982 837 800 921 887 910 982 980 828 869", "output": "YES" }, { "input": "3\n408 410 409", "output": "YES" }, { "input": "3\n903 902 904", "output": "YES" }, { "input": "3\n399 400 398", "output": "YES" }, { "input": "3\n450 448 449", "output": "YES" }, { "input": "3\n390 389 388", "output": "YES" }, { "input": "3\n438 439 440", "output": "YES" }, { "input": "11\n488 688 490 94 564 615 641 170 489 517 669", "output": "YES" }, { "input": "24\n102 672 983 82 720 501 81 721 982 312 207 897 159 964 611 956 118 984 37 271 596 403 772 954", "output": "YES" }, { "input": "36\n175 551 70 479 875 480 979 32 465 402 640 116 76 687 874 678 359 785 753 401 978 629 162 963 886 641 39 845 132 930 2 372 478 947 407 318", "output": "YES" }, { "input": "6\n10 79 306 334 304 305", "output": "YES" }, { "input": "34\n787 62 26 683 486 364 684 891 846 801 969 837 359 800 836 359 471 637 732 91 841 836 7 799 959 405 416 841 737 803 615 483 323 365", "output": "YES" }, { "input": "30\n860 238 14 543 669 100 428 789 576 484 754 274 849 850 586 377 711 386 510 408 520 693 23 477 266 851 728 711 964 73", "output": "YES" }, { "input": "11\n325 325 324 324 324 325 325 324 324 324 324", "output": "NO" }, { "input": "7\n517 517 518 517 518 518 518", "output": "NO" }, { "input": "20\n710 710 711 711 711 711 710 710 710 710 711 710 710 710 710 710 710 711 711 710", "output": "NO" }, { "input": "48\n29 30 29 29 29 30 29 30 30 30 30 29 30 30 30 29 29 30 30 29 30 29 29 30 29 30 29 30 30 29 30 29 29 30 30 29 29 30 30 29 29 30 30 30 29 29 30 29", "output": "NO" }, { "input": "7\n880 880 514 536 881 881 879", "output": "YES" }, { "input": "15\n377 432 262 376 261 375 377 262 263 263 261 376 262 262 375", "output": "YES" }, { "input": "32\n305 426 404 961 426 425 614 304 404 425 615 403 303 304 615 303 305 405 427 614 403 303 425 615 404 304 427 403 206 616 405 404", "output": "YES" }, { "input": "41\n115 686 988 744 762 519 745 519 518 83 85 115 520 44 687 686 685 596 988 687 989 988 114 745 84 519 519 746 988 84 745 744 115 114 85 115 520 746 745 116 987", "output": "YES" }, { "input": "47\n1 2 483 28 7 109 270 651 464 162 353 521 224 989 721 499 56 69 197 716 313 446 580 645 828 197 100 138 789 499 147 677 384 711 783 937 300 543 540 93 669 604 739 122 632 822 116", "output": "NO" }, { "input": "31\n1 2 1 373 355 692 750 920 578 666 615 232 141 129 663 929 414 704 422 559 568 731 354 811 532 618 39 879 292 602 995", "output": "NO" }, { "input": "50\n5 38 41 4 15 40 27 39 20 3 44 47 30 6 36 29 35 12 19 26 10 2 21 50 11 46 48 49 17 16 33 13 32 28 31 18 23 34 7 14 24 45 9 37 1 8 42 25 43 22", "output": "YES" }, { "input": "50\n967 999 972 990 969 978 963 987 954 955 973 970 959 981 995 983 986 994 979 957 965 982 992 977 953 975 956 961 993 997 998 958 980 962 960 951 996 991 1000 966 971 988 976 968 989 984 974 964 985 952", "output": "YES" }, { "input": "50\n850 536 761 506 842 898 857 723 583 637 536 943 895 929 890 612 832 633 696 731 553 880 710 812 665 877 915 636 711 540 748 600 554 521 813 796 568 513 543 809 798 820 928 504 999 646 907 639 550 911", "output": "NO" }, { "input": "3\n3 1 2", "output": "YES" }, { "input": "3\n500 999 1000", "output": "NO" }, { "input": "10\n101 102 104 105 107 109 110 112 113 115", "output": "NO" }, { "input": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "NO" }, { "input": "50\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000", "output": "NO" }, { "input": "3\n1000 999 998", "output": "YES" }, { "input": "49\n343 322 248 477 53 156 245 493 209 141 370 66 229 184 434 137 276 472 216 456 147 180 140 114 493 323 393 262 380 314 222 124 98 441 129 346 48 401 347 460 122 125 114 106 189 260 374 165 456", "output": "NO" }, { "input": "20\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 3 3 3 3 3", "output": "YES" }, { "input": "3\n999 999 1000", "output": "NO" }, { "input": "9\n2 4 5 13 25 100 200 300 400", "output": "NO" }, { "input": "9\n1 1 1 2 2 2 3 3 3", "output": "YES" }, { "input": "3\n1 1 2", "output": "NO" }, { "input": "3\n998 999 1000", "output": "YES" }, { "input": "12\n1 1 1 1 1 1 1 1 1 2 2 4", "output": "NO" }, { "input": "4\n4 3 4 5", "output": "YES" }, { "input": "6\n1 1 1 2 2 2", "output": "NO" }, { "input": "3\n2 3 2", "output": "NO" }, { "input": "5\n10 5 6 3 2", "output": "NO" }, { "input": "3\n1 2 1", "output": "NO" }, { "input": "3\n1 2 3", "output": "YES" }, { "input": "4\n998 999 1000 1000", "output": "YES" }, { "input": "5\n2 3 9 9 4", "output": "YES" }, { "input": "4\n1 2 4 4", "output": "NO" }, { "input": "3\n1 1 1", "output": "NO" }, { "input": "3\n2 2 3", "output": "NO" }, { "input": "7\n1 2 2 2 4 5 6", "output": "YES" }, { "input": "5\n1 3 10 3 10", "output": "NO" }, { "input": "3\n1 2 2", "output": "NO" }, { "input": "4\n1000 1000 999 998", "output": "YES" }, { "input": "3\n5 3 7", "output": "NO" }, { "input": "6\n1 1 2 2 3 3", "output": "YES" }, { "input": "9\n6 6 6 5 5 5 4 4 4", "output": "YES" }, { "input": "7\n5 6 6 6 7 7 7", "output": "YES" }, { "input": "5\n2 3 3 3 4", "output": "YES" }, { "input": "5\n2 1 2 1 3", "output": "YES" }, { "input": "3\n1 2 7", "output": "NO" }, { "input": "3\n1000 1000 1000", "output": "NO" }, { "input": "5\n1 100 2 100 3", "output": "YES" }, { "input": "5\n5 4 6 5 5", "output": "YES" }, { "input": "12\n1 1 1 1 2 2 2 2 3 3 3 3", "output": "YES" }, { "input": "5\n9 9 1 2 3", "output": "YES" }, { "input": "6\n1 2 3 1 2 3", "output": "YES" }, { "input": "7\n1 1 1 1 2 3 3", "output": "YES" }, { "input": "3\n13 13 13", "output": "NO" }, { "input": "3\n42 42 42", "output": "NO" }, { "input": "8\n1 1 1 1 2 2 2 2", "output": "NO" }, { "input": "6\n1 1 1 1 2 3", "output": "YES" }, { "input": "6\n1 1 2 2 6 6", "output": "NO" }, { "input": "6\n1 2 5 5 5 5", "output": "NO" }, { "input": "9\n1 2 3 1 2 3 1 2 3", "output": "YES" }, { "input": "4\n1 2 1 100", "output": "NO" }, { "input": "5\n1 1 2 2 3", "output": "YES" } ]
1,458,376,975
475
Python 3
WRONG_ANSWER
PRETESTS
4
62
4,608,000
#!/usr/bin/python3 def good_pair(a, b): return 0 < (max(a, b) - min(a, b)) <= 2 n = int(input()) balls = sorted(list(map(int, input().split()))) ans = "NO" for i in range(1, n - 1): if good_pair(balls[i], balls[i + 1]) and good_pair(balls[i], balls[i - 1]) and good_pair(balls[i - 1], balls[i + 1]): ans = "YES" break print(ans)
Title: Bear and Three Balls Time Limit: None seconds Memory Limit: None megabytes Problem Description: Limak is a little polar bear. He has *n* balls, the *i*-th ball has size *t**i*. Limak wants to give one ball to each of his three friends. Giving gifts isn't easy — there are two rules Limak must obey to make friends happy: - No two friends can get balls of the same size. - No two friends can get balls of sizes that differ by more than 2. For example, Limak can choose balls with sizes 4, 5 and 3, or balls with sizes 90, 91 and 92. But he can't choose balls with sizes 5, 5 and 6 (two friends would get balls of the same size), and he can't choose balls with sizes 30, 31 and 33 (because sizes 30 and 33 differ by more than 2). Your task is to check whether Limak can choose three balls that satisfy conditions above. Input Specification: The first line of the input contains one integer *n* (3<=≤<=*n*<=≤<=50) — the number of balls Limak has. The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000) where *t**i* denotes the size of the *i*-th ball. Output Specification: Print "YES" (without quotes) if Limak can choose three balls of distinct sizes, such that any two of them differ by no more than 2. Otherwise, print "NO" (without quotes). Demo Input: ['4\n18 55 16 17\n', '6\n40 41 43 44 44 44\n', '8\n5 972 3 4 1 4 970 971\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n'] Note: In the first sample, there are 4 balls and Limak is able to choose three of them to satisfy the rules. He must must choose balls with sizes 18, 16 and 17. In the second sample, there is no way to give gifts to three friends without breaking the rules. In the third sample, there is even more than one way to choose balls: 1. Choose balls with sizes 3, 4 and 5. 1. Choose balls with sizes 972, 970, 971.
```python #!/usr/bin/python3 def good_pair(a, b): return 0 < (max(a, b) - min(a, b)) <= 2 n = int(input()) balls = sorted(list(map(int, input().split()))) ans = "NO" for i in range(1, n - 1): if good_pair(balls[i], balls[i + 1]) and good_pair(balls[i], balls[i - 1]) and good_pair(balls[i - 1], balls[i + 1]): ans = "YES" break print(ans) ```
0
869
A
The Artful Expedient
PROGRAMMING
1,100
[ "brute force", "implementation" ]
null
null
Rock... Paper! After Karen have found the deterministic winning (losing?) strategy for rock-paper-scissors, her brother, Koyomi, comes up with a new game as a substitute. The game works as follows. A positive integer *n* is decided first. Both Koyomi and Karen independently choose *n* distinct positive integers, denoted by *x*1,<=*x*2,<=...,<=*x**n* and *y*1,<=*y*2,<=...,<=*y**n* respectively. They reveal their sequences, and repeat until all of 2*n* integers become distinct, which is the only final state to be kept and considered. Then they count the number of ordered pairs (*i*,<=*j*) (1<=≤<=*i*,<=*j*<=≤<=*n*) such that the value *x**i* xor *y**j* equals to one of the 2*n* integers. Here xor means the [bitwise exclusive or](https://en.wikipedia.org/wiki/Bitwise_operation#XOR) operation on two integers, and is denoted by operators ^ and/or xor in most programming languages. Karen claims a win if the number of such pairs is even, and Koyomi does otherwise. And you're here to help determine the winner of their latest game.
The first line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=2<=000) — the length of both sequences. The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=2·106) — the integers finally chosen by Koyomi. The third line contains *n* space-separated integers *y*1,<=*y*2,<=...,<=*y**n* (1<=≤<=*y**i*<=≤<=2·106) — the integers finally chosen by Karen. Input guarantees that the given 2*n* integers are pairwise distinct, that is, no pair (*i*,<=*j*) (1<=≤<=*i*,<=*j*<=≤<=*n*) exists such that one of the following holds: *x**i*<==<=*y**j*; *i*<=≠<=*j* and *x**i*<==<=*x**j*; *i*<=≠<=*j* and *y**i*<==<=*y**j*.
Output one line — the name of the winner, that is, "Koyomi" or "Karen" (without quotes). Please be aware of the capitalization.
[ "3\n1 2 3\n4 5 6\n", "5\n2 4 6 8 10\n9 7 5 3 1\n" ]
[ "Karen\n", "Karen\n" ]
In the first example, there are 6 pairs satisfying the constraint: (1, 1), (1, 2), (2, 1), (2, 3), (3, 2) and (3, 3). Thus, Karen wins since 6 is an even number. In the second example, there are 16 such pairs, and Karen wins again.
500
[ { "input": "3\n1 2 3\n4 5 6", "output": "Karen" }, { "input": "5\n2 4 6 8 10\n9 7 5 3 1", "output": "Karen" }, { "input": "1\n1\n2000000", "output": "Karen" }, { "input": "2\n97153 2000000\n1999998 254", "output": "Karen" }, { "input": "15\n31 30 29 28 27 26 25 24 23 22 21 20 19 18 17\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15", "output": "Karen" }, { "input": "30\n79656 68607 871714 1858841 237684 1177337 532141 161161 1111201 527235 323345 1979059 665353 507265 1290761 610606 1238375 743262 106355 1167830 180315 1233029 816465 752968 782570 1499881 1328457 1867240 13948 1302782\n322597 1868510 1958236 1348157 765908 1023636 874300 537124 631783 414906 886318 1931572 1381013 992451 1305644 1525745 716087 83173 303248 1572710 43084 333341 992413 267806 70390 644521 1014900 497068 178940 1920268", "output": "Karen" }, { "input": "30\n1143673 436496 1214486 1315862 148404 724601 1430740 1433008 1654610 1635673 614673 1713408 1270999 1697 1463796 50027 525482 1659078 688200 842647 518551 877506 1017082 1807856 3280 759698 1208220 470180 829800 1960886\n1312613 1965095 967255 1289012 1950383 582960 856825 49684 808824 319418 1968270 190821 344545 211332 1219388 1773751 1876402 132626 541448 1584672 24276 1053225 1823073 1858232 1209173 1035991 1956373 1237148 1973608 848873", "output": "Karen" }, { "input": "1\n2\n3", "output": "Karen" }, { "input": "1\n1048576\n1020000", "output": "Karen" }, { "input": "3\n9 33 69\n71 74 100", "output": "Karen" }, { "input": "3\n1 2 3\n9 5 6", "output": "Karen" }, { "input": "3\n1 7 8\n9 10 20", "output": "Karen" }, { "input": "3\n1 3 2\n4 5 8", "output": "Karen" }, { "input": "3\n2 1 100\n3 4 9", "output": "Karen" }, { "input": "3\n3 1 100\n2 1000 100000", "output": "Karen" }, { "input": "3\n1 2 5\n3 4 6", "output": "Karen" }, { "input": "3\n3 1 8\n2 4 17", "output": "Karen" }, { "input": "3\n1 5 6\n7 8 3", "output": "Karen" }, { "input": "1\n1\n3", "output": "Karen" }, { "input": "3\n1 3 10\n2 4 20", "output": "Karen" }, { "input": "3\n7 8 10\n15 9 11", "output": "Karen" }, { "input": "3\n5 6 8\n3 100 9", "output": "Karen" }, { "input": "3\n1 2 3\n4 5 8", "output": "Karen" }, { "input": "3\n1 2 19\n3 7 30", "output": "Karen" }, { "input": "3\n1 2 3\n6 7 8", "output": "Karen" }, { "input": "3\n1 4 55\n2 3 9", "output": "Karen" }, { "input": "3\n1 100 200\n5 4 500", "output": "Karen" }, { "input": "1\n6\n7", "output": "Karen" }, { "input": "3\n1 3 5\n2 4 13", "output": "Karen" }, { "input": "3\n3 1 100\n2 1000 10000", "output": "Karen" }, { "input": "3\n1 3 9\n2 4 40", "output": "Karen" }, { "input": "2\n1 199999\n1935807 2000000", "output": "Karen" }, { "input": "3\n1 3 8\n2 4 24", "output": "Karen" }, { "input": "2\n4 1\n7 3", "output": "Karen" }, { "input": "3\n1 2 4\n3 7 8", "output": "Karen" }, { "input": "3\n1 6 10000\n2 3 100000", "output": "Karen" } ]
1,549,303,523
2,147,483,647
PyPy 3
OK
TESTS
49
202
614,400
n=int(input()) Lko = list(map(int, input().split())) Lka=list(map(int,input().split())) E=set(Lko+Lka) c=0; for i in range(n) : for j in range(n) : if((Lko[i]^Lka[j])in E) : c=c+1; if (c%2==0): print("Karen") else: print("Koyomi")
Title: The Artful Expedient Time Limit: None seconds Memory Limit: None megabytes Problem Description: Rock... Paper! After Karen have found the deterministic winning (losing?) strategy for rock-paper-scissors, her brother, Koyomi, comes up with a new game as a substitute. The game works as follows. A positive integer *n* is decided first. Both Koyomi and Karen independently choose *n* distinct positive integers, denoted by *x*1,<=*x*2,<=...,<=*x**n* and *y*1,<=*y*2,<=...,<=*y**n* respectively. They reveal their sequences, and repeat until all of 2*n* integers become distinct, which is the only final state to be kept and considered. Then they count the number of ordered pairs (*i*,<=*j*) (1<=≤<=*i*,<=*j*<=≤<=*n*) such that the value *x**i* xor *y**j* equals to one of the 2*n* integers. Here xor means the [bitwise exclusive or](https://en.wikipedia.org/wiki/Bitwise_operation#XOR) operation on two integers, and is denoted by operators ^ and/or xor in most programming languages. Karen claims a win if the number of such pairs is even, and Koyomi does otherwise. And you're here to help determine the winner of their latest game. Input Specification: The first line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=2<=000) — the length of both sequences. The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=2·106) — the integers finally chosen by Koyomi. The third line contains *n* space-separated integers *y*1,<=*y*2,<=...,<=*y**n* (1<=≤<=*y**i*<=≤<=2·106) — the integers finally chosen by Karen. Input guarantees that the given 2*n* integers are pairwise distinct, that is, no pair (*i*,<=*j*) (1<=≤<=*i*,<=*j*<=≤<=*n*) exists such that one of the following holds: *x**i*<==<=*y**j*; *i*<=≠<=*j* and *x**i*<==<=*x**j*; *i*<=≠<=*j* and *y**i*<==<=*y**j*. Output Specification: Output one line — the name of the winner, that is, "Koyomi" or "Karen" (without quotes). Please be aware of the capitalization. Demo Input: ['3\n1 2 3\n4 5 6\n', '5\n2 4 6 8 10\n9 7 5 3 1\n'] Demo Output: ['Karen\n', 'Karen\n'] Note: In the first example, there are 6 pairs satisfying the constraint: (1, 1), (1, 2), (2, 1), (2, 3), (3, 2) and (3, 3). Thus, Karen wins since 6 is an even number. In the second example, there are 16 such pairs, and Karen wins again.
```python n=int(input()) Lko = list(map(int, input().split())) Lka=list(map(int,input().split())) E=set(Lko+Lka) c=0; for i in range(n) : for j in range(n) : if((Lko[i]^Lka[j])in E) : c=c+1; if (c%2==0): print("Karen") else: print("Koyomi") ```
3
962
A
Equator
PROGRAMMING
1,300
[ "implementation" ]
null
null
Polycarp has created his own training plan to prepare for the programming contests. He will train for $n$ days, all days are numbered from $1$ to $n$, beginning from the first. On the $i$-th day Polycarp will necessarily solve $a_i$ problems. One evening Polycarp plans to celebrate the equator. He will celebrate it on the first evening of such a day that from the beginning of the training and to this day inclusive he will solve half or more of all the problems. Determine the index of day when Polycarp will celebrate the equator.
The first line contains a single integer $n$ ($1 \le n \le 200\,000$) — the number of days to prepare for the programming contests. The second line contains a sequence $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10\,000$), where $a_i$ equals to the number of problems, which Polycarp will solve on the $i$-th day.
Print the index of the day when Polycarp will celebrate the equator.
[ "4\n1 3 2 1\n", "6\n2 2 2 2 2 2\n" ]
[ "2\n", "3\n" ]
In the first example Polycarp will celebrate the equator on the evening of the second day, because up to this day (inclusive) he will solve $4$ out of $7$ scheduled problems on four days of the training. In the second example Polycarp will celebrate the equator on the evening of the third day, because up to this day (inclusive) he will solve $6$ out of $12$ scheduled problems on six days of the training.
0
[ { "input": "4\n1 3 2 1", "output": "2" }, { "input": "6\n2 2 2 2 2 2", "output": "3" }, { "input": "1\n10000", "output": "1" }, { "input": "3\n2 1 1", "output": "1" }, { "input": "2\n1 3", "output": "2" }, { "input": "4\n2 1 1 3", "output": "3" }, { "input": "3\n1 1 3", "output": "3" }, { "input": "3\n1 1 1", "output": "2" }, { "input": "2\n1 2", "output": "2" }, { "input": "3\n2 1 2", "output": "2" }, { "input": "5\n1 2 4 3 5", "output": "4" }, { "input": "5\n2 2 2 4 3", "output": "4" }, { "input": "4\n1 2 3 1", "output": "3" }, { "input": "6\n7 3 10 7 3 11", "output": "4" }, { "input": "2\n3 4", "output": "2" }, { "input": "5\n1 1 1 1 1", "output": "3" }, { "input": "4\n1 3 2 3", "output": "3" }, { "input": "2\n2 3", "output": "2" }, { "input": "3\n32 10 23", "output": "2" }, { "input": "7\n1 1 1 1 1 1 1", "output": "4" }, { "input": "3\n1 2 4", "output": "3" }, { "input": "6\n3 3 3 2 4 4", "output": "4" }, { "input": "9\n1 1 1 1 1 1 1 1 1", "output": "5" }, { "input": "5\n1 3 3 1 1", "output": "3" }, { "input": "4\n1 1 1 2", "output": "3" }, { "input": "4\n1 2 1 3", "output": "3" }, { "input": "3\n2 2 1", "output": "2" }, { "input": "4\n2 3 3 3", "output": "3" }, { "input": "4\n3 2 3 3", "output": "3" }, { "input": "4\n2 1 1 1", "output": "2" }, { "input": "3\n2 1 4", "output": "3" }, { "input": "2\n6 7", "output": "2" }, { "input": "4\n3 3 4 3", "output": "3" }, { "input": "4\n1 1 2 5", "output": "4" }, { "input": "4\n1 8 7 3", "output": "3" }, { "input": "6\n2 2 2 2 2 3", "output": "4" }, { "input": "3\n2 2 5", "output": "3" }, { "input": "4\n1 1 2 1", "output": "3" }, { "input": "5\n1 1 2 2 3", "output": "4" }, { "input": "5\n9 5 3 4 8", "output": "3" }, { "input": "3\n3 3 1", "output": "2" }, { "input": "4\n1 2 2 2", "output": "3" }, { "input": "3\n1 3 5", "output": "3" }, { "input": "4\n1 1 3 6", "output": "4" }, { "input": "6\n1 2 1 1 1 1", "output": "3" }, { "input": "3\n3 1 3", "output": "2" }, { "input": "5\n3 4 5 1 2", "output": "3" }, { "input": "11\n1 1 1 1 1 1 1 1 1 1 1", "output": "6" }, { "input": "5\n3 1 2 5 2", "output": "4" }, { "input": "4\n1 1 1 4", "output": "4" }, { "input": "4\n2 6 1 10", "output": "4" }, { "input": "4\n2 2 3 2", "output": "3" }, { "input": "4\n4 2 2 1", "output": "2" }, { "input": "6\n1 1 1 1 1 4", "output": "5" }, { "input": "3\n3 2 2", "output": "2" }, { "input": "6\n1 3 5 1 7 4", "output": "5" }, { "input": "5\n1 2 4 8 16", "output": "5" }, { "input": "5\n1 2 4 4 4", "output": "4" }, { "input": "6\n4 2 1 2 3 1", "output": "3" }, { "input": "4\n3 2 1 5", "output": "3" }, { "input": "1\n1", "output": "1" }, { "input": "3\n2 4 7", "output": "3" }, { "input": "5\n1 1 1 1 3", "output": "4" }, { "input": "3\n3 1 5", "output": "3" }, { "input": "4\n1 2 3 7", "output": "4" }, { "input": "3\n1 4 6", "output": "3" }, { "input": "4\n2 1 2 2", "output": "3" }, { "input": "2\n4 5", "output": "2" }, { "input": "5\n1 2 1 2 1", "output": "3" }, { "input": "3\n2 3 6", "output": "3" }, { "input": "6\n1 1 4 1 1 5", "output": "4" }, { "input": "5\n2 2 2 2 1", "output": "3" }, { "input": "2\n5 6", "output": "2" }, { "input": "4\n2 2 1 4", "output": "3" }, { "input": "5\n2 2 3 4 4", "output": "4" }, { "input": "4\n3 1 1 2", "output": "2" }, { "input": "5\n3 4 1 4 5", "output": "4" }, { "input": "4\n1 3 1 6", "output": "4" }, { "input": "5\n1 1 1 2 2", "output": "4" }, { "input": "4\n1 4 2 4", "output": "3" }, { "input": "10\n1 1 1 1 1 1 1 1 1 8", "output": "9" }, { "input": "4\n1 4 5 1", "output": "3" }, { "input": "5\n1 1 1 1 5", "output": "5" }, { "input": "4\n1 3 4 1", "output": "3" }, { "input": "4\n2 2 2 3", "output": "3" }, { "input": "4\n2 3 2 4", "output": "3" }, { "input": "5\n2 2 1 2 2", "output": "3" }, { "input": "3\n4 3 2", "output": "2" }, { "input": "3\n6 5 2", "output": "2" }, { "input": "69\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "35" }, { "input": "6\n1 1 1 1 1 2", "output": "4" }, { "input": "5\n1 2 5 4 5", "output": "4" }, { "input": "2\n9 10", "output": "2" }, { "input": "3\n1 1 5", "output": "3" }, { "input": "4\n3 4 3 5", "output": "3" }, { "input": "4\n1 4 3 3", "output": "3" }, { "input": "4\n7 1 3 4", "output": "2" }, { "input": "3\n100 100 1", "output": "2" }, { "input": "4\n5 2 2 2", "output": "2" } ]
1,558,983,328
2,147,483,647
Python 3
OK
TESTS
106
1,637
13,516,800
x=int(input()) s=[int(n) for n in input().split()] j=x//2 if sum(s[:j+1])*2>sum(s): n=j+1 while sum(s[:n])*2>=sum(s): n-=1 print(n+1) elif sum(s[:j+1])*2==sum(s): print(j+1) else: n=j+1 while sum(s[:n])*2<sum(s): n+=1 print(n)
Title: Equator Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarp has created his own training plan to prepare for the programming contests. He will train for $n$ days, all days are numbered from $1$ to $n$, beginning from the first. On the $i$-th day Polycarp will necessarily solve $a_i$ problems. One evening Polycarp plans to celebrate the equator. He will celebrate it on the first evening of such a day that from the beginning of the training and to this day inclusive he will solve half or more of all the problems. Determine the index of day when Polycarp will celebrate the equator. Input Specification: The first line contains a single integer $n$ ($1 \le n \le 200\,000$) — the number of days to prepare for the programming contests. The second line contains a sequence $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10\,000$), where $a_i$ equals to the number of problems, which Polycarp will solve on the $i$-th day. Output Specification: Print the index of the day when Polycarp will celebrate the equator. Demo Input: ['4\n1 3 2 1\n', '6\n2 2 2 2 2 2\n'] Demo Output: ['2\n', '3\n'] Note: In the first example Polycarp will celebrate the equator on the evening of the second day, because up to this day (inclusive) he will solve $4$ out of $7$ scheduled problems on four days of the training. In the second example Polycarp will celebrate the equator on the evening of the third day, because up to this day (inclusive) he will solve $6$ out of $12$ scheduled problems on six days of the training.
```python x=int(input()) s=[int(n) for n in input().split()] j=x//2 if sum(s[:j+1])*2>sum(s): n=j+1 while sum(s[:n])*2>=sum(s): n-=1 print(n+1) elif sum(s[:j+1])*2==sum(s): print(j+1) else: n=j+1 while sum(s[:n])*2<sum(s): n+=1 print(n) ```
3
770
A
New Password
PROGRAMMING
800
[ "*special", "implementation" ]
null
null
Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help. Innokentiy decides that new password should satisfy the following conditions: - the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct. Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions.
The first line contains two positive integers *n* and *k* (2<=≤<=*n*<=≤<=100, 2<=≤<=*k*<=≤<=*min*(*n*,<=26)) — the length of the password and the number of distinct symbols in it. Pay attention that a desired new password always exists.
Print any password which satisfies all conditions given by Innokentiy.
[ "4 3\n", "6 6\n", "5 2\n" ]
[ "java\n", "python\n", "phphp\n" ]
In the first test there is one of the appropriate new passwords — java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it. In the second test there is one of the appropriate new passwords — python, because its length is equal to 6 and it consists of 6 distinct lowercase letters. In the third test there is one of the appropriate new passwords — phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it. Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests.
500
[ { "input": "4 3", "output": "abca" }, { "input": "6 6", "output": "abcdef" }, { "input": "5 2", "output": "ababa" }, { "input": "3 2", "output": "aba" }, { "input": "10 2", "output": "ababababab" }, { "input": "26 13", "output": "abcdefghijklmabcdefghijklm" }, { "input": "100 2", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababab" }, { "input": "100 10", "output": "abcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij" }, { "input": "3 3", "output": "abc" }, { "input": "6 3", "output": "abcabc" }, { "input": "10 3", "output": "abcabcabca" }, { "input": "50 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab" }, { "input": "90 2", "output": "ababababababababababababababababababababababababababababababababababababababababababababab" }, { "input": "6 2", "output": "ababab" }, { "input": "99 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabc" }, { "input": "4 2", "output": "abab" }, { "input": "100 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca" }, { "input": "40 22", "output": "abcdefghijklmnopqrstuvabcdefghijklmnopqr" }, { "input": "13 8", "output": "abcdefghabcde" }, { "input": "16 15", "output": "abcdefghijklmnoa" }, { "input": "17 17", "output": "abcdefghijklmnopq" }, { "input": "19 4", "output": "abcdabcdabcdabcdabc" }, { "input": "100 26", "output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv" }, { "input": "100 25", "output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxy" }, { "input": "26 26", "output": "abcdefghijklmnopqrstuvwxyz" }, { "input": "27 26", "output": "abcdefghijklmnopqrstuvwxyza" }, { "input": "2 2", "output": "ab" }, { "input": "26 25", "output": "abcdefghijklmnopqrstuvwxya" }, { "input": "99 2", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababa" }, { "input": "99 26", "output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstu" }, { "input": "4 4", "output": "abcd" }, { "input": "5 3", "output": "abcab" }, { "input": "5 4", "output": "abcda" }, { "input": "5 5", "output": "abcde" }, { "input": "24 22", "output": "abcdefghijklmnopqrstuvab" }, { "input": "26 14", "output": "abcdefghijklmnabcdefghijkl" }, { "input": "26 15", "output": "abcdefghijklmnoabcdefghijk" }, { "input": "30 12", "output": "abcdefghijklabcdefghijklabcdef" }, { "input": "35 4", "output": "abcdabcdabcdabcdabcdabcdabcdabcdabc" }, { "input": "79 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca" }, { "input": "79 14", "output": "abcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghi" }, { "input": "85 13", "output": "abcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefg" }, { "input": "90 25", "output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmno" }, { "input": "90 19", "output": "abcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmn" }, { "input": "26 24", "output": "abcdefghijklmnopqrstuvwxab" }, { "input": "100 17", "output": "abcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmno" }, { "input": "26 2", "output": "ababababababababababababab" } ]
1,647,034,592
2,147,483,647
Python 3
OK
TESTS
47
46
0
n, k = map(int, input().split()) alphabets = "abcdefghijklmnopqrstuvwxyz" print((alphabets[:k])*(n//k)+alphabets[:n%k])
Title: New Password Time Limit: None seconds Memory Limit: None megabytes Problem Description: Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help. Innokentiy decides that new password should satisfy the following conditions: - the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct. Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions. Input Specification: The first line contains two positive integers *n* and *k* (2<=≤<=*n*<=≤<=100, 2<=≤<=*k*<=≤<=*min*(*n*,<=26)) — the length of the password and the number of distinct symbols in it. Pay attention that a desired new password always exists. Output Specification: Print any password which satisfies all conditions given by Innokentiy. Demo Input: ['4 3\n', '6 6\n', '5 2\n'] Demo Output: ['java\n', 'python\n', 'phphp\n'] Note: In the first test there is one of the appropriate new passwords — java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it. In the second test there is one of the appropriate new passwords — python, because its length is equal to 6 and it consists of 6 distinct lowercase letters. In the third test there is one of the appropriate new passwords — phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it. Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests.
```python n, k = map(int, input().split()) alphabets = "abcdefghijklmnopqrstuvwxyz" print((alphabets[:k])*(n//k)+alphabets[:n%k]) ```
3
996
A
Hit the Lottery
PROGRAMMING
800
[ "dp", "greedy" ]
null
null
Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance?
The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$).
Output the minimum number of bills that Allen could receive.
[ "125\n", "43\n", "1000000000\n" ]
[ "3\n", "5\n", "10000000\n" ]
In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills. In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills. In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
500
[ { "input": "125", "output": "3" }, { "input": "43", "output": "5" }, { "input": "1000000000", "output": "10000000" }, { "input": "4", "output": "4" }, { "input": "5", "output": "1" }, { "input": "1", "output": "1" }, { "input": "74", "output": "8" }, { "input": "31", "output": "3" }, { "input": "59", "output": "8" }, { "input": "79", "output": "9" }, { "input": "7", "output": "3" }, { "input": "55", "output": "4" }, { "input": "40", "output": "2" }, { "input": "719", "output": "13" }, { "input": "847", "output": "13" }, { "input": "225", "output": "4" }, { "input": "4704", "output": "51" }, { "input": "1132", "output": "15" }, { "input": "7811", "output": "80" }, { "input": "7981", "output": "84" }, { "input": "82655", "output": "830" }, { "input": "6364", "output": "70" }, { "input": "74611", "output": "748" }, { "input": "45391", "output": "459" }, { "input": "620448", "output": "6210" }, { "input": "265145", "output": "2654" }, { "input": "671704", "output": "6721" }, { "input": "365173", "output": "3658" }, { "input": "7130872", "output": "71314" }, { "input": "9628747", "output": "96292" }, { "input": "8898399", "output": "88993" }, { "input": "9497953", "output": "94985" }, { "input": "19070947", "output": "190714" }, { "input": "20185520", "output": "201856" }, { "input": "91402248", "output": "914028" }, { "input": "27035533", "output": "270360" }, { "input": "22717528", "output": "227180" }, { "input": "24403439", "output": "244041" }, { "input": "163565555", "output": "1635659" }, { "input": "152541908", "output": "1525423" }, { "input": "668439837", "output": "6684403" }, { "input": "20", "output": "1" }, { "input": "999999999", "output": "10000009" }, { "input": "10", "output": "1" }, { "input": "7", "output": "3" }, { "input": "6", "output": "2" }, { "input": "99999999", "output": "1000009" }, { "input": "1000001", "output": "10001" }, { "input": "2521", "output": "27" } ]
1,698,041,811
2,147,483,647
PyPy 3-64
COMPILATION_ERROR
TESTS
0
0
0
// Online C++ compiler to run C++ program online #include <iostream> using namespace std; int main() { int a,sum=0; cin>>a; while (a!=1) { if (a>=100) { sum+=a/100; a=a%100; } else if (a>=20) { sum+=a/20; a=a%20; } else if (a>=15) { sum+=a/15; a=a%15; } else if (a>=5) { sum+=a/5; a=a%5; } else { sum+=a; break; } } cout<<sum<<endl; return 0; }
Title: Hit the Lottery Time Limit: None seconds Memory Limit: None megabytes Problem Description: Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance? Input Specification: The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$). Output Specification: Output the minimum number of bills that Allen could receive. Demo Input: ['125\n', '43\n', '1000000000\n'] Demo Output: ['3\n', '5\n', '10000000\n'] Note: In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills. In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills. In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
```python // Online C++ compiler to run C++ program online #include <iostream> using namespace std; int main() { int a,sum=0; cin>>a; while (a!=1) { if (a>=100) { sum+=a/100; a=a%100; } else if (a>=20) { sum+=a/20; a=a%20; } else if (a>=15) { sum+=a/15; a=a%15; } else if (a>=5) { sum+=a/5; a=a%5; } else { sum+=a; break; } } cout<<sum<<endl; return 0; } ```
-1
602
B
Approximating a Constant Range
PROGRAMMING
1,400
[ "dp", "implementation", "two pointers" ]
null
null
When Xellos was doing a practice course in university, he once had to measure the intensity of an effect that slowly approached equilibrium. A good way to determine the equilibrium intensity would be choosing a sufficiently large number of consecutive data points that seems as constant as possible and taking their average. Of course, with the usual sizes of data, it's nothing challenging — but why not make a similar programming contest problem while we're at it? You're given a sequence of *n* data points *a*1,<=...,<=*a**n*. There aren't any big jumps between consecutive data points — for each 1<=≤<=*i*<=&lt;<=*n*, it's guaranteed that |*a**i*<=+<=1<=-<=*a**i*|<=≤<=1. A range [*l*,<=*r*] of data points is said to be almost constant if the difference between the largest and the smallest value in that range is at most 1. Formally, let *M* be the maximum and *m* the minimum value of *a**i* for *l*<=≤<=*i*<=≤<=*r*; the range [*l*,<=*r*] is almost constant if *M*<=-<=*m*<=≤<=1. Find the length of the longest almost constant range.
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of data points. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100<=000).
Print a single number — the maximum length of an almost constant range of the given sequence.
[ "5\n1 2 3 3 2\n", "11\n5 4 5 5 6 7 8 8 8 7 6\n" ]
[ "4\n", "5\n" ]
In the first sample, the longest almost constant range is [2, 5]; its length (the number of data points in it) is 4. In the second sample, there are three almost constant ranges of length 4: [1, 4], [6, 9] and [7, 10]; the only almost constant range of the maximum length 5 is [6, 10].
1,000
[ { "input": "5\n1 2 3 3 2", "output": "4" }, { "input": "11\n5 4 5 5 6 7 8 8 8 7 6", "output": "5" }, { "input": "2\n3 2", "output": "2" }, { "input": "4\n1001 1000 1000 1001", "output": "4" }, { "input": "4\n1 1 2 3", "output": "3" }, { "input": "3\n1 2 1", "output": "3" }, { "input": "3\n1 2 3", "output": "2" }, { "input": "18\n10 9 8 7 6 5 4 3 2 1 2 3 4 5 6 7 8 9", "output": "3" }, { "input": "3\n1 2 2", "output": "3" }, { "input": "4\n10 9 10 9", "output": "4" }, { "input": "4\n4 3 2 3", "output": "3" }, { "input": "4\n8 8 7 7", "output": "4" }, { "input": "3\n99998 99999 100000", "output": "2" }, { "input": "3\n100000 99999 99998", "output": "2" }, { "input": "3\n1 1 1", "output": "3" }, { "input": "2\n99999 100000", "output": "2" }, { "input": "2\n100000 100000", "output": "2" }, { "input": "2\n1 1", "output": "2" }, { "input": "15\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000", "output": "15" } ]
1,642,355,913
2,147,483,647
PyPy 3-64
OK
TESTS
107
156
14,643,200
a=int(input()) b=list(map(int,input().split())) c=1 d=0 e=0 g=0 for i in range(1,a): f=b[i]-b[i-1] if(f!=0): if(f==d): g=e+1 e=i-1 d=f c=max(c,i-g+1) print(c)
Title: Approximating a Constant Range Time Limit: None seconds Memory Limit: None megabytes Problem Description: When Xellos was doing a practice course in university, he once had to measure the intensity of an effect that slowly approached equilibrium. A good way to determine the equilibrium intensity would be choosing a sufficiently large number of consecutive data points that seems as constant as possible and taking their average. Of course, with the usual sizes of data, it's nothing challenging — but why not make a similar programming contest problem while we're at it? You're given a sequence of *n* data points *a*1,<=...,<=*a**n*. There aren't any big jumps between consecutive data points — for each 1<=≤<=*i*<=&lt;<=*n*, it's guaranteed that |*a**i*<=+<=1<=-<=*a**i*|<=≤<=1. A range [*l*,<=*r*] of data points is said to be almost constant if the difference between the largest and the smallest value in that range is at most 1. Formally, let *M* be the maximum and *m* the minimum value of *a**i* for *l*<=≤<=*i*<=≤<=*r*; the range [*l*,<=*r*] is almost constant if *M*<=-<=*m*<=≤<=1. Find the length of the longest almost constant range. Input Specification: The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of data points. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100<=000). Output Specification: Print a single number — the maximum length of an almost constant range of the given sequence. Demo Input: ['5\n1 2 3 3 2\n', '11\n5 4 5 5 6 7 8 8 8 7 6\n'] Demo Output: ['4\n', '5\n'] Note: In the first sample, the longest almost constant range is [2, 5]; its length (the number of data points in it) is 4. In the second sample, there are three almost constant ranges of length 4: [1, 4], [6, 9] and [7, 10]; the only almost constant range of the maximum length 5 is [6, 10].
```python a=int(input()) b=list(map(int,input().split())) c=1 d=0 e=0 g=0 for i in range(1,a): f=b[i]-b[i-1] if(f!=0): if(f==d): g=e+1 e=i-1 d=f c=max(c,i-g+1) print(c) ```
3
875
E
Delivery Club
PROGRAMMING
2,600
[ "binary search", "data structures", "dp" ]
null
null
Petya and Vasya got employed as couriers. During the working day they are to deliver packages to *n* different points on the line. According to the company's internal rules, the delivery of packages must be carried out strictly in a certain order. Initially, Petya is at the point with the coordinate *s*1, Vasya is at the point with the coordinate *s*2, and the clients are at the points *x*1,<=*x*2,<=...,<=*x**n* in the order of the required visit. The guys agree in advance who of them will deliver the package to which of the customers, and then they act as follows. When the package for the *i*-th client is delivered, the one who delivers the package to the (*i*<=+<=1)-st client is sent to the path (it can be the same person who went to the point *x**i*, or the other). The friend who is not busy in delivering the current package, is standing still. To communicate with each other, the guys have got walkie-talkies. The walkie-talkies work rather poorly at great distances, so Petya and Vasya want to distribute the orders so that the maximum distance between them during the day is as low as possible. Help Petya and Vasya to minimize the maximum distance between them, observing all delivery rules.
The first line contains three integers *n*, *s*1, *s*2 (1<=≤<=*n*<=≤<=100<=000, 0<=≤<=*s*1,<=*s*2<=≤<=109) — number of points of delivery and starting positions of Petya and Vasya. The second line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n* — customers coordinates (0<=≤<=*x**i*<=≤<=109), in the order to make a delivery. It is guaranteed, that among the numbers *s*1,<=*s*2,<=*x*1,<=...,<=*x**n* there are no two equal.
Output the only integer, minimum possible maximal distance between couriers during delivery.
[ "2 0 10\n5 6\n", "3 2 1\n3 4 5\n", "1 4 5\n2\n" ]
[ "10\n", "1\n", "2\n" ]
In the first test case the initial distance between the couriers is 10. This value will be the answer, for example, Petya can perform both deliveries, and Vasya will remain at the starting point. In the second test case you can optimally act, for example, like this: Vasya delivers the package to the first customer, Petya to the second and, finally, Vasya delivers the package to the third client. With this order of delivery, the distance between the couriers will never exceed 1. In the third test case only two variants are possible: if the delivery of a single package is carried out by Petya, the maximum distance between them will be 5 - 2 = 3. If Vasya will deliver the package, the maximum distance is 4 - 2 = 2. The latter method is optimal.
2,000
[]
1,689,176,397
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
30
0
print("_RANDOM_GUESS_1689176397.439151")# 1689176397.4391732
Title: Delivery Club Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petya and Vasya got employed as couriers. During the working day they are to deliver packages to *n* different points on the line. According to the company's internal rules, the delivery of packages must be carried out strictly in a certain order. Initially, Petya is at the point with the coordinate *s*1, Vasya is at the point with the coordinate *s*2, and the clients are at the points *x*1,<=*x*2,<=...,<=*x**n* in the order of the required visit. The guys agree in advance who of them will deliver the package to which of the customers, and then they act as follows. When the package for the *i*-th client is delivered, the one who delivers the package to the (*i*<=+<=1)-st client is sent to the path (it can be the same person who went to the point *x**i*, or the other). The friend who is not busy in delivering the current package, is standing still. To communicate with each other, the guys have got walkie-talkies. The walkie-talkies work rather poorly at great distances, so Petya and Vasya want to distribute the orders so that the maximum distance between them during the day is as low as possible. Help Petya and Vasya to minimize the maximum distance between them, observing all delivery rules. Input Specification: The first line contains three integers *n*, *s*1, *s*2 (1<=≤<=*n*<=≤<=100<=000, 0<=≤<=*s*1,<=*s*2<=≤<=109) — number of points of delivery and starting positions of Petya and Vasya. The second line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n* — customers coordinates (0<=≤<=*x**i*<=≤<=109), in the order to make a delivery. It is guaranteed, that among the numbers *s*1,<=*s*2,<=*x*1,<=...,<=*x**n* there are no two equal. Output Specification: Output the only integer, minimum possible maximal distance between couriers during delivery. Demo Input: ['2 0 10\n5 6\n', '3 2 1\n3 4 5\n', '1 4 5\n2\n'] Demo Output: ['10\n', '1\n', '2\n'] Note: In the first test case the initial distance between the couriers is 10. This value will be the answer, for example, Petya can perform both deliveries, and Vasya will remain at the starting point. In the second test case you can optimally act, for example, like this: Vasya delivers the package to the first customer, Petya to the second and, finally, Vasya delivers the package to the third client. With this order of delivery, the distance between the couriers will never exceed 1. In the third test case only two variants are possible: if the delivery of a single package is carried out by Petya, the maximum distance between them will be 5 - 2 = 3. If Vasya will deliver the package, the maximum distance is 4 - 2 = 2. The latter method is optimal.
```python print("_RANDOM_GUESS_1689176397.439151")# 1689176397.4391732 ```
0
199
B
Special Olympics
PROGRAMMING
1,900
[ "geometry" ]
null
null
A renowned abstract artist Sasha, drawing inspiration from nowhere, decided to paint a picture entitled "Special Olympics". He justly thought that, if the regular Olympic games have five rings, then the Special ones will do with exactly two rings just fine. Let us remind you that a ring is a region located between two concentric circles with radii *r* and *R* (*r*<=&lt;<=*R*). These radii are called internal and external, respectively. Concentric circles are circles with centers located at the same point. Soon a white canvas, which can be considered as an infinite Cartesian plane, had two perfect rings, painted with solid black paint. As Sasha is very impulsive, the rings could have different radii and sizes, they intersect and overlap with each other in any way. We know only one thing for sure: the centers of the pair of rings are not the same. When Sasha got tired and fell into a deep sleep, a girl called Ilona came into the room and wanted to cut a circle for the sake of good memories. To make the circle beautiful, she decided to cut along the contour. We'll consider a contour to be a continuous closed line through which there is transition from one color to another (see notes for clarification). If the contour takes the form of a circle, then the result will be cutting out a circle, which Iona wants. But the girl's inquisitive mathematical mind does not rest: how many ways are there to cut a circle out of the canvas?
The input contains two lines. Each line has four space-separated integers *x**i*, *y**i*, *r**i*, *R**i*, that describe the *i*-th ring; *x**i* and *y**i* are coordinates of the ring's center, *r**i* and *R**i* are the internal and external radii of the ring correspondingly (<=-<=100<=≤<=*x**i*,<=*y**i*<=≤<=100; 1<=≤<=*r**i*<=&lt;<=*R**i*<=≤<=100). It is guaranteed that the centers of the rings do not coinside.
A single integer — the number of ways to cut out a circle from the canvas.
[ "60 60 45 55\n80 80 8 32\n", "60 60 45 55\n80 60 15 25\n", "50 50 35 45\n90 50 35 45\n" ]
[ "1", "4", "0" ]
Figures for test samples are given below. The possible cuts are marked with red dotted line.
1,000
[ { "input": "60 60 45 55\n80 80 8 32", "output": "1" }, { "input": "60 60 45 55\n80 60 15 25", "output": "4" }, { "input": "50 50 35 45\n90 50 35 45", "output": "0" }, { "input": "0 0 50 70\n1 0 60 80", "output": "2" }, { "input": "0 0 1 2\n10 0 2 20", "output": "2" }, { "input": "31 13 22 95\n48 63 21 98", "output": "0" }, { "input": "31 40 37 76\n48 65 66 98", "output": "0" }, { "input": "-65 -81 37 76\n48 65 66 98", "output": "4" }, { "input": "41 -14 37 76\n48 65 66 98", "output": "0" }, { "input": "41 -14 16 100\n48 17 37 66", "output": "1" }, { "input": "-75 -9 20 40\n25 55 99 100", "output": "0" }, { "input": "-45 6 20 40\n35 6 99 100", "output": "0" }, { "input": "-3 84 20 40\n76 96 96 100", "output": "0" }, { "input": "10 -91 20 40\n70 -91 79 100", "output": "1" }, { "input": "-64 -47 20 40\n-5 -37 79 100", "output": "1" }, { "input": "-63 97 20 40\n-34 97 11 48", "output": "0" }, { "input": "-67 47 20 40\n-38 47 11 49", "output": "0" }, { "input": "-100 -91 20 40\n-71 -91 11 68", "output": "0" }, { "input": "45 -76 20 40\n69 -69 15 65", "output": "1" }, { "input": "12 -43 20 40\n41 -43 11 97", "output": "1" }, { "input": "10 71 20 40\n39 78 10 49", "output": "0" }, { "input": "56 44 20 40\n83 44 12 13", "output": "1" }, { "input": "-20 78 20 40\n8 85 10 11", "output": "1" }, { "input": "65 -9 20 40\n94 -9 10 49", "output": "0" }, { "input": "-84 -59 20 40\n-74 -59 29 30", "output": "1" }, { "input": "33 -37 20 40\n42 -37 28 29", "output": "1" }, { "input": "-25 10 20 40\n4 17 10 69", "output": "0" }, { "input": "13 32 20 40\n42 32 10 69", "output": "1" }, { "input": "-12 -1 20 40\n-3 -1 28 31", "output": "1" }, { "input": "48 30 20 40\n77 37 10 99", "output": "1" }, { "input": "47 -50 20 40\n56 -46 28 30", "output": "1" }, { "input": "-26 -65 20 40\n52 -65 98 100", "output": "1" }, { "input": "-46 36 20 40\n14 36 80 100", "output": "2" }, { "input": "19 96 20 40\n77 96 78 99", "output": "2" }, { "input": "-42 -44 20 40\n-32 -44 30 48", "output": "1" }, { "input": "83 -23 20 40\n93 -23 30 50", "output": "2" }, { "input": "-100 -97 20 40\n-90 -97 30 100", "output": "2" }, { "input": "65 16 20 40\n74 16 29 48", "output": "1" }, { "input": "-66 78 20 40\n-62 81 25 45", "output": "2" }, { "input": "-11 63 20 40\n-2 63 29 31", "output": "2" }, { "input": "91 -59 20 40\n100 -59 29 100", "output": "2" }, { "input": "39 90 20 40\n47 90 28 31", "output": "2" }, { "input": "-100 40 20 40\n-81 40 1 38", "output": "1" }, { "input": "24 -24 20 40\n43 -24 1 21", "output": "2" }, { "input": "-8 35 20 40\n11 35 1 19", "output": "2" }, { "input": "-52 -94 20 40\n-33 -94 1 39", "output": "1" }, { "input": "61 2 20 40\n67 10 10 30", "output": "2" }, { "input": "49 -67 20 40\n57 -67 12 28", "output": "2" }, { "input": "65 17 20 40\n84 17 1 58", "output": "1" }, { "input": "-16 -18 20 40\n3 -18 1 59", "output": "2" }, { "input": "24 -16 20 40\n33 -16 11 31", "output": "2" }, { "input": "-83 96 20 40\n-64 96 1 98", "output": "2" }, { "input": "-10 89 20 40\n-2 89 12 29", "output": "2" }, { "input": "-40 -69 20 40\n60 -69 80 100", "output": "0" }, { "input": "-70 66 20 40\n8 66 58 98", "output": "0" }, { "input": "-11 -97 20 40\n67 -97 58 100", "output": "0" }, { "input": "-60 60 20 40\n0 60 40 100", "output": "1" }, { "input": "0 73 20 40\n59 73 39 100", "output": "1" }, { "input": "28 -91 20 40\n58 -91 10 49", "output": "0" }, { "input": "75 72 20 40\n99 90 10 50", "output": "0" }, { "input": "-84 74 20 40\n-54 74 10 63", "output": "0" }, { "input": "35 -6 20 40\n59 12 10 70", "output": "1" }, { "input": "67 41 20 40\n97 41 10 98", "output": "1" }, { "input": "-27 -68 20 40\n2 -68 9 48", "output": "0" }, { "input": "50 13 20 40\n78 13 8 12", "output": "1" }, { "input": "-73 36 20 40\n-44 36 9 10", "output": "1" }, { "input": "70 92 20 40\n99 92 9 49", "output": "0" }, { "input": "37 -80 20 40\n66 -80 9 66", "output": "0" }, { "input": "8 -95 20 40\n36 -95 8 68", "output": "1" }, { "input": "-9 77 20 40\n20 77 9 100", "output": "1" }, { "input": "-37 20 20 40\n41 31 99 100", "output": "1" }, { "input": "-36 28 20 40\n24 28 99 100", "output": "2" }, { "input": "-77 -16 20 40\n-18 -6 99 100", "output": "2" }, { "input": "-65 24 20 40\n-6 24 99 100", "output": "4" }, { "input": "-55 23 20 40\n-46 23 31 48", "output": "1" }, { "input": "-37 18 20 40\n-30 18 33 47", "output": "2" }, { "input": "-45 -93 20 40\n-36 -93 31 99", "output": "2" }, { "input": "-97 -29 20 40\n-39 -19 99 100", "output": "4" }, { "input": "14 18 20 40\n23 22 30 49", "output": "1" }, { "input": "-90 -38 20 40\n-81 -38 30 49", "output": "2" }, { "input": "52 -4 20 40\n61 -4 30 31", "output": "2" }, { "input": "-54 46 20 40\n-45 50 30 98", "output": "2" }, { "input": "74 -34 20 40\n82 -30 30 31", "output": "2" }, { "input": "23 -61 20 40\n41 -55 1 37", "output": "1" }, { "input": "57 -86 20 40\n75 -86 1 22", "output": "2" }, { "input": "-38 43 20 40\n-20 49 1 20", "output": "2" }, { "input": "-19 10 20 40\n-2 10 2 37", "output": "1" }, { "input": "64 58 20 40\n74 58 7 30", "output": "2" }, { "input": "53 49 20 40\n62 49 10 29", "output": "2" }, { "input": "53 80 20 40\n70 80 2 3", "output": "4" }, { "input": "73 -41 20 40\n91 -35 1 49", "output": "1" }, { "input": "-8 -34 20 40\n9 -34 2 57", "output": "2" }, { "input": "51 -40 20 40\n60 -40 9 31", "output": "2" }, { "input": "-29 87 20 40\n-11 93 1 94", "output": "2" }, { "input": "-64 3 20 40\n-55 7 6 30", "output": "2" }, { "input": "24 36 20 40\n41 39 1 2", "output": "4" }, { "input": "-56 -64 20 40\n44 2 96 100", "output": "0" }, { "input": "-59 -17 20 40\n21 -17 59 100", "output": "0" }, { "input": "-43 -3 20 40\n57 -3 79 80", "output": "1" }, { "input": "20 57 20 40\n99 69 58 100", "output": "0" }, { "input": "36 82 20 40\n96 82 38 100", "output": "1" }, { "input": "-55 37 20 40\n4 47 38 100", "output": "1" }, { "input": "-58 -4 20 40\n42 91 99 100", "output": "1" }, { "input": "28 51 20 40\n67 51 1 58", "output": "0" }, { "input": "-79 -62 20 40\n-41 -62 2 58", "output": "0" }, { "input": "-19 -10 20 40\n20 -10 1 19", "output": "1" }, { "input": "-95 -64 20 40\n-56 -64 1 78", "output": "0" }, { "input": "-17 -7 20 40\n22 -7 1 79", "output": "1" }, { "input": "-45 86 20 40\n-6 86 1 99", "output": "1" }, { "input": "-71 -23 20 40\n-32 -23 1 18", "output": "1" }, { "input": "-20 11 20 40\n80 11 60 100", "output": "1" }, { "input": "-27 97 20 40\n51 97 38 98", "output": "1" }, { "input": "-47 -84 20 40\n52 -64 61 81", "output": "2" }, { "input": "-81 99 20 40\n-3 99 38 99", "output": "1" }, { "input": "-54 25 20 40\n6 25 20 100", "output": "2" }, { "input": "-22 40 20 40\n36 40 18 100", "output": "2" }, { "input": "-71 15 20 40\n29 90 85 100", "output": "2" }, { "input": "31 -13 20 40\n69 -5 1 56", "output": "0" }, { "input": "-46 55 20 40\n-17 55 7 11", "output": "1" }, { "input": "-35 25 20 40\n-6 32 7 10", "output": "1" }, { "input": "27 -98 20 40\n65 -98 1 58", "output": "0" }, { "input": "-100 -19 20 40\n-62 -19 1 18", "output": "1" }, { "input": "48 66 20 40\n78 66 9 10", "output": "2" }, { "input": "-37 -22 20 40\n-8 -22 8 9", "output": "2" }, { "input": "-42 41 20 40\n-4 49 1 78", "output": "0" }, { "input": "-2 -27 20 40\n35 -27 1 77", "output": "1" }, { "input": "-28 -36 20 40\n10 -28 1 100", "output": "1" }, { "input": "-17 31 20 40\n21 39 1 14", "output": "1" }, { "input": "1 44 20 40\n39 44 1 2", "output": "2" }, { "input": "21 -99 20 40\n58 -97 1 2", "output": "2" }, { "input": "-86 -97 20 40\n14 -31 79 100", "output": "1" }, { "input": "-33 42 20 40\n47 42 39 100", "output": "1" }, { "input": "-79 45 20 40\n21 45 57 80", "output": "2" }, { "input": "-99 -66 20 40\n-20 -54 39 100", "output": "1" }, { "input": "39 -44 20 40\n99 -44 17 100", "output": "2" }, { "input": "10 86 20 40\n69 96 19 100", "output": "2" }, { "input": "-72 -4 20 40\n28 93 99 100", "output": "2" }, { "input": "-81 -55 20 40\n19 20 83 85", "output": "4" }, { "input": "-65 -34 20 40\n35 66 99 100", "output": "4" }, { "input": "-91 -46 10 50\n-73 -40 30 31", "output": "2" } ]
1,593,323,644
2,147,483,647
Python 3
OK
TESTS
140
218
6,963,200
def okay(xc, yc, rc, xr, yr, rr, Rr): d = ((xc-xr) ** 2 + (yc-yr) ** 2) ** 0.5 if d + rc <= rr: return True if d >= rc + Rr: return True if d + Rr <= rc: return True return False x1, y1, r1, R1 = map(float, input().split()) x2, y2, r2, R2 = map(float, input().split()) ans = 0 if okay(x2, y2, r2, x1, y1, r1, R1): ans += 1 if okay(x2, y2, R2, x1, y1, r1, R1): ans += 1 if okay(x1, y1, r1, x2, y2, r2, R2): ans += 1 if okay(x1, y1, R1, x2, y2, r2, R2): ans += 1 print (ans)
Title: Special Olympics Time Limit: None seconds Memory Limit: None megabytes Problem Description: A renowned abstract artist Sasha, drawing inspiration from nowhere, decided to paint a picture entitled "Special Olympics". He justly thought that, if the regular Olympic games have five rings, then the Special ones will do with exactly two rings just fine. Let us remind you that a ring is a region located between two concentric circles with radii *r* and *R* (*r*<=&lt;<=*R*). These radii are called internal and external, respectively. Concentric circles are circles with centers located at the same point. Soon a white canvas, which can be considered as an infinite Cartesian plane, had two perfect rings, painted with solid black paint. As Sasha is very impulsive, the rings could have different radii and sizes, they intersect and overlap with each other in any way. We know only one thing for sure: the centers of the pair of rings are not the same. When Sasha got tired and fell into a deep sleep, a girl called Ilona came into the room and wanted to cut a circle for the sake of good memories. To make the circle beautiful, she decided to cut along the contour. We'll consider a contour to be a continuous closed line through which there is transition from one color to another (see notes for clarification). If the contour takes the form of a circle, then the result will be cutting out a circle, which Iona wants. But the girl's inquisitive mathematical mind does not rest: how many ways are there to cut a circle out of the canvas? Input Specification: The input contains two lines. Each line has four space-separated integers *x**i*, *y**i*, *r**i*, *R**i*, that describe the *i*-th ring; *x**i* and *y**i* are coordinates of the ring's center, *r**i* and *R**i* are the internal and external radii of the ring correspondingly (<=-<=100<=≤<=*x**i*,<=*y**i*<=≤<=100; 1<=≤<=*r**i*<=&lt;<=*R**i*<=≤<=100). It is guaranteed that the centers of the rings do not coinside. Output Specification: A single integer — the number of ways to cut out a circle from the canvas. Demo Input: ['60 60 45 55\n80 80 8 32\n', '60 60 45 55\n80 60 15 25\n', '50 50 35 45\n90 50 35 45\n'] Demo Output: ['1', '4', '0'] Note: Figures for test samples are given below. The possible cuts are marked with red dotted line.
```python def okay(xc, yc, rc, xr, yr, rr, Rr): d = ((xc-xr) ** 2 + (yc-yr) ** 2) ** 0.5 if d + rc <= rr: return True if d >= rc + Rr: return True if d + Rr <= rc: return True return False x1, y1, r1, R1 = map(float, input().split()) x2, y2, r2, R2 = map(float, input().split()) ans = 0 if okay(x2, y2, r2, x1, y1, r1, R1): ans += 1 if okay(x2, y2, R2, x1, y1, r1, R1): ans += 1 if okay(x1, y1, r1, x2, y2, r2, R2): ans += 1 if okay(x1, y1, R1, x2, y2, r2, R2): ans += 1 print (ans) ```
3
312
A
Whose sentence is it?
PROGRAMMING
1,100
[ "implementation", "strings" ]
null
null
One day, liouzhou_101 got a chat record of Freda and Rainbow. Out of curiosity, he wanted to know which sentences were said by Freda, and which were said by Rainbow. According to his experience, he thought that Freda always said "lala." at the end of her sentences, while Rainbow always said "miao." at the beginning of his sentences. For each sentence in the chat record, help liouzhou_101 find whose sentence it is.
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=10), number of sentences in the chat record. Each of the next *n* lines contains a sentence. A sentence is a string that contains only Latin letters (A-Z, a-z), underline (_), comma (,), point (.) and space ( ). Its length doesn’t exceed 100.
For each sentence, output "Freda's" if the sentence was said by Freda, "Rainbow's" if the sentence was said by Rainbow, or "OMG&gt;.&lt; I don't know!" if liouzhou_101 can’t recognize whose sentence it is. He can’t recognize a sentence if it begins with "miao." and ends with "lala.", or satisfies neither of the conditions.
[ "5\nI will go to play with you lala.\nwow, welcome.\nmiao.lala.\nmiao.\nmiao .\n" ]
[ "Freda's\nOMG&gt;.&lt; I don't know!\nOMG&gt;.&lt; I don't know!\nRainbow's\nOMG&gt;.&lt; I don't know!\n" ]
none
500
[ { "input": "5\nI will go to play with you lala.\nwow, welcome.\nmiao.lala.\nmiao.\nmiao .", "output": "Freda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!" }, { "input": "10\nLpAEKiHVJrzSZqBVSSyY\nYECGBlala.\nUZeGpeM.UCwiHmmA\nqt_,.b_.LSwJtJ.\nFAnXZtHlala.\nmiao.iapelala.\nCFPlbUgObrXLejPNu.F\nZSUfvisiHyrIMjMlala.\nmiao. lala.\nd,IWSeumytrVlala.", "output": "OMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nFreda's" }, { "input": "10\nmiao.,taUvXPVlala.\nmiao.txEeId.X_lala.\nLZIeAEd JaeBVlala.\ncKPIsWpwIlala.\nfYp.eSvn,g\nKMx,nFEslala.\nmiao.QtMyxYqiajjuM\nDutxNkCqywgcnCYskcd\ngFLKACjeqfD\n,Ss UmY.wJvcX", "output": "OMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nFreda's\nOMG>.< I don't know!\nFreda's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nmiao.Plala.\nDVm,VYslala.\nmiao.rlala.\nmiao.,KQNL.fO_.QRc\nUBLCKEUePlala.\nIouS.Alala.\nmiao.lala.\nmiao.rlala.\nEJZwRJeKlala.\nmiao.Olala.", "output": "OMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nRainbow's\nFreda's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!" }, { "input": "10\nmiao.grFTpju.jCLRnZ\ng.pVHYA_Usnm\nlloWONolcMFElala.\nAW,n.JJkOTe.Nd\n.bP.HvKlala.\nGziqPGQa,lala.\nmiao.,QkOCH.vFlala.\n.PUtOwImvUsoeh \nmiao.Z,KIds.R\nmiao.,_MDzoaAiJlala.", "output": "Rainbow's\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nFreda's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!" }, { "input": "10\nmiao.xWfjV\nHFVrGCDQXyZ,Sbm\nLMDS.xVkTCAY.vm\nmiao.lLBglala.\nnl,jRPyClala.\nFYnHoXlala.\nmiao. oxaHE\n.WTrw_mNpOQCa\nHOk..wHYoyMhl\nQX,XpMuPIROM", "output": "Rainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nFreda's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nJBQqiXlala.\npUNUWQRiMPCXv\nAiLnfNHWznwkC.lala.\nmiao.Dl_Oy\nxJJJkVkdfOzQBH_SmKh\nfgD_IHvdHiorE,W\nmiao.usBKixglala.\nwCpqPUzEtD\nmiao.rlala.\nmiao.JylcGvWlala.", "output": "Freda's\nOMG>.< I don't know!\nFreda's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nmiao..FLhPl_Wjslala.\nmiao. tdEGtfdJlala.\nGAzEUlala.\nKCcmOa .aKBlZyYsdu.V\nmiao.lala.\njKylnM,FXK\nmiao.GBWqjGH.v\nmiao.RefxS Cni.\nOxaaEihuHQR_s,\nmiao.a,Axtlala.", "output": "OMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nNo.I_aTXlala.\nmiao.JKSCoRZS\nnOBMIlala.\nmiao.nlala.\nmiao._xqxoHIIlala.\nmiao.NJPy SWyiUDWc\nmiao.cCnahFaqqj.Xqp\nnreSMDeXPPYAQxI,W\nAktPajWimdd_qRn\nmiao.QHwKCYlala.", "output": "Freda's\nRainbow's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\n \n,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ \n \nmiao.miao.miao.\nlala.lala.lala.\nlala.miao.\nmiaolala. \nmiao.lala\nmiaolala_\n,.._ abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ", "output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nduClyjMIPsEuWmx_Ce.byVoizYlTM,sF\nuZHsNip_,Mwtg,FZjM_LzPC,_pSvEOyTHfAOvoZXvxCZdgYDTCDdCAoSVZWyxXGcLgWlala.\nEGtJFPAvTEcqjkhaGxdduaQ_rmUzF.WaU, EIuX B,aVzFFpFrxpwADXuayRD azDfj \n_tJqYzXyqc.,u.F,mUYukveBPWnPq,f,dJnPHuBazdnbRHfzwNUdRbheAIjcoaPcnLvocrzcioxCapb R\n.YUBeb_zmwUt.QQuUdQIiOXtqshcsycEe,HLytHlala.\ndJndLqGBHt.GfpN.BgvsbXoLh_DIzAJOtFDmLSCYEztvPcS_GHPxivzV,NPMmSAtfk.Mg.w,A UcCt_lCD.csEzyJJBYtSMkzqiA\nmiao.qlala.\nmiao.FmDlY\nmiao.UQI.aJmnanNvRLskuVaMybDMsOlala.\nmiao.lala.", "output": "OMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nmiao.vyscfysAtWcPkpFHdwZqAQ,UPPcjhKQTlala.\nmiao.KESqus DybUuYFoWVpo..LWZh.UqEdUsTHFlKfzqkThAUPklala.\nUNoE vfZIAdxkiWKhsHPfsqRPTNQoHgAxooVLYxRzugHjo jaEHWQFF\nCCmdIwr.UkoiYWK.Z,,ZesMpISTXNgnpYnJaWquCyL,gO\n.JvOayhXK_bgoYbfAtnXg\nbvdSzRrXoGxVgWvdXnsjEnEfxDzIQo_aZVGDGrzwuAMtzVAHioMBx_DHuTxyieGbGuSRNUojOREqxBBxvCgqAOMzwIWT\nMBuaWduZmRaOGyIPzWOsBVeqtDrblAbXxmM_uRfqMvnVlLEuhVKlhidN_aigiXyq,ZEDqQAx\nmiao.wCHVCuVKNePKmIUFLL_lala.\nmiao.iAqstXHUv\n pMO yvPkNtnNwmUCao W,wW.OvIMVaEeVYHmqaniWq.ivlala.", "output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nFreda's" }, { "input": "10\nmiao.\nmiao.jrwLBCpNaDCjyoK.PFzbwWU.h.. wfQquG_P..lala.\nmiao.LGlYdKjw__.Chlala.\nW.wtr qG KDOHj.xWxPbXIXjD_,GJZDaAZ,JBHphsjWJwSKcZAIAi\nmiao.pHsGAZQDWPJQwKC.zHjJituLgp.eUrzObTI.wrpect.FMUJqu,Zuslala.\nmiao.YVlOpXccUA_YU igbsbZbhOVwyYTyOjnWqgiTmxwAuFa.flCHn.,MtVbqxZQl_BGHXWkwijGjuL, ,ezyNlala.\nmiao.xCrVSz.aMv UOSOroDlQxWeBmlWe.FA.ZfUmviMlala.\nxebAlala.\nmiao.qVSxqf vOTlala.\nD.oBUwsLQRgXAoNkQJhQN.w.oMhuvtujnmiwgQYMfjlNTSHh .lSKgI.OEp", "output": "Rainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nZXXzYlTiQU\nkXE.DdcbOojSaSgjMcFBPubKHefEVAzbi,PDFgSZIz,lala.\nxEfrTCjKhhwBC.UNmJXgTGUdkQeVDlala.\nLfaEw.jvMmuOBWtfoiJNtDIlQAVWNU,xWK_efBBtfkM\nqtBpqKZMWZMX_NKrUAEKYyQcLZWQlqbM\nmiao.PrJEbUtInremuaKRItqXOrfQEjQcAak VQ\nMpGCq awvQaHRvDr uvtVMKsvZI\nmiao.A.RVGu.szCEp.pXQJwL EuTltlN.WradoTvWHJyhcNSoulala.\nmiao.rzlUHzUdxtDRpWRuc,QZwEBfsKKGHMLGtFymPPQdptLFlzZ_ORWqrlfOrlntuDkpXEvz.CxwAsFYUvpnOnFWG\nmiao.VXUoNBwlgBwcna_n.CgAAcKKUuiVA.doOJKHpMdwNwlHAcLpdfN.Awa SthrlEWpUcuOonUTxIQNszYcHDXxnhArrM..A", "output": "OMG>.< I don't know!\nFreda's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's" }, { "input": "10\nmiao.qbxBFzrjtWv.yOk\nDBgi,loApO AACrGnwssCHN\nmiao.LV.wbQEE_V.BSAtdTIHTQOJVJ_nGOthbL,nJvQ.UeWFpsa.GGsK_Uv,HQxHS,AN_bkrolala.\nmiao.tBEqk rIQuByGKhfq_iP.BW,nySZEfrfySEcqnnIzxC,lrjIiivbxlkoVXJFiegGFRn NO,txGPhVBcv.CVhMmNO zlala.\nmiao.aBZWDWxk.wkR ,NyCzGxJnJDqBZpetdUPAmmBZDXl_Tbflala.\nmiao. XN,uMwWm. VqloYr..jTLszlala.\n.rshcgfZ.eZOdMu_RMh\nmiao.ahiwpECEe.lala.\nLeoUSroTekQAMSO__M L_ZEeRD_tUihYvQETFB,RzJmFtFiKrU\nBtygQG_OoFEFBL.KsVWTYbtqtalXoStFCZ RINHda.NuLmlkRB.vAQJFvelbsfoJ.T,M sJn", "output": "Rainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nYoYBCcaqhXLfvKKf.UYMODTHyPZlala.\ncxgWn J.Q\nmiao.nwH.IHntgKYDhdsjU DMTHXEVRyeJP ZaAecCIBJXuv.YjhEmtbjvjKnK.U,oc,x\nmiao.EcQ.FDtRJgmpAzxhq.RwXBLxjyC,IeMqaFoheMPFCGWBcwUAFnbiwlbz_fcsEGPfJaeryCtFocBNEWTlala.\nmiao.W\nmiao. ZQpIeyCXJSnFgAIzu.THfrmyoogYWQzFqblala.\nmiao.ifzdCwnTDcxpvdr OTC.YqPv.MKDp..utICtAsbfYyGlala.\nmiao.\nmiao.tS.U.wH.s,CxORZJsBAHLi,fXeoDJWVBH\nrcUMpeupOVRKrcIRAvU.rP kgUEfoeXcrFPQOBYG.BNvAQPg.XHMWizhLpZNljXc .LQmVXCi", "output": "Freda's\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!" }, { "input": "10\nlala.\nmiao.milalala.lmmialamiao.la.o.iao.a.ao.\nmialala.o.\nmiao.millala.allala.amiao..miao.miao.lala.ao.miammiao.iao.o.\nmiao.miaomiao..\nlalmiao.amiao..\nmiao.lala.lamiamiaolala..o.lalala.miao..\nmlala.iao.lalamiao..\nlmlala.iao.alalamiao.lmialala.lala.miao.o.alala..lala..lalmiaomiao..lalmiao.a.lalamiao..miao.alala..\nlalllamiao.la.lala.alamiao.lalalala.lala..miao.lamiao.la.lallalamiao..a..a.", "output": "Freda's\nRainbow's\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nlalllala.ala.lala.a.mmimiao.aomiao.lllala.ala.amiao.la.mialalala.la.o..imiao.miao.amlala.iao.o.\nmilala.alllala.ala.amiao.lamiao..o.\nlala.lalalala..lalalala..\nlala.miao.\nmimiao.ao.lala.\nlalmiao.amlala.iamialala.o.o..\nlalammlala.iaolammiao.imiao.ao.la..iao..\nmiao.mialala.omiao..mlala.iaolala..\nmiamiao.o.llallala.ala.la.miao.ala.miao.mimialmiao.ala.o.alala.miaomiao..olala..\nmialala.lamiao.la.lala.miao.ollala.allala.ala.lmiaommiao.imiao.ao.lallallala.a.miao.a..a..", "output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nlamiao.lamiao.mimiao.ao..\nllala.almiaomiao..lala.miao.a.\nlalala.lala.lalala.lala.lalala..la.\nlalala.la.miao.\nmiao.llalallala.miao.a.la.lala.almimiao.ao.a.\nmiao.mlala.ilala.aomilala.ao..\nmilala.ao.\nmmiao.iao.\nmlala.lala.ialalmiao.alala..olala.lala..\nlala.lmlalalalalala...iao.milala.aommiao.iao..alamiaolallala.milala.ao.a..lalalmiao.a..llala.amiao..", "output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "4\n \n miao. \n lala. \n ", "output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "1\nMiao.", "output": "OMG>.< I don't know!" }, { "input": "1\nm", "output": "OMG>.< I don't know!" }, { "input": "1\nMiAo.sdsdlala.", "output": "Freda's" }, { "input": "1\nLalA.", "output": "OMG>.< I don't know!" }, { "input": "3\n.\nm\nl", "output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" } ]
1,639,996,479
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
30
0
n=int(input()) for i in range(n): s=input() a=s.split(' ') ans=0 if(a[0]=='miao.'): ans+=1 if(a[-1]=='lala.'): ans+=2 if(ans==1): print("Rainbow's") elif(ans==2): print("Freda's") else: print("OMG>.< I don't know!")
Title: Whose sentence is it? Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day, liouzhou_101 got a chat record of Freda and Rainbow. Out of curiosity, he wanted to know which sentences were said by Freda, and which were said by Rainbow. According to his experience, he thought that Freda always said "lala." at the end of her sentences, while Rainbow always said "miao." at the beginning of his sentences. For each sentence in the chat record, help liouzhou_101 find whose sentence it is. Input Specification: The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=10), number of sentences in the chat record. Each of the next *n* lines contains a sentence. A sentence is a string that contains only Latin letters (A-Z, a-z), underline (_), comma (,), point (.) and space ( ). Its length doesn’t exceed 100. Output Specification: For each sentence, output "Freda's" if the sentence was said by Freda, "Rainbow's" if the sentence was said by Rainbow, or "OMG&gt;.&lt; I don't know!" if liouzhou_101 can’t recognize whose sentence it is. He can’t recognize a sentence if it begins with "miao." and ends with "lala.", or satisfies neither of the conditions. Demo Input: ['5\nI will go to play with you lala.\nwow, welcome.\nmiao.lala.\nmiao.\nmiao .\n'] Demo Output: ["Freda's\nOMG&gt;.&lt; I don't know!\nOMG&gt;.&lt; I don't know!\nRainbow's\nOMG&gt;.&lt; I don't know!\n"] Note: none
```python n=int(input()) for i in range(n): s=input() a=s.split(' ') ans=0 if(a[0]=='miao.'): ans+=1 if(a[-1]=='lala.'): ans+=2 if(ans==1): print("Rainbow's") elif(ans==2): print("Freda's") else: print("OMG>.< I don't know!") ```
0
258
A
Little Elephant and Bits
PROGRAMMING
1,100
[ "greedy", "math" ]
null
null
The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper. To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes). The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation.
The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits.
In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem.
[ "101\n", "110010\n" ]
[ "11\n", "11010\n" ]
In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>. In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>.
500
[ { "input": "101", "output": "11" }, { "input": "110010", "output": "11010" }, { "input": "10000", "output": "1000" }, { "input": "1111111110", "output": "111111111" }, { "input": "10100101011110101", "output": "1100101011110101" }, { "input": "111010010111", "output": "11110010111" }, { "input": "11110111011100000000", "output": "1111111011100000000" }, { "input": "11110010010100001110110101110011110110100111101", "output": "1111010010100001110110101110011110110100111101" }, { "input": "1001011111010010100111111", "output": "101011111010010100111111" }, { "input": "1111111111", "output": "111111111" }, { "input": "1111111111111111111100111101001110110111111000001111110101001101001110011000001011001111111000110101", "output": "111111111111111111110111101001110110111111000001111110101001101001110011000001011001111111000110101" }, { "input": "11010110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100", "output": "1110110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100" }, { "input": "11111111111111111111111110110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011", "output": "1111111111111111111111111110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011" }, { "input": "11100010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011", "output": "1110010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011" }, { "input": "11", "output": "1" }, { "input": "111", "output": "11" }, { "input": "111111", "output": "11111" }, { "input": "11111", "output": "1111" }, { "input": "1111", "output": "111" } ]
1,621,706,426
2,147,483,647
Python 3
OK
TESTS
37
124
102,400
s=input() flag=False for z in range(len(s)): if s[z]=='0': s=s[:z]+s[z+1:] flag=True break if flag: print(s) else: print(s[1:])
Title: Little Elephant and Bits Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper. To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes). The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation. Input Specification: The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits. Output Specification: In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem. Demo Input: ['101\n', '110010\n'] Demo Output: ['11\n', '11010\n'] Note: In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>. In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>.
```python s=input() flag=False for z in range(len(s)): if s[z]=='0': s=s[:z]+s[z+1:] flag=True break if flag: print(s) else: print(s[1:]) ```
3
182
D
Common Divisors
PROGRAMMING
1,400
[ "brute force", "hashing", "implementation", "math", "strings" ]
null
null
Vasya has recently learned at school what a number's divisor is and decided to determine a string's divisor. Here is what he came up with. String *a* is the divisor of string *b* if and only if there exists a positive integer *x* such that if we write out string *a* consecutively *x* times, we get string *b*. For example, string "abab" has two divisors — "ab" and "abab". Now Vasya wants to write a program that calculates the number of common divisors of two strings. Please help him.
The first input line contains a non-empty string *s*1. The second input line contains a non-empty string *s*2. Lengths of strings *s*1 and *s*2 are positive and do not exceed 105. The strings only consist of lowercase Latin letters.
Print the number of common divisors of strings *s*1 and *s*2.
[ "abcdabcd\nabcdabcdabcdabcd\n", "aaa\naa\n" ]
[ "2\n", "1\n" ]
In first sample the common divisors are strings "abcd" and "abcdabcd". In the second sample the common divisor is a single string "a". String "aa" isn't included in the answer as it isn't a divisor of string "aaa".
1,000
[ { "input": "abcdabcd\nabcdabcdabcdabcd", "output": "2" }, { "input": "aaa\naa", "output": "1" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaa\naaaaaaaaaaaaaaaaaaaaaaaaa", "output": "3" }, { "input": "aaaaaaaaaaaaaa\naaaaaaaaaaaaaa", "output": "4" }, { "input": "a\nb", "output": "0" }, { "input": "a\na", "output": "1" }, { "input": "ab\nac", "output": "0" }, { "input": "asdkjjaskldjklasjdhasjdasdas\nasdjahsgdjslkdaygsudhasdkasnjdbayusvduasdklmaklsd", "output": "0" }, { "input": "aaa\naaaaab", "output": "0" }, { "input": "ab\naa", "output": "0" }, { "input": "aa\naac", "output": "0" }, { "input": "aba\nabaaba", "output": "1" }, { "input": "aa\nbb", "output": "0" }, { "input": "abababab\ncdcdcdcd", "output": "0" }, { "input": "ab\nab", "output": "1" }, { "input": "abcabcabc\nertert", "output": "0" }, { "input": "aaaa\nbbbb", "output": "0" }, { "input": "abc\ncde", "output": "0" }, { "input": "abc\nabcabcab", "output": "0" }, { "input": "aba\naaa", "output": "0" }, { "input": "abcabc\nabdabdabd", "output": "0" }, { "input": "aaaaaa\naaaaaaaaa", "output": "2" }, { "input": "aaa\nbbb", "output": "0" } ]
1,552,737,497
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
47
312
7,884,800
s1, s2 = input(), input() L1, L2 = len(s1), len(s2) D = set() for d in range(1, int(L1 * .5) + 1): if L1 % d == 0: D |= {d, L1 // d} S = [s1[:d] for d in D if s1[:d] * (L1//d) == s1] print(sum(s * (L2//len(s)) == s2 for s in S))
Title: Common Divisors Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya has recently learned at school what a number's divisor is and decided to determine a string's divisor. Here is what he came up with. String *a* is the divisor of string *b* if and only if there exists a positive integer *x* such that if we write out string *a* consecutively *x* times, we get string *b*. For example, string "abab" has two divisors — "ab" and "abab". Now Vasya wants to write a program that calculates the number of common divisors of two strings. Please help him. Input Specification: The first input line contains a non-empty string *s*1. The second input line contains a non-empty string *s*2. Lengths of strings *s*1 and *s*2 are positive and do not exceed 105. The strings only consist of lowercase Latin letters. Output Specification: Print the number of common divisors of strings *s*1 and *s*2. Demo Input: ['abcdabcd\nabcdabcdabcdabcd\n', 'aaa\naa\n'] Demo Output: ['2\n', '1\n'] Note: In first sample the common divisors are strings "abcd" and "abcdabcd". In the second sample the common divisor is a single string "a". String "aa" isn't included in the answer as it isn't a divisor of string "aaa".
```python s1, s2 = input(), input() L1, L2 = len(s1), len(s2) D = set() for d in range(1, int(L1 * .5) + 1): if L1 % d == 0: D |= {d, L1 // d} S = [s1[:d] for d in D if s1[:d] * (L1//d) == s1] print(sum(s * (L2//len(s)) == s2 for s in S)) ```
0
331
C1
The Great Julya Calendar
PROGRAMMING
1,100
[ "dp" ]
null
null
Yet another Armageddon is coming! This time the culprit is the Julya tribe calendar. The beavers in this tribe knew math very well. Smart Beaver, an archaeologist, got a sacred plate with a magic integer on it. The translation from Old Beaverish is as follows: "May the Great Beaver bless you! May your chacres open and may your third eye never turn blind from beholding the Truth! Take the magic number, subtract a digit from it (the digit must occur in the number) and get a new magic number. Repeat this operation until a magic number equals zero. The Earth will stand on Three Beavers for the time, equal to the number of subtractions you perform!" Distinct subtraction sequences can obviously get you different number of operations. But the Smart Beaver is ready to face the worst and is asking you to count the minimum number of operations he needs to reduce the magic number to zero.
The single line contains the magic integer *n*, 0<=≤<=*n*. - to get 20 points, you need to solve the problem with constraints: *n*<=≤<=106 (subproblem C1); - to get 40 points, you need to solve the problem with constraints: *n*<=≤<=1012 (subproblems C1+C2); - to get 100 points, you need to solve the problem with constraints: *n*<=≤<=1018 (subproblems C1+C2+C3).
Print a single integer — the minimum number of subtractions that turns the magic number to a zero.
[ "24\n" ]
[ "5" ]
In the first test sample the minimum number of operations can be reached by the following sequence of subtractions:
20
[ { "input": "24", "output": "5" }, { "input": "0", "output": "0" }, { "input": "3", "output": "1" }, { "input": "8", "output": "1" }, { "input": "9", "output": "1" }, { "input": "10", "output": "2" }, { "input": "31", "output": "6" }, { "input": "701", "output": "116" }, { "input": "222", "output": "39" }, { "input": "156", "output": "28" }, { "input": "12343", "output": "1778" }, { "input": "7984", "output": "1178" }, { "input": "1000000", "output": "128207" }, { "input": "1", "output": "1" }, { "input": "3", "output": "1" }, { "input": "5", "output": "1" }, { "input": "11", "output": "3" }, { "input": "77", "output": "14" }, { "input": "216", "output": "37" }, { "input": "1468", "output": "233" }, { "input": "1995", "output": "305" }, { "input": "11010", "output": "1568" }, { "input": "47320", "output": "6746" }, { "input": "258634", "output": "35024" } ]
1,580,361,228
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS1
7
248
0
#Ashish Sagar n=input() s=list(n) if n!='0': for i in range(len(s)): s[i]=int(s[i]) if max(s)>(s[-1]): s[-1]=0 else: s[-1]=5 z="" for i in range(len(s)): z+=str(s[i]) z=int(z) print(z//5) else: print(0)
Title: The Great Julya Calendar Time Limit: None seconds Memory Limit: None megabytes Problem Description: Yet another Armageddon is coming! This time the culprit is the Julya tribe calendar. The beavers in this tribe knew math very well. Smart Beaver, an archaeologist, got a sacred plate with a magic integer on it. The translation from Old Beaverish is as follows: "May the Great Beaver bless you! May your chacres open and may your third eye never turn blind from beholding the Truth! Take the magic number, subtract a digit from it (the digit must occur in the number) and get a new magic number. Repeat this operation until a magic number equals zero. The Earth will stand on Three Beavers for the time, equal to the number of subtractions you perform!" Distinct subtraction sequences can obviously get you different number of operations. But the Smart Beaver is ready to face the worst and is asking you to count the minimum number of operations he needs to reduce the magic number to zero. Input Specification: The single line contains the magic integer *n*, 0<=≤<=*n*. - to get 20 points, you need to solve the problem with constraints: *n*<=≤<=106 (subproblem C1); - to get 40 points, you need to solve the problem with constraints: *n*<=≤<=1012 (subproblems C1+C2); - to get 100 points, you need to solve the problem with constraints: *n*<=≤<=1018 (subproblems C1+C2+C3). Output Specification: Print a single integer — the minimum number of subtractions that turns the magic number to a zero. Demo Input: ['24\n'] Demo Output: ['5'] Note: In the first test sample the minimum number of operations can be reached by the following sequence of subtractions:
```python #Ashish Sagar n=input() s=list(n) if n!='0': for i in range(len(s)): s[i]=int(s[i]) if max(s)>(s[-1]): s[-1]=0 else: s[-1]=5 z="" for i in range(len(s)): z+=str(s[i]) z=int(z) print(z//5) else: print(0) ```
0
696
C
PLEASE
PROGRAMMING
2,000
[ "combinatorics", "dp", "implementation", "math", "matrices" ]
null
null
As we all know Barney's job is "PLEASE" and he has not much to do at work. That's why he started playing "cups and key". In this game there are three identical cups arranged in a line from left to right. Initially key to Barney's heart is under the middle cup. Then at one turn Barney swaps the cup in the middle with any of other two cups randomly (he choses each with equal probability), so the chosen cup becomes the middle one. Game lasts *n* turns and Barney independently choses a cup to swap with the middle one within each turn, and the key always remains in the cup it was at the start. After *n*-th turn Barney asks a girl to guess which cup contains the key. The girl points to the middle one but Barney was distracted while making turns and doesn't know if the key is under the middle cup. That's why he asked you to tell him the probability that girl guessed right. Number *n* of game turns can be extremely large, that's why Barney did not give it to you. Instead he gave you an array *a*1,<=*a*2,<=...,<=*a**k* such that in other words, *n* is multiplication of all elements of the given array. Because of precision difficulties, Barney asked you to tell him the answer as an irreducible fraction. In other words you need to find it as a fraction *p*<=/<=*q* such that , where is the greatest common divisor. Since *p* and *q* can be extremely large, you only need to find the remainders of dividing each of them by 109<=+<=7. Please note that we want of *p* and *q* to be 1, not of their remainders after dividing by 109<=+<=7.
The first line of input contains a single integer *k* (1<=≤<=*k*<=≤<=105) — the number of elements in array Barney gave you. The second line contains *k* integers *a*1,<=*a*2,<=...,<=*a**k* (1<=≤<=*a**i*<=≤<=1018) — the elements of the array.
In the only line of output print a single string *x*<=/<=*y* where *x* is the remainder of dividing *p* by 109<=+<=7 and *y* is the remainder of dividing *q* by 109<=+<=7.
[ "1\n2\n", "3\n1 1 1\n" ]
[ "1/2\n", "0/1\n" ]
none
1,500
[ { "input": "1\n2", "output": "1/2" }, { "input": "3\n1 1 1", "output": "0/1" }, { "input": "1\n983155795040951739", "output": "145599903/436799710" }, { "input": "2\n467131402341701583 956277077729692725", "output": "63467752/190403257" }, { "input": "10\n217673221404542171 806579927281665969 500754531396239406 214319484250163112 328494187336342674 427465830578952934 951554014286436941 664022909283791499 653206814724654845 66704816231807388", "output": "896298678/688896019" }, { "input": "8\n137264686188377169 524477139880847337 939966121107073137 244138018261712937 158070587508987781 35608416591331673 378899027510195451 81986819972451999", "output": "993002178/979006521" }, { "input": "9\n174496219779575399 193634487267697117 972518022554199573 695317701399937273 464007855398119159 881020180696239657 296973121744507377 544232692627163469 751214074246742731", "output": "149736910/449210731" }, { "input": "12\n254904759290707697 475737283258450340 533306428548398547 442127134828578937 779740159015946254 272877594683860919 93000149670491971 349640818793278778 498293278222136720 551099726729989816 149940343283925029 989425634209891686", "output": "674872752/24618241" }, { "input": "1\n1", "output": "0/1" }, { "input": "1\n1000000000000000000", "output": "453246046/359738130" }, { "input": "1\n3", "output": "1/4" }, { "input": "1\n1000000006", "output": "500000004/500000004" }, { "input": "2\n500000004 1000000006", "output": "500000004/500000004" }, { "input": "1\n500000004", "output": "666666672/1" }, { "input": "2\n500000004 500000004", "output": "666666672/1" }, { "input": "1\n500000003", "output": "833333339/500000004" }, { "input": "2\n500000003 500000004", "output": "500000004/500000004" }, { "input": "2\n500000003 500000003", "output": "833333339/500000004" }, { "input": "1\n1000000005", "output": "750000005/250000002" }, { "input": "2\n1000000005 500000004", "output": "416666670/250000002" } ]
1,613,137,883
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
46
204,800
n = int(input()) ls = [int(x) for x in input().split(' ')] t = 1 mod = 1000000007 def qpow(n: int, m: int): m %= mod - 1 ans = 1 while m: if m & 1: ans = ans * n % mod n = n * n % mod m >>= 1 return ans k = 0 for x in ls: t = t * x % (mod * 2 - 2) if x % 2 == 0: k = 1 t = (t - 1 + mod) % mod fz = (qpow(4, t >> 1) - 1) * qpow(3, mod - 2) % mod if k == 1: fz = (fz * 2 + 1) % mod fm = qpow(2, t) print('{}/{}'.format(fz, fm))
Title: PLEASE Time Limit: None seconds Memory Limit: None megabytes Problem Description: As we all know Barney's job is "PLEASE" and he has not much to do at work. That's why he started playing "cups and key". In this game there are three identical cups arranged in a line from left to right. Initially key to Barney's heart is under the middle cup. Then at one turn Barney swaps the cup in the middle with any of other two cups randomly (he choses each with equal probability), so the chosen cup becomes the middle one. Game lasts *n* turns and Barney independently choses a cup to swap with the middle one within each turn, and the key always remains in the cup it was at the start. After *n*-th turn Barney asks a girl to guess which cup contains the key. The girl points to the middle one but Barney was distracted while making turns and doesn't know if the key is under the middle cup. That's why he asked you to tell him the probability that girl guessed right. Number *n* of game turns can be extremely large, that's why Barney did not give it to you. Instead he gave you an array *a*1,<=*a*2,<=...,<=*a**k* such that in other words, *n* is multiplication of all elements of the given array. Because of precision difficulties, Barney asked you to tell him the answer as an irreducible fraction. In other words you need to find it as a fraction *p*<=/<=*q* such that , where is the greatest common divisor. Since *p* and *q* can be extremely large, you only need to find the remainders of dividing each of them by 109<=+<=7. Please note that we want of *p* and *q* to be 1, not of their remainders after dividing by 109<=+<=7. Input Specification: The first line of input contains a single integer *k* (1<=≤<=*k*<=≤<=105) — the number of elements in array Barney gave you. The second line contains *k* integers *a*1,<=*a*2,<=...,<=*a**k* (1<=≤<=*a**i*<=≤<=1018) — the elements of the array. Output Specification: In the only line of output print a single string *x*<=/<=*y* where *x* is the remainder of dividing *p* by 109<=+<=7 and *y* is the remainder of dividing *q* by 109<=+<=7. Demo Input: ['1\n2\n', '3\n1 1 1\n'] Demo Output: ['1/2\n', '0/1\n'] Note: none
```python n = int(input()) ls = [int(x) for x in input().split(' ')] t = 1 mod = 1000000007 def qpow(n: int, m: int): m %= mod - 1 ans = 1 while m: if m & 1: ans = ans * n % mod n = n * n % mod m >>= 1 return ans k = 0 for x in ls: t = t * x % (mod * 2 - 2) if x % 2 == 0: k = 1 t = (t - 1 + mod) % mod fz = (qpow(4, t >> 1) - 1) * qpow(3, mod - 2) % mod if k == 1: fz = (fz * 2 + 1) % mod fm = qpow(2, t) print('{}/{}'.format(fz, fm)) ```
0
25
A
IQ test
PROGRAMMING
1,300
[ "brute force" ]
A. IQ test
2
256
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
[ "5\n2 4 7 8 10\n", "4\n1 2 1 1\n" ]
[ "3\n", "2\n" ]
none
0
[ { "input": "5\n2 4 7 8 10", "output": "3" }, { "input": "4\n1 2 1 1", "output": "2" }, { "input": "3\n1 2 2", "output": "1" }, { "input": "3\n100 99 100", "output": "2" }, { "input": "3\n5 3 2", "output": "3" }, { "input": "4\n43 28 1 91", "output": "2" }, { "input": "4\n75 13 94 77", "output": "3" }, { "input": "4\n97 8 27 3", "output": "2" }, { "input": "10\n95 51 12 91 85 3 1 31 25 7", "output": "3" }, { "input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46", "output": "4" }, { "input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36", "output": "26" }, { "input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83", "output": "48" }, { "input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25", "output": "1" }, { "input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46", "output": "25" }, { "input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73", "output": "13" }, { "input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76", "output": "99" }, { "input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14", "output": "1" }, { "input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22", "output": "93" }, { "input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23", "output": "1" }, { "input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98", "output": "1" }, { "input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94", "output": "93" }, { "input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29", "output": "32" }, { "input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47", "output": "26" }, { "input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72", "output": "56" }, { "input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86", "output": "97" }, { "input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42", "output": "79" }, { "input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52", "output": "25" }, { "input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86", "output": "78" }, { "input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68", "output": "70" }, { "input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81", "output": "39" }, { "input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83", "output": "88" }, { "input": "3\n100 100 1", "output": "3" } ]
1,634,028,541
2,147,483,647
Python 3
OK
TESTS
32
122
6,963,200
n=int(input()) lst=list(map(int,input().split())) ans=0 t=(lst[0]%2==0)+(lst[1]%2==0)+(lst[2]%2==0)<=1 for i in range(n): if t^(lst[i]%2==1): ans=i+1 break print(ans)
Title: IQ test Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness. Input Specification: The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness. Output Specification: Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order. Demo Input: ['5\n2 4 7 8 10\n', '4\n1 2 1 1\n'] Demo Output: ['3\n', '2\n'] Note: none
```python n=int(input()) lst=list(map(int,input().split())) ans=0 t=(lst[0]%2==0)+(lst[1]%2==0)+(lst[2]%2==0)<=1 for i in range(n): if t^(lst[i]%2==1): ans=i+1 break print(ans) ```
3.95653
1
A
Theatre Square
PROGRAMMING
1,000
[ "math" ]
A. Theatre Square
1
256
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Write the needed number of flagstones.
[ "6 6 4\n" ]
[ "4\n" ]
none
0
[ { "input": "6 6 4", "output": "4" }, { "input": "1 1 1", "output": "1" }, { "input": "2 1 1", "output": "2" }, { "input": "1 2 1", "output": "2" }, { "input": "2 2 1", "output": "4" }, { "input": "2 1 2", "output": "1" }, { "input": "1 1 3", "output": "1" }, { "input": "2 3 4", "output": "1" }, { "input": "1000000000 1000000000 1", "output": "1000000000000000000" }, { "input": "12 13 4", "output": "12" }, { "input": "222 332 5", "output": "3015" }, { "input": "1000 1000 10", "output": "10000" }, { "input": "1001 1000 10", "output": "10100" }, { "input": "100 10001 1000000000", "output": "1" }, { "input": "1000000000 1000000000 1000000000", "output": "1" }, { "input": "1000000000 1000000000 999999999", "output": "4" }, { "input": "1000000000 1000000000 192", "output": "27126743055556" }, { "input": "1000000000 987654321 1", "output": "987654321000000000" }, { "input": "456784567 1000000000 51", "output": "175618850864484" }, { "input": "39916800 134217728 40320", "output": "3295710" } ]
1,692,522,942
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
30
0
inputData = input() splitted = inputData.split() m = int(splitted[0]) n = int(splitted[1]) a = int(splitted[2]) countM=0 countN = 0 if n <=1: if a <= 10**9: while m>=0: m = m - a countM = countM + 1 while n>=0: n = n -a countN = countN +1 print(countM*countN) else: print('daun') else: print('loh')
Title: Theatre Square Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. Input Specification: The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). Output Specification: Write the needed number of flagstones. Demo Input: ['6 6 4\n'] Demo Output: ['4\n'] Note: none
```python inputData = input() splitted = inputData.split() m = int(splitted[0]) n = int(splitted[1]) a = int(splitted[2]) countM=0 countN = 0 if n <=1: if a <= 10**9: while m>=0: m = m - a countM = countM + 1 while n>=0: n = n -a countN = countN +1 print(countM*countN) else: print('daun') else: print('loh') ```
0
883
I
Photo Processing
PROGRAMMING
1,900
[ "binary search", "dp" ]
null
null
Evlampiy has found one more cool application to process photos. However the application has certain limitations. Each photo *i* has a contrast *v**i*. In order for the processing to be truly of high quality, the application must receive at least *k* photos with contrasts which differ as little as possible. Evlampiy already knows the contrast *v**i* for each of his *n* photos. Now he wants to split the photos into groups, so that each group contains at least *k* photos. As a result, each photo must belong to exactly one group. He considers a processing time of the *j*-th group to be the difference between the maximum and minimum values of *v**i* in the group. Because of multithreading the processing time of a division into groups is the maximum processing time among all groups. Split *n* photos into groups in a such way that the processing time of the division is the minimum possible, i.e. that the the maximum processing time over all groups as least as possible.
The first line contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=3·105) — number of photos and minimum size of a group. The second line contains *n* integers *v*1,<=*v*2,<=...,<=*v**n* (1<=≤<=*v**i*<=≤<=109), where *v**i* is the contrast of the *i*-th photo.
Print the minimal processing time of the division into groups.
[ "5 2\n50 110 130 40 120\n", "4 1\n2 3 4 1\n" ]
[ "20\n", "0\n" ]
In the first example the photos should be split into 2 groups: [40, 50] and [110, 120, 130]. The processing time of the first group is 10, and the processing time of the second group is 20. Maximum among 10 and 20 is 20. It is impossible to split the photos into groups in a such way that the processing time of division is less than 20. In the second example the photos should be split into four groups, each containing one photo. So the minimal possible processing time of a division is 0.
0
[ { "input": "5 2\n50 110 130 40 120", "output": "20" }, { "input": "4 1\n2 3 4 1", "output": "0" }, { "input": "1 1\n4", "output": "0" }, { "input": "2 2\n7 5", "output": "2" }, { "input": "3 2\n34 3 75", "output": "72" }, { "input": "5 2\n932 328 886 96 589", "output": "343" }, { "input": "10 4\n810 8527 9736 3143 2341 6029 7474 707 2513 2023", "output": "3707" }, { "input": "20 11\n924129 939902 178964 918687 720767 695035 577430 407131 213304 810868 596349 266075 123602 376312 36680 18426 716200 121546 61834 851586", "output": "921476" }, { "input": "100 28\n1 2 3 5 1 1 1 4 1 5 2 4 3 2 5 4 1 1 4 1 4 5 4 1 4 5 1 3 5 1 1 1 4 2 5 2 3 5 2 2 3 2 4 5 5 5 5 1 2 4 1 3 1 1 1 4 3 1 5 2 5 1 3 3 2 4 5 1 1 3 4 1 1 3 3 1 2 4 3 3 4 4 3 1 2 1 5 1 4 4 2 3 1 3 3 4 2 4 1 1", "output": "1" }, { "input": "101 9\n3 2 2 1 4 1 3 2 3 4 3 2 3 1 4 4 1 1 4 1 3 3 4 1 2 1 1 3 1 2 2 4 3 1 4 3 1 1 4 4 1 2 1 1 4 2 3 4 1 2 1 4 4 1 4 3 1 4 2 1 2 1 4 3 4 3 4 2 2 4 3 2 1 3 4 3 2 2 4 3 3 2 4 1 3 2 2 4 1 3 4 2 1 3 3 2 2 1 1 3 1", "output": "0" }, { "input": "2 2\n1 1000000000", "output": "999999999" }, { "input": "2 1\n1 1000000000", "output": "0" }, { "input": "11 3\n412 3306 3390 2290 1534 316 1080 2860 253 230 3166", "output": "1122" }, { "input": "10 3\n2414 294 184 666 2706 1999 2201 1270 904 653", "output": "707" }, { "input": "24 4\n33 27 12 65 19 6 46 33 57 2 21 50 73 13 59 69 51 45 39 1 6 64 39 27", "output": "9" } ]
1,683,806,170
2,147,483,647
PyPy 3-64
TIME_LIMIT_EXCEEDED
TESTS
53
3,000
25,088,000
import sys input = lambda: sys.stdin.readline().strip() print = lambda d: sys.stdout.write(str(d) + "\n") n, k = input().split(" ") n, k = int(n), int(k) arr = [int(val) for val in input().split(" ")] arr.sort() cnt_sum = [0 for i in range(n + 1)] def is_ok(val): # is_end_ok = [False for i in range(n)] cnt_sum[0] = 0 left, right = 0, 0 for i in range(n): right = i - k + 1 here_ok = 0; if right >= 0: while left <= i and arr[left] + val < arr[i]: left += 1 if (left <= right): if (left == 0 or cnt_sum[right] - cnt_sum[left - 1] != 0): here_ok = 1 cnt_sum[i + 1] = cnt_sum[i] if here_ok: cnt_sum[i + 1] += 1 # print(cnt_sum) return cnt_sum[-1] > cnt_sum[-2] # print("363", is_ok(363)) # exit() if k == 1: print(0) else: l, r = 0, arr[-1] - arr[0] while l < r: m = (l + r) // 2 if is_ok(m): r = m - 1 else: l = m + 1 if is_ok(r): print(r) elif is_ok(r + 1): print(r + 1) # print(r + 2) # # #include<stdio.h> # #include <stdlib.h> # # int cnt_sum[300000 + 1]; # # int is_ok(int arr[], int n, int k, int val) { # int left = 0, right = 0; # cnt_sum[0] = 0; # int here_ok; # for (int i = 0; i < n; ++i) { # right = i - k + 1; # here_ok = 0; # if (right >= 0) { # while (left <= i && arr[left] + val < arr[i]) { # ++left; # } # if (left <= right) { # if (left == 0 || cnt_sum[right] - cnt_sum[left - 1] != 0) { # here_ok = 1; # } # } # } # cnt_sum[i + 1] = cnt_sum[i]; # if (here_ok) { # ++cnt_sum[i + 1]; # } # } # return cnt_sum[n] > cnt_sum[n - 1]; # } # # int cmp(const void *a, const void * b) { # return *(int *)a - *(int *)b; # } # # int main(){ # int n, k; # int i, l, r, m; # int arr[300000]; # scanf("%d %d", &n, &k); # for (i = 0; i < n; i++) { # scanf("%d", &arr[i]); # } # if (k == 1) { # printf("0\n"); # return 0; # } # qsort(arr,n,sizeof(int), cmp); # l = 0, r = arr[n - 1] - arr[0]; # while (l < r) { # m = (l + r) / 2; # if (is_ok(arr, n, k, m)) { # r = m - 1; # } else { # l = m + 1; # } # } # if (is_ok(arr, n, k, r)) { # printf("%d\n", r); # return 0; # } # printf("%d\n", r + 1); # return 0; # }
Title: Photo Processing Time Limit: None seconds Memory Limit: None megabytes Problem Description: Evlampiy has found one more cool application to process photos. However the application has certain limitations. Each photo *i* has a contrast *v**i*. In order for the processing to be truly of high quality, the application must receive at least *k* photos with contrasts which differ as little as possible. Evlampiy already knows the contrast *v**i* for each of his *n* photos. Now he wants to split the photos into groups, so that each group contains at least *k* photos. As a result, each photo must belong to exactly one group. He considers a processing time of the *j*-th group to be the difference between the maximum and minimum values of *v**i* in the group. Because of multithreading the processing time of a division into groups is the maximum processing time among all groups. Split *n* photos into groups in a such way that the processing time of the division is the minimum possible, i.e. that the the maximum processing time over all groups as least as possible. Input Specification: The first line contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=3·105) — number of photos and minimum size of a group. The second line contains *n* integers *v*1,<=*v*2,<=...,<=*v**n* (1<=≤<=*v**i*<=≤<=109), where *v**i* is the contrast of the *i*-th photo. Output Specification: Print the minimal processing time of the division into groups. Demo Input: ['5 2\n50 110 130 40 120\n', '4 1\n2 3 4 1\n'] Demo Output: ['20\n', '0\n'] Note: In the first example the photos should be split into 2 groups: [40, 50] and [110, 120, 130]. The processing time of the first group is 10, and the processing time of the second group is 20. Maximum among 10 and 20 is 20. It is impossible to split the photos into groups in a such way that the processing time of division is less than 20. In the second example the photos should be split into four groups, each containing one photo. So the minimal possible processing time of a division is 0.
```python import sys input = lambda: sys.stdin.readline().strip() print = lambda d: sys.stdout.write(str(d) + "\n") n, k = input().split(" ") n, k = int(n), int(k) arr = [int(val) for val in input().split(" ")] arr.sort() cnt_sum = [0 for i in range(n + 1)] def is_ok(val): # is_end_ok = [False for i in range(n)] cnt_sum[0] = 0 left, right = 0, 0 for i in range(n): right = i - k + 1 here_ok = 0; if right >= 0: while left <= i and arr[left] + val < arr[i]: left += 1 if (left <= right): if (left == 0 or cnt_sum[right] - cnt_sum[left - 1] != 0): here_ok = 1 cnt_sum[i + 1] = cnt_sum[i] if here_ok: cnt_sum[i + 1] += 1 # print(cnt_sum) return cnt_sum[-1] > cnt_sum[-2] # print("363", is_ok(363)) # exit() if k == 1: print(0) else: l, r = 0, arr[-1] - arr[0] while l < r: m = (l + r) // 2 if is_ok(m): r = m - 1 else: l = m + 1 if is_ok(r): print(r) elif is_ok(r + 1): print(r + 1) # print(r + 2) # # #include<stdio.h> # #include <stdlib.h> # # int cnt_sum[300000 + 1]; # # int is_ok(int arr[], int n, int k, int val) { # int left = 0, right = 0; # cnt_sum[0] = 0; # int here_ok; # for (int i = 0; i < n; ++i) { # right = i - k + 1; # here_ok = 0; # if (right >= 0) { # while (left <= i && arr[left] + val < arr[i]) { # ++left; # } # if (left <= right) { # if (left == 0 || cnt_sum[right] - cnt_sum[left - 1] != 0) { # here_ok = 1; # } # } # } # cnt_sum[i + 1] = cnt_sum[i]; # if (here_ok) { # ++cnt_sum[i + 1]; # } # } # return cnt_sum[n] > cnt_sum[n - 1]; # } # # int cmp(const void *a, const void * b) { # return *(int *)a - *(int *)b; # } # # int main(){ # int n, k; # int i, l, r, m; # int arr[300000]; # scanf("%d %d", &n, &k); # for (i = 0; i < n; i++) { # scanf("%d", &arr[i]); # } # if (k == 1) { # printf("0\n"); # return 0; # } # qsort(arr,n,sizeof(int), cmp); # l = 0, r = arr[n - 1] - arr[0]; # while (l < r) { # m = (l + r) / 2; # if (is_ok(arr, n, k, m)) { # r = m - 1; # } else { # l = m + 1; # } # } # if (is_ok(arr, n, k, r)) { # printf("%d\n", r); # return 0; # } # printf("%d\n", r + 1); # return 0; # } ```
0
584
D
Dima and Lisa
PROGRAMMING
1,800
[ "brute force", "math", "number theory" ]
null
null
Dima loves representing an odd number as the sum of multiple primes, and Lisa loves it when there are at most three primes. Help them to represent the given number as the sum of at most than three primes. More formally, you are given an odd numer *n*. Find a set of numbers *p**i* (1<=≤<=*i*<=≤<=*k*), such that 1. 1<=≤<=*k*<=≤<=31. *p**i* is a prime1. The numbers *p**i* do not necessarily have to be distinct. It is guaranteed that at least one possible solution exists.
The single line contains an odd number *n* (3<=≤<=*n*<=&lt;<=109).
In the first line print *k* (1<=≤<=*k*<=≤<=3), showing how many numbers are in the representation you found. In the second line print numbers *p**i* in any order. If there are multiple possible solutions, you can print any of them.
[ "27\n" ]
[ "3\n5 11 11\n" ]
A prime is an integer strictly larger than one that is divisible only by one and by itself.
2,000
[ { "input": "27", "output": "3\n2 2 23" }, { "input": "3", "output": "1\n3" }, { "input": "25", "output": "2\n2 23" }, { "input": "9", "output": "2\n2 7" }, { "input": "91", "output": "2\n2 89" }, { "input": "57", "output": "3\n2 2 53" }, { "input": "31", "output": "1\n31" }, { "input": "555", "output": "3\n3 5 547" }, { "input": "700000001", "output": "1\n700000001" }, { "input": "5", "output": "1\n5" }, { "input": "7", "output": "1\n7" }, { "input": "11", "output": "1\n11" }, { "input": "13", "output": "1\n13" }, { "input": "15", "output": "2\n2 13" }, { "input": "17", "output": "1\n17" }, { "input": "19", "output": "1\n19" }, { "input": "21", "output": "2\n2 19" }, { "input": "23", "output": "1\n23" }, { "input": "29", "output": "1\n29" }, { "input": "79", "output": "1\n79" }, { "input": "99", "output": "2\n2 97" }, { "input": "27", "output": "3\n2 2 23" }, { "input": "55", "output": "2\n2 53" }, { "input": "79", "output": "1\n79" }, { "input": "585", "output": "3\n3 5 577" }, { "input": "245", "output": "3\n2 2 241" }, { "input": "793", "output": "3\n3 3 787" }, { "input": "133", "output": "2\n2 131" }, { "input": "681", "output": "3\n2 2 677" }, { "input": "981399", "output": "2\n2 981397" }, { "input": "867773", "output": "1\n867773" }, { "input": "654141", "output": "3\n3 11 654127" }, { "input": "202985", "output": "3\n2 2 202981" }, { "input": "784533", "output": "3\n3 17 784513" }, { "input": "370359", "output": "3\n19 79 370261" }, { "input": "396831", "output": "3\n19 79 396733" }, { "input": "492211", "output": "3\n19 79 492113" }, { "input": "838347", "output": "3\n19 79 838249" }, { "input": "1098945", "output": "3\n19 79 1098847" }, { "input": "1313565", "output": "3\n19 79 1313467" }, { "input": "1349631", "output": "3\n19 79 1349533" }, { "input": "1357299", "output": "3\n19 79 1357201" }, { "input": "1357323", "output": "3\n13 109 1357201" }, { "input": "1357329", "output": "3\n19 109 1357201" }, { "input": "1388581", "output": "3\n19 79 1388483" }, { "input": "5275", "output": "2\n2 5273" }, { "input": "9515", "output": "3\n2 2 9511" }, { "input": "7847", "output": "3\n3 3 7841" }, { "input": "7077", "output": "3\n3 5 7069" }, { "input": "9531", "output": "3\n3 7 9521" }, { "input": "7865", "output": "3\n5 7 7853" }, { "input": "9675", "output": "3\n3 11 9661" }, { "input": "8909", "output": "3\n3 13 8893" }, { "input": "7147", "output": "3\n5 13 7129" }, { "input": "8487", "output": "3\n3 17 8467" }, { "input": "436273289", "output": "3\n3 277 436273009" }, { "input": "649580445", "output": "3\n3 271 649580171" }, { "input": "944193065", "output": "3\n7 251 944192807" }, { "input": "630045387", "output": "3\n11 239 630045137" }, { "input": "931103229", "output": "3\n3 223 931103003" }, { "input": "950664039", "output": "3\n3 197 950663839" }, { "input": "996104777", "output": "3\n7 173 996104597" }, { "input": "997255617", "output": "3\n7 157 997255453" }, { "input": "999962901", "output": "3\n19 109 999962773" }, { "input": "999995529", "output": "3\n19 79 999995431" }, { "input": "999995339", "output": "3\n5 43 999995291" }, { "input": "999998367", "output": "3\n5 23 999998339" }, { "input": "999999891", "output": "3\n3 5 999999883" }, { "input": "999999935", "output": "3\n3 3 999999929" }, { "input": "999999755", "output": "3\n2 2 999999751" }, { "input": "999999759", "output": "2\n2 999999757" }, { "input": "999999191", "output": "1\n999999191" }, { "input": "999999999", "output": "3\n3 59 999999937" }, { "input": "409449117", "output": "3\n2 2 409449113" }, { "input": "882499837", "output": "3\n3 3 882499831" }, { "input": "765615965", "output": "3\n5 23 765615937" }, { "input": "648732093", "output": "3\n3 11 648732079" }, { "input": "826815517", "output": "3\n3 11 826815503" }, { "input": "4898941", "output": "2\n2 4898939" }, { "input": "182982365", "output": "3\n5 13 182982347" }, { "input": "66098493", "output": "3\n3 41 66098449" }, { "input": "539149213", "output": "1\n539149213" }, { "input": "655957385", "output": "3\n3 13 655957369" }, { "input": "199999581", "output": "3\n19 79 199999483" }, { "input": "199998345", "output": "3\n19 79 199998247" }, { "input": "199991935", "output": "3\n19 79 199991837" }, { "input": "199986207", "output": "3\n19 79 199986109" }, { "input": "499991589", "output": "3\n19 79 499991491" }, { "input": "499984689", "output": "3\n19 79 499984591" }, { "input": "499984159", "output": "3\n19 79 499984061" }, { "input": "499966179", "output": "3\n19 79 499966081" }, { "input": "999995529", "output": "3\n19 79 999995431" }, { "input": "999995085", "output": "3\n19 79 999994987" }, { "input": "999991817", "output": "3\n11 137 999991669" }, { "input": "999991797", "output": "3\n19 109 999991669" }, { "input": "999991791", "output": "3\n13 109 999991669" }, { "input": "748859699", "output": "3\n3 3 748859693" }, { "input": "323845235", "output": "3\n3 3 323845229" }, { "input": "462409937", "output": "3\n2 2 462409933" }, { "input": "618047403", "output": "3\n3 13 618047387" }, { "input": "501148647", "output": "3\n2 2 501148643" }, { "input": "998017623", "output": "2\n2 998017621" }, { "input": "436273289", "output": "3\n3 277 436273009" }, { "input": "999999965", "output": "3\n5 23 999999937" }, { "input": "5", "output": "1\n5" }, { "input": "1000037", "output": "1\n1000037" }, { "input": "989898987", "output": "3\n2 2 989898983" }, { "input": "999999999", "output": "3\n3 59 999999937" }, { "input": "100000003", "output": "3\n3 11 99999989" } ]
1,689,343,116
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
15
0
print("_RANDOM_GUESS_1689343116.331787")# 1689343116.331794
Title: Dima and Lisa Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dima loves representing an odd number as the sum of multiple primes, and Lisa loves it when there are at most three primes. Help them to represent the given number as the sum of at most than three primes. More formally, you are given an odd numer *n*. Find a set of numbers *p**i* (1<=≤<=*i*<=≤<=*k*), such that 1. 1<=≤<=*k*<=≤<=31. *p**i* is a prime1. The numbers *p**i* do not necessarily have to be distinct. It is guaranteed that at least one possible solution exists. Input Specification: The single line contains an odd number *n* (3<=≤<=*n*<=&lt;<=109). Output Specification: In the first line print *k* (1<=≤<=*k*<=≤<=3), showing how many numbers are in the representation you found. In the second line print numbers *p**i* in any order. If there are multiple possible solutions, you can print any of them. Demo Input: ['27\n'] Demo Output: ['3\n5 11 11\n'] Note: A prime is an integer strictly larger than one that is divisible only by one and by itself.
```python print("_RANDOM_GUESS_1689343116.331787")# 1689343116.331794 ```
0
598
B
Queries on a String
PROGRAMMING
1,300
[ "implementation", "strings" ]
null
null
You are given a string *s* and should process *m* queries. Each query is described by two 1-based indices *l**i*, *r**i* and integer *k**i*. It means that you should cyclically shift the substring *s*[*l**i*... *r**i*] *k**i* times. The queries should be processed one after another in the order they are given. One operation of a cyclic shift (rotation) is equivalent to moving the last character to the position of the first character and shifting all other characters one position to the right. For example, if the string *s* is abacaba and the query is *l*1<==<=3,<=*r*1<==<=6,<=*k*1<==<=1 then the answer is abbacaa. If after that we would process the query *l*2<==<=1,<=*r*2<==<=4,<=*k*2<==<=2 then we would get the string baabcaa.
The first line of the input contains the string *s* (1<=≤<=|*s*|<=≤<=10<=000) in its initial state, where |*s*| stands for the length of *s*. It contains only lowercase English letters. Second line contains a single integer *m* (1<=≤<=*m*<=≤<=300) — the number of queries. The *i*-th of the next *m* lines contains three integers *l**i*, *r**i* and *k**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=|*s*|,<=1<=≤<=*k**i*<=≤<=1<=000<=000) — the description of the *i*-th query.
Print the resulting string *s* after processing all *m* queries.
[ "abacaba\n2\n3 6 1\n1 4 2\n" ]
[ "baabcaa\n" ]
The sample is described in problem statement.
0
[ { "input": "abacaba\n2\n3 6 1\n1 4 2", "output": "baabcaa" }, { "input": "u\n1\n1 1 1", "output": "u" }, { "input": "p\n5\n1 1 5\n1 1 9\n1 1 10\n1 1 10\n1 1 4", "output": "p" }, { "input": "ssssssssss\n5\n5 7 9\n3 9 3\n2 7 1\n7 7 10\n1 9 6", "output": "ssssssssss" }, { "input": "tcpyzttcpo\n10\n2 3 6\n2 4 1\n2 6 9\n7 10 5\n2 3 5\n4 5 6\n3 4 5\n7 9 4\n9 10 7\n1 10 8", "output": "zctycopttp" }, { "input": "yywlblbblw\n10\n4 7 2\n3 8 2\n4 10 6\n4 7 1\n3 9 6\n1 7 3\n3 7 3\n3 7 1\n1 8 7\n2 7 5", "output": "bylwlwylbb" }, { "input": "thisisahacktest\n1\n1 2 1", "output": "htisisahacktest" }, { "input": "ozozumuhackleyan\n1\n1 4 1", "output": "zozoumuhackleyan" }, { "input": "lacongaithattuyet\n1\n1 1 1", "output": "lacongaithattuyet" } ]
1,678,023,047
1,847
PyPy 3
TIME_LIMIT_EXCEEDED
TESTS
7
2,000
12,390,400
# for iiiii in range(int(input())): # n=int(input()) # p=int(input()) # p=list(map(int, p.strip())) # s=(list(map(int,input().split(' ')))) # l=list(input()) s=input() for i in range(int(input())): l,r,k=(list(map(int,input().split(' ')))) ss=s[l-1:r] # print(ss) for j in range(k): ss=ss[-1]+ss[:-1] # print(ss) # print(s[:l-1],ss, s[r:]) s=s[:l-1]+ss+s[r:] print(s)
Title: Queries on a String Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a string *s* and should process *m* queries. Each query is described by two 1-based indices *l**i*, *r**i* and integer *k**i*. It means that you should cyclically shift the substring *s*[*l**i*... *r**i*] *k**i* times. The queries should be processed one after another in the order they are given. One operation of a cyclic shift (rotation) is equivalent to moving the last character to the position of the first character and shifting all other characters one position to the right. For example, if the string *s* is abacaba and the query is *l*1<==<=3,<=*r*1<==<=6,<=*k*1<==<=1 then the answer is abbacaa. If after that we would process the query *l*2<==<=1,<=*r*2<==<=4,<=*k*2<==<=2 then we would get the string baabcaa. Input Specification: The first line of the input contains the string *s* (1<=≤<=|*s*|<=≤<=10<=000) in its initial state, where |*s*| stands for the length of *s*. It contains only lowercase English letters. Second line contains a single integer *m* (1<=≤<=*m*<=≤<=300) — the number of queries. The *i*-th of the next *m* lines contains three integers *l**i*, *r**i* and *k**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=|*s*|,<=1<=≤<=*k**i*<=≤<=1<=000<=000) — the description of the *i*-th query. Output Specification: Print the resulting string *s* after processing all *m* queries. Demo Input: ['abacaba\n2\n3 6 1\n1 4 2\n'] Demo Output: ['baabcaa\n'] Note: The sample is described in problem statement.
```python # for iiiii in range(int(input())): # n=int(input()) # p=int(input()) # p=list(map(int, p.strip())) # s=(list(map(int,input().split(' ')))) # l=list(input()) s=input() for i in range(int(input())): l,r,k=(list(map(int,input().split(' ')))) ss=s[l-1:r] # print(ss) for j in range(k): ss=ss[-1]+ss[:-1] # print(ss) # print(s[:l-1],ss, s[r:]) s=s[:l-1]+ss+s[r:] print(s) ```
0