contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
listlengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
522
|
A
|
Reposts
|
PROGRAMMING
| 1,200
|
[
"*special",
"dfs and similar",
"dp",
"graphs",
"trees"
] | null | null |
One day Polycarp published a funny picture in a social network making a poll about the color of his handle. Many of his friends started reposting Polycarp's joke to their news feed. Some of them reposted the reposts and so on.
These events are given as a sequence of strings "name1 reposted name2", where name1 is the name of the person who reposted the joke, and name2 is the name of the person from whose news feed the joke was reposted. It is guaranteed that for each string "name1 reposted name2" user "name1" didn't have the joke in his feed yet, and "name2" already had it in his feed by the moment of repost. Polycarp was registered as "Polycarp" and initially the joke was only in his feed.
Polycarp measures the popularity of the joke as the length of the largest repost chain. Print the popularity of Polycarp's joke.
|
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=200) — the number of reposts. Next follow the reposts in the order they were made. Each of them is written on a single line and looks as "name1 reposted name2". All the names in the input consist of lowercase or uppercase English letters and/or digits and have lengths from 2 to 24 characters, inclusive.
We know that the user names are case-insensitive, that is, two names that only differ in the letter case correspond to the same social network user.
|
Print a single integer — the maximum length of a repost chain.
|
[
"5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya\n",
"6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp\n",
"1\nSoMeStRaNgEgUe reposted PoLyCaRp\n"
] |
[
"6\n",
"2\n",
"2\n"
] |
none
| 500
|
[
{
"input": "5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya",
"output": "6"
},
{
"input": "6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp",
"output": "2"
},
{
"input": "1\nSoMeStRaNgEgUe reposted PoLyCaRp",
"output": "2"
},
{
"input": "1\niuNtwVf reposted POlYcarP",
"output": "2"
},
{
"input": "10\ncs reposted poLYCaRp\nAFIkDrY7Of4V7Mq reposted CS\nsoBiwyN7KOvoFUfbhux reposted aFikDry7Of4v7MQ\nvb6LbwA reposted sObIWYN7KOvoFufBHUx\nDtWKIcVwIHgj4Rcv reposted vb6lbwa\nkt reposted DTwKicvwihgJ4rCV\n75K reposted kT\njKzyxx1 reposted 75K\nuoS reposted jkZyXX1\npZJskHTCIqE3YyZ5ME reposted uoS",
"output": "11"
},
{
"input": "10\nvxrUpCXvx8Isq reposted pOLYcaRP\nICb1 reposted vXRUpCxvX8ISq\nJFMt4b8jZE7iF2m8by7y2 reposted Icb1\nqkG6ZkMIf9QRrBFQU reposted ICb1\nnawsNfcR2palIMnmKZ reposted pOlYcaRP\nKksyH reposted jFMT4b8JzE7If2M8by7y2\nwJtWwQS5FvzN0h8CxrYyL reposted NawsNfcR2paLIMnmKz\nDpBcBPYAcTXEdhldI6tPl reposted NaWSnFCr2pALiMnmkZ\nlEnwTVnlwdQg2vaIRQry reposted kKSYh\nQUVFgwllaWO reposted Wjtwwqs5FVzN0H8cxRyyl",
"output": "6"
},
{
"input": "10\nkkuLGEiHv reposted POLYcArp\n3oX1AoUqyw1eR3nCADY9hLwd reposted kkuLGeIHV\nwf97dqq5bx1dPIchCoT reposted 3OX1AOuQYW1eR3ncAdY9hLwD\nWANr8h reposted Wf97dQQ5bx1dpIcHcoT\n3Fb736lkljZK2LtSbfL reposted wANR8h\n6nq9xLOn reposted 3fB736lKlJZk2LtSbFL\nWL reposted 3Fb736lKLjZk2LTSbfl\ndvxn4Xtc6SBcvKf1 reposted wF97DQq5bX1dPiChCOt\nMCcPLIMISqxDzrj reposted 6nQ9XLOn\nxsQL4Z2Iu reposted MCcpLiMiSqxdzrj",
"output": "9"
},
{
"input": "10\nsMA4 reposted pOLyCARP\nlq3 reposted pOlycARp\nEa16LSFTQxLJnE reposted polYcARp\nkvZVZhJwXcWsnC7NA1DV2WvS reposted polYCArp\nEYqqlrjRwddI reposted pOlyCArP\nsPqQCA67Y6PBBbcaV3EhooO reposted ea16LSFTqxLJne\njjPnneZdF6WLZ3v reposted Ea16LSFTqxLjNe\nWEoi6UpnfBUx79 reposted ea16LSFtqXljNe\nqi4yra reposted eYqqlRJrWDDI\ncw7E1UCSUD reposted eYqqLRJRwDdI",
"output": "3"
}
] | 1,599,811,680
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 108
| 307,200
|
d={'polycarp':[]}
for _ in range(int(input())):
s=input().lower().split()
name1,name2=s[0],s[2]
d[name2].append(name1)
d[name1]=[]
stack=['polycarp']
visited={'polycarp'}
level={'polycarp':1}
while stack:
a=stack.pop()
for i in d[a]:
if i not in visited:
visited.add(i)
stack.append(i)
level[i]=level[a]+1
print(max(list(level.values())))
|
Title: Reposts
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Polycarp published a funny picture in a social network making a poll about the color of his handle. Many of his friends started reposting Polycarp's joke to their news feed. Some of them reposted the reposts and so on.
These events are given as a sequence of strings "name1 reposted name2", where name1 is the name of the person who reposted the joke, and name2 is the name of the person from whose news feed the joke was reposted. It is guaranteed that for each string "name1 reposted name2" user "name1" didn't have the joke in his feed yet, and "name2" already had it in his feed by the moment of repost. Polycarp was registered as "Polycarp" and initially the joke was only in his feed.
Polycarp measures the popularity of the joke as the length of the largest repost chain. Print the popularity of Polycarp's joke.
Input Specification:
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=200) — the number of reposts. Next follow the reposts in the order they were made. Each of them is written on a single line and looks as "name1 reposted name2". All the names in the input consist of lowercase or uppercase English letters and/or digits and have lengths from 2 to 24 characters, inclusive.
We know that the user names are case-insensitive, that is, two names that only differ in the letter case correspond to the same social network user.
Output Specification:
Print a single integer — the maximum length of a repost chain.
Demo Input:
['5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya\n', '6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp\n', '1\nSoMeStRaNgEgUe reposted PoLyCaRp\n']
Demo Output:
['6\n', '2\n', '2\n']
Note:
none
|
```python
d={'polycarp':[]}
for _ in range(int(input())):
s=input().lower().split()
name1,name2=s[0],s[2]
d[name2].append(name1)
d[name1]=[]
stack=['polycarp']
visited={'polycarp'}
level={'polycarp':1}
while stack:
a=stack.pop()
for i in d[a]:
if i not in visited:
visited.add(i)
stack.append(i)
level[i]=level[a]+1
print(max(list(level.values())))
```
| 3
|
|
485
|
A
|
Factory
|
PROGRAMMING
| 1,400
|
[
"implementation",
"math",
"matrices"
] | null | null |
One industrial factory is reforming working plan. The director suggested to set a mythical detail production norm. If at the beginning of the day there were *x* details in the factory storage, then by the end of the day the factory has to produce (remainder after dividing *x* by *m*) more details. Unfortunately, no customer has ever bought any mythical detail, so all the details produced stay on the factory.
The board of directors are worried that the production by the given plan may eventually stop (that means that there will be а moment when the current number of details on the factory is divisible by *m*).
Given the number of details *a* on the first day and number *m* check if the production stops at some moment.
|
The first line contains two integers *a* and *m* (1<=≤<=*a*,<=*m*<=≤<=105).
|
Print "Yes" (without quotes) if the production will eventually stop, otherwise print "No".
|
[
"1 5\n",
"3 6\n"
] |
[
"No\n",
"Yes\n"
] |
none
| 1,000
|
[
{
"input": "1 5",
"output": "No"
},
{
"input": "3 6",
"output": "Yes"
},
{
"input": "1 8",
"output": "Yes"
},
{
"input": "2 3",
"output": "No"
},
{
"input": "3 24",
"output": "Yes"
},
{
"input": "1 1",
"output": "Yes"
},
{
"input": "100000 100000",
"output": "Yes"
},
{
"input": "1 99989",
"output": "No"
},
{
"input": "512 2",
"output": "Yes"
},
{
"input": "100 24",
"output": "No"
},
{
"input": "1 100000",
"output": "No"
},
{
"input": "100000 1",
"output": "Yes"
},
{
"input": "3 99929",
"output": "No"
},
{
"input": "99961 99971",
"output": "No"
},
{
"input": "1 65536",
"output": "Yes"
},
{
"input": "4 65536",
"output": "Yes"
},
{
"input": "3 65536",
"output": "Yes"
},
{
"input": "32768 65536",
"output": "Yes"
},
{
"input": "65535 65536",
"output": "Yes"
},
{
"input": "1 65535",
"output": "No"
},
{
"input": "98812 100000",
"output": "No"
},
{
"input": "10 5",
"output": "Yes"
},
{
"input": "6 8",
"output": "Yes"
}
] | 1,618,063,781
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 8
| 77
| 0
|
a, m = map(int, input().split())
i = 0
f = 0
while a <= m:
if a % m == 0:
print('Yes')
f = 1
break
a += a % m
i += 1
if f == 0:
print('No')
|
Title: Factory
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One industrial factory is reforming working plan. The director suggested to set a mythical detail production norm. If at the beginning of the day there were *x* details in the factory storage, then by the end of the day the factory has to produce (remainder after dividing *x* by *m*) more details. Unfortunately, no customer has ever bought any mythical detail, so all the details produced stay on the factory.
The board of directors are worried that the production by the given plan may eventually stop (that means that there will be а moment when the current number of details on the factory is divisible by *m*).
Given the number of details *a* on the first day and number *m* check if the production stops at some moment.
Input Specification:
The first line contains two integers *a* and *m* (1<=≤<=*a*,<=*m*<=≤<=105).
Output Specification:
Print "Yes" (without quotes) if the production will eventually stop, otherwise print "No".
Demo Input:
['1 5\n', '3 6\n']
Demo Output:
['No\n', 'Yes\n']
Note:
none
|
```python
a, m = map(int, input().split())
i = 0
f = 0
while a <= m:
if a % m == 0:
print('Yes')
f = 1
break
a += a % m
i += 1
if f == 0:
print('No')
```
| 0
|
|
2
|
A
|
Winner
|
PROGRAMMING
| 1,500
|
[
"hashing",
"implementation"
] |
A. Winner
|
1
|
64
|
The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points.
|
The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive.
|
Print the name of the winner.
|
[
"3\nmike 3\nandrew 5\nmike 2\n",
"3\nandrew 3\nandrew 2\nmike 5\n"
] |
[
"andrew\n",
"andrew\n"
] |
none
| 0
|
[
{
"input": "3\nmike 3\nandrew 5\nmike 2",
"output": "andrew"
},
{
"input": "3\nandrew 3\nandrew 2\nmike 5",
"output": "andrew"
},
{
"input": "5\nkaxqybeultn -352\nmgochgrmeyieyskhuourfg -910\nkaxqybeultn 691\nmgochgrmeyieyskhuourfg -76\nkaxqybeultn -303",
"output": "kaxqybeultn"
},
{
"input": "7\nksjuuerbnlklcfdjeyq 312\ndthjlkrvvbyahttifpdewvyslsh -983\nksjuuerbnlklcfdjeyq 268\ndthjlkrvvbyahttifpdewvyslsh 788\nksjuuerbnlklcfdjeyq -79\nksjuuerbnlklcfdjeyq -593\nksjuuerbnlklcfdjeyq 734",
"output": "ksjuuerbnlklcfdjeyq"
},
{
"input": "12\natrtthfpcvishmqbakprquvnejr 185\natrtthfpcvishmqbakprquvnejr -699\natrtthfpcvishmqbakprquvnejr -911\natrtthfpcvishmqbakprquvnejr -220\nfcgslzkicjrpbqaifgweyzreajjfdo 132\nfcgslzkicjrpbqaifgweyzreajjfdo -242\nm 177\nm -549\natrtthfpcvishmqbakprquvnejr -242\nm 38\natrtthfpcvishmqbakprquvnejr -761\nfcgslzkicjrpbqaifgweyzreajjfdo 879",
"output": "fcgslzkicjrpbqaifgweyzreajjfdo"
},
{
"input": "15\naawtvezfntstrcpgbzjbf 681\nzhahpvqiptvksnbjkdvmknb -74\naawtvezfntstrcpgbzjbf 661\njpdwmyke 474\naawtvezfntstrcpgbzjbf -547\naawtvezfntstrcpgbzjbf 600\nzhahpvqiptvksnbjkdvmknb -11\njpdwmyke 711\nbjmj 652\naawtvezfntstrcpgbzjbf -1000\naawtvezfntstrcpgbzjbf -171\nbjmj -302\naawtvezfntstrcpgbzjbf 961\nzhahpvqiptvksnbjkdvmknb 848\nbjmj -735",
"output": "aawtvezfntstrcpgbzjbf"
},
{
"input": "17\nqdplghhx -649\nivhgbxiv 424\nivhgbxiv -72\nivhgbxiv 479\nugowfouebkelargxylsxn 83\nugowfouebkelargxylsxn -840\nivhgbxiv 382\nqdplghhx -904\nivhgbxiv -710\nugowfouebkelargxylsxn -838\nqdplghhx -974\nqdplghhx 571\nivhgbxiv -145\nugowfouebkelargxylsxn -788\nivhgbxiv 209\nivhgbxiv 420\nqdplghhx -158",
"output": "ivhgbxiv"
}
] | 1,676,650,168
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 62
| 0
|
print("andrew")
|
Title: Winner
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points.
Input Specification:
The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive.
Output Specification:
Print the name of the winner.
Demo Input:
['3\nmike 3\nandrew 5\nmike 2\n', '3\nandrew 3\nandrew 2\nmike 5\n']
Demo Output:
['andrew\n', 'andrew\n']
Note:
none
|
```python
print("andrew")
```
| 0
|
124
|
A
|
The number of positions
|
PROGRAMMING
| 1,000
|
[
"math"
] | null | null |
Petr stands in line of *n* people, but he doesn't know exactly which position he occupies. He can say that there are no less than *a* people standing in front of him and no more than *b* people standing behind him. Find the number of different positions Petr can occupy.
|
The only line contains three integers *n*, *a* and *b* (0<=≤<=*a*,<=*b*<=<<=*n*<=≤<=100).
|
Print the single number — the number of the sought positions.
|
[
"3 1 1\n",
"5 2 3\n"
] |
[
"2\n",
"3\n"
] |
The possible positions in the first sample are: 2 and 3 (if we number the positions starting with 1).
In the second sample they are 3, 4 and 5.
| 500
|
[
{
"input": "3 1 1",
"output": "2"
},
{
"input": "5 2 3",
"output": "3"
},
{
"input": "5 4 0",
"output": "1"
},
{
"input": "6 5 5",
"output": "1"
},
{
"input": "9 4 3",
"output": "4"
},
{
"input": "11 4 6",
"output": "7"
},
{
"input": "13 8 7",
"output": "5"
},
{
"input": "14 5 5",
"output": "6"
},
{
"input": "16 6 9",
"output": "10"
},
{
"input": "20 13 17",
"output": "7"
},
{
"input": "22 4 8",
"output": "9"
},
{
"input": "23 8 14",
"output": "15"
},
{
"input": "26 18 22",
"output": "8"
},
{
"input": "28 6 1",
"output": "2"
},
{
"input": "29 5 23",
"output": "24"
},
{
"input": "32 27 15",
"output": "5"
},
{
"input": "33 11 5",
"output": "6"
},
{
"input": "37 21 15",
"output": "16"
},
{
"input": "39 34 33",
"output": "5"
},
{
"input": "41 27 11",
"output": "12"
},
{
"input": "42 25 16",
"output": "17"
},
{
"input": "45 7 43",
"output": "38"
},
{
"input": "47 16 17",
"output": "18"
},
{
"input": "49 11 37",
"output": "38"
},
{
"input": "51 38 39",
"output": "13"
},
{
"input": "52 29 7",
"output": "8"
},
{
"input": "56 43 12",
"output": "13"
},
{
"input": "58 57 28",
"output": "1"
},
{
"input": "59 12 39",
"output": "40"
},
{
"input": "62 9 52",
"output": "53"
},
{
"input": "63 29 44",
"output": "34"
},
{
"input": "65 30 22",
"output": "23"
},
{
"input": "66 27 38",
"output": "39"
},
{
"input": "71 33 53",
"output": "38"
},
{
"input": "73 14 12",
"output": "13"
},
{
"input": "73 37 35",
"output": "36"
},
{
"input": "76 69 44",
"output": "7"
},
{
"input": "79 25 20",
"output": "21"
},
{
"input": "81 60 20",
"output": "21"
},
{
"input": "81 79 14",
"output": "2"
},
{
"input": "84 0 42",
"output": "43"
},
{
"input": "88 79 8",
"output": "9"
},
{
"input": "90 76 59",
"output": "14"
},
{
"input": "92 2 22",
"output": "23"
},
{
"input": "94 5 88",
"output": "89"
},
{
"input": "94 62 48",
"output": "32"
},
{
"input": "96 22 72",
"output": "73"
},
{
"input": "100 11 88",
"output": "89"
},
{
"input": "100 81 91",
"output": "19"
},
{
"input": "1 0 0",
"output": "1"
}
] | 1,649,963,543
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 62
| 0
|
n,a,b = map(int, input().split())
if(a<=b):
print(min((a+1),(n-a)))
else:
print(min((b+1),(n-b)))
|
Title: The number of positions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petr stands in line of *n* people, but he doesn't know exactly which position he occupies. He can say that there are no less than *a* people standing in front of him and no more than *b* people standing behind him. Find the number of different positions Petr can occupy.
Input Specification:
The only line contains three integers *n*, *a* and *b* (0<=≤<=*a*,<=*b*<=<<=*n*<=≤<=100).
Output Specification:
Print the single number — the number of the sought positions.
Demo Input:
['3 1 1\n', '5 2 3\n']
Demo Output:
['2\n', '3\n']
Note:
The possible positions in the first sample are: 2 and 3 (if we number the positions starting with 1).
In the second sample they are 3, 4 and 5.
|
```python
n,a,b = map(int, input().split())
if(a<=b):
print(min((a+1),(n-a)))
else:
print(min((b+1),(n-b)))
```
| 0
|
|
864
|
B
|
Polycarp and Letters
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation",
"strings"
] | null | null |
Polycarp loves lowercase letters and dislikes uppercase ones. Once he got a string *s* consisting only of lowercase and uppercase Latin letters.
Let *A* be a set of positions in the string. Let's call it pretty if following conditions are met:
- letters on positions from *A* in the string are all distinct and lowercase; - there are no uppercase letters in the string which are situated between positions from *A* (i.e. there is no such *j* that *s*[*j*] is an uppercase letter, and *a*1<=<<=*j*<=<<=*a*2 for some *a*1 and *a*2 from *A*).
Write a program that will determine the maximum number of elements in a pretty set of positions.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=200) — length of string *s*.
The second line contains a string *s* consisting of lowercase and uppercase Latin letters.
|
Print maximum number of elements in pretty set of positions for string *s*.
|
[
"11\naaaaBaabAbA\n",
"12\nzACaAbbaazzC\n",
"3\nABC\n"
] |
[
"2\n",
"3\n",
"0\n"
] |
In the first example the desired positions might be 6 and 8 or 7 and 8. Positions 6 and 7 contain letters 'a', position 8 contains letter 'b'. The pair of positions 1 and 8 is not suitable because there is an uppercase letter 'B' between these position.
In the second example desired positions can be 7, 8 and 11. There are other ways to choose pretty set consisting of three elements.
In the third example the given string *s* does not contain any lowercase letters, so the answer is 0.
| 1,000
|
[
{
"input": "11\naaaaBaabAbA",
"output": "2"
},
{
"input": "12\nzACaAbbaazzC",
"output": "3"
},
{
"input": "3\nABC",
"output": "0"
},
{
"input": "1\na",
"output": "1"
},
{
"input": "2\naz",
"output": "2"
},
{
"input": "200\nXbTJZqcbpYuZQEoUrbxlPXAPCtVLrRExpQzxzqzcqsqzsiisswqitswzCtJQxOavicSdBIodideVRKHPojCNHmbnrLgwJlwOpyrJJIhrUePszxSjJGeUgTtOfewPQnPVWhZAtogRPrJLwyShNQaeNsvrJwjuuBOMPCeSckBMISQzGngfOmeyfDObncyeNsihYVtQbSEh",
"output": "8"
},
{
"input": "2\nAZ",
"output": "0"
},
{
"input": "28\nAabcBabcCBNMaaaaabbbbbcccccc",
"output": "3"
},
{
"input": "200\nrsgraosldglhdoorwhkrsehjpuxrjuwgeanjgezhekprzarelduuaxdnspzjuooguuwnzkowkuhzduakdrzpnslauejhrrkalwpurpuuswdgeadlhjwzjgegwpknepazwwleulppwrlgrgedlwdzuodzropsrrkxusjnuzshdkjrxxpgzanzdrpnggdwxarpwohxdepJ",
"output": "17"
},
{
"input": "1\nk",
"output": "1"
},
{
"input": "1\nH",
"output": "0"
},
{
"input": "2\nzG",
"output": "1"
},
{
"input": "2\ngg",
"output": "1"
},
{
"input": "2\nai",
"output": "2"
},
{
"input": "20\npEjVrKWLIFCZjIHgggVU",
"output": "1"
},
{
"input": "20\niFSiiigiYFSKmDnMGcgM",
"output": "2"
},
{
"input": "20\nedxedxxxCQiIVmYEUtLi",
"output": "3"
},
{
"input": "20\nprnchweyabjvzkoqiltm",
"output": "20"
},
{
"input": "35\nQLDZNKFXKVSVLUVHRTDPQYMSTDXBELXBOTS",
"output": "0"
},
{
"input": "35\nbvZWiitgxodztelnYUyljYGnCoWluXTvBLp",
"output": "10"
},
{
"input": "35\nBTexnaeplecllxwlanarpcollawHLVMHIIF",
"output": "10"
},
{
"input": "35\nhhwxqysolegsthsvfcqiryenbujbrrScobu",
"output": "20"
},
{
"input": "26\npbgfqosklxjuzmdheyvawrictn",
"output": "26"
},
{
"input": "100\nchMRWwymTDuZDZuSTvUmmuxvSscnTasyjlwwodhzcoifeahnbmcifyeobbydwparebduoLDCgHlOsPtVRbYGGQXfnkdvrWKIwCRl",
"output": "20"
},
{
"input": "100\nhXYLXKUMBrGkjqQJTGbGWAfmztqqapdbjbhcualhypgnaieKXmhzGMnqXVlcPesskfaEVgvWQTTShRRnEtFahWDyuBzySMpugxCM",
"output": "19"
},
{
"input": "100\nucOgELrgjMrFOgtHzqgvUgtHngKJxdMFKBjfcCppciqmGZXXoiSZibgpadshyljqrwxbomzeutvnhTLGVckZUmyiFPLlwuLBFito",
"output": "23"
},
{
"input": "200\nWTCKAKLVGXSYFVMVJDUYERXNMVNTGWXUGRFCGMYXJQGLODYZTUIDENHYEGFKXFIEUILAMESAXAWZXVCZPJPEYUXBITHMTZOTMKWITGRSFHODKVJHPAHVVWTCTHIVAWAREQXWMPUWQSTPPJFHKGKELBTPUYDAVIUMGASPUEDIODRYXIWCORHOSLIBLOZUNJPHHMXEXOAY",
"output": "0"
},
{
"input": "200\neLCCuYMPPwQoNlCpPOtKWJaQJmWfHeZCKiMSpILHSKjFOYGpRMzMCfMXdDuQdBGNsCNrHIVJzEFfBZcNMwNcFjOFVJvEtUQmLbFNKVHgNDyFkFVQhUTUQDgXhMjJZgFSSiHhMKuTgZQYJqAqKBpHoHddddddddddddddddXSSYNKNnRrKuOjAVKZlRLzCjExPdHaDHBT",
"output": "1"
},
{
"input": "200\nitSYxgOLlwOoAkkkkkzzzzzzzzkzkzkzkkkkkzkzzkzUDJSKybRPBvaIDsNuWImPJvrHkKiMeYukWmtHtgZSyQsgYanZvXNbKXBlFLSUcqRnGWSriAvKxsTkDJfROqaKdzXhvJsPEDATueCraWOGEvRDWjPwXuiNpWsEnCuhDcKWOQxjBkdBqmFatWFkgKsbZuLtRGtY",
"output": "2"
},
{
"input": "200\noggqoqqogoqoggggoggqgooqggogogooogqqgggoqgggqoqogogggogggqgooqgqggqqqoqgqgoooqgqogqoggoqqgqoqgoooqoogooqoogqoqoqqgoqgoqgggogqqqoqoggoqoqqoqggqoggooqqqoqggoggqqqqqqqqqgogqgggggooogogqgggqogqgoqoqogoooq",
"output": "3"
},
{
"input": "200\nCtclUtUnmqFniaLqGRmMoUMeLyFfAgWxIZxdrBarcRQprSOGcdUYsmDbooSuOvBLgrYlgaIjJtFgcxJKHGkCXpYfVKmUbouuIqGstFrrwJzYQqjjqqppqqqqqpqqqjpjjpjqjXRYkfPhGAatOigFuItkKxkjCBLdiNMVGjmdWNMgOOvmaJEdGsWNoaERrINNKqKeQajv",
"output": "3"
},
{
"input": "200\nmeZNrhqtSTSmktGQnnNOTcnyAMTKSixxKQKiagrMqRYBqgbRlsbJhvtNeHVUuMCyZLCnsIixRYrYEAkfQOxSVqXkrPqeCZQksInzRsRKBgvIqlGVPxPQnypknSXjgMjsjElcqGsaJRbegJVAKtWcHoOnzHqzhoKReqBBsOhZYLaYJhmqOMQsizdCsQfjUDHcTtHoeYwu",
"output": "4"
},
{
"input": "200\nvFAYTHJLZaivWzSYmiuDBDUFACDSVbkImnVaXBpCgrbgmTfXKJfoglIkZxWPSeVSFPnHZDNUAqLyhjLXSuAqGLskBlDxjxGPJyGdwzlPfIekwsblIrkxzfhJeNoHywdfAGlJzqXOfQaKceSqViVFTRJEGfACnsFeSFpOYisIHJciqTMNAmgeXeublTvfWoPnddtvKIyF",
"output": "6"
},
{
"input": "200\ngnDdkqJjYvduVYDSsswZDvoCouyaYZTfhmpSakERWLhufZtthWsfbQdTGwhKYjEcrqWBOyxBbiFhdLlIjChLOPiOpYmcrJgDtXsJfmHtLrabyGKOfHQRukEtTzwoqBHfmyVXPebfcpGQacLkGWFwerszjdHpTBXGssYXmGHlcCBgBXyGJqxbVhvDffLyCrZnxonABEXV",
"output": "7"
},
{
"input": "200\nBmggKNRZBXPtJqlJaXLdKKQLDJvXpDuQGupiRQfDwCJCJvAlDDGpPZNOvXkrdKOFOEFBVfrsZjWyHPoKGzXmTAyPJGEmxCyCXpeAdTwbrMtWLmlmGNqxvuxmqpmtpuhrmxxtrquSLFYVlnSYgRJDYHWgHBbziBLZRwCIJNvbtsEdLLxmTbnjkoqSPAuzEeTYLlmejOUH",
"output": "9"
},
{
"input": "200\nMkuxcDWdcnqsrlTsejehQKrTwoOBRCUAywqSnZkDLRmVBDVoOqdZHbrInQQyeRFAjiYYmHGrBbWgWstCPfLPRdNVDXBdqFJsGQfSXbufsiogybEhKDlWfPazIuhpONwGzZWaQNwVnmhTqWdewaklgjwaumXYDGwjSeEcYXjkVtLiYSWULEnTFukIlWQGWsXwWRMJGTcI",
"output": "10"
},
{
"input": "200\nOgMBgYeuMJdjPtLybvwmGDrQEOhliaabEtwulzNEjsfnaznXUMoBbbxkLEwSQzcLrlJdjJCLGVNBxorghPxTYCoqniySJMcilpsqpBAbqdzqRUDVaYOgqGhGrxlIJkyYgkOdTUgRZwpgIkeZFXojLXpDilzirHVVadiHaMrxhzodzpdvhvrzdzxbhmhdpxqqpoDegfFQ",
"output": "11"
},
{
"input": "200\nOLaJOtwultZLiZPSYAVGIbYvbIuZkqFZXwfsqpsavCDmBMStAuUFLBVknWDXNzmiuUYIsUMGxtoadWlPYPqvqSvpYdOiJRxFzGGnnmstniltvitnrmyrblnqyruylummmlsqtqitlbulvtuitiqimuintbimqyurviuntqnnvslynlNYMpYVKYwKVTbIUVdlNGrcFZON",
"output": "12"
},
{
"input": "200\nGAcmlaqfjSAQLvXlkhxujXgSbxdFAwnoxDuldDvYmpUhTWJdcEQSdARLrozJzIgFVCkzPUztWIpaGfiKeqzoXinEjVuoKqyBHmtFjBWcRdBmyjviNlGAIkpikjAimmBgayfphrstfbjexjbttzfzfzaysxfyrjazfhtpghnbbeffjhxrjxpttesgzrnrfbgzzsRsCgmz",
"output": "15"
},
{
"input": "200\nYRvIopNqSTYDhViTqCLMwEbTTIdHkoeuBmAJWhgtOgVxlcHSsavDNzMfpwTghkBvYEtCYQxicLUxdgAcaCzOOgbQYsfnaTXFlFxbeEiGwdNvxwHzkTdKtWlqzalwniDDBDipkxfflpaqkfkgfezbkxdvzemlfohwtgytzzywmwhvzUgPlPdeAVqTPAUZbogQheRXetvT",
"output": "20"
},
{
"input": "200\nNcYVomemswLCUqVRSDKHCknlBmqeSWhVyRzQrnZaOANnTGqsRFMjpczllcEVebqpxdavzppvztxsnfmtcharzqlginndyjkawzurqkxJLXiXKNZTIIxhSQghDpjwzatEqnLMTLxwoEKpHytvWkKFDUcZjLShCiVdocxRvvJtbXHCDGpJvMwRKWLhcTFtswdLUHkbhfau",
"output": "25"
},
{
"input": "200\nDxNZuvkTkQEqdWIkLzcKAwfqvZQiptnTazydSCTIfGjDhLMrlPZiKEsqIdDhgKPAlEvXyzNwWtYorotgkcwydpabjqnzubaksdchucxtkmjzfretdmvlxgklyvicrtftvztsbiUaQorfNIYUOdwQDRsKpxLUiLknbLbinilpPXPTTwLAnXVpMHBaAcKWgDBeOFabPtXU",
"output": "26"
},
{
"input": "4\nabbc",
"output": "3"
},
{
"input": "3\naaa",
"output": "1"
},
{
"input": "3\naba",
"output": "2"
},
{
"input": "3\nabb",
"output": "2"
},
{
"input": "3\nbba",
"output": "2"
},
{
"input": "3\nAaa",
"output": "1"
},
{
"input": "3\nAba",
"output": "2"
},
{
"input": "3\naBa",
"output": "1"
},
{
"input": "3\naAa",
"output": "1"
},
{
"input": "3\naAb",
"output": "1"
},
{
"input": "3\nAaA",
"output": "1"
},
{
"input": "5\naBacd",
"output": "3"
},
{
"input": "5\naAabc",
"output": "3"
}
] | 1,535,107,534
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 55
| 124
| 0
|
n=int(input())
s=input()
sl=[]
for i in s:
sl+=[i]
for i in range(n):
if sl[i].isupper()==True:
sl[i]='A'
s=''.join(sl)
sl=s.split('A')
maxx=-1
for i in sl:
lt=[]
if len(sl)>=0:
k=0
for j in range(len(i)):
if i[j] not in lt:
k+=1
lt+=[i[j]]
maxx=max(maxx,k)
print(maxx)
|
Title: Polycarp and Letters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp loves lowercase letters and dislikes uppercase ones. Once he got a string *s* consisting only of lowercase and uppercase Latin letters.
Let *A* be a set of positions in the string. Let's call it pretty if following conditions are met:
- letters on positions from *A* in the string are all distinct and lowercase; - there are no uppercase letters in the string which are situated between positions from *A* (i.e. there is no such *j* that *s*[*j*] is an uppercase letter, and *a*1<=<<=*j*<=<<=*a*2 for some *a*1 and *a*2 from *A*).
Write a program that will determine the maximum number of elements in a pretty set of positions.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=200) — length of string *s*.
The second line contains a string *s* consisting of lowercase and uppercase Latin letters.
Output Specification:
Print maximum number of elements in pretty set of positions for string *s*.
Demo Input:
['11\naaaaBaabAbA\n', '12\nzACaAbbaazzC\n', '3\nABC\n']
Demo Output:
['2\n', '3\n', '0\n']
Note:
In the first example the desired positions might be 6 and 8 or 7 and 8. Positions 6 and 7 contain letters 'a', position 8 contains letter 'b'. The pair of positions 1 and 8 is not suitable because there is an uppercase letter 'B' between these position.
In the second example desired positions can be 7, 8 and 11. There are other ways to choose pretty set consisting of three elements.
In the third example the given string *s* does not contain any lowercase letters, so the answer is 0.
|
```python
n=int(input())
s=input()
sl=[]
for i in s:
sl+=[i]
for i in range(n):
if sl[i].isupper()==True:
sl[i]='A'
s=''.join(sl)
sl=s.split('A')
maxx=-1
for i in sl:
lt=[]
if len(sl)>=0:
k=0
for j in range(len(i)):
if i[j] not in lt:
k+=1
lt+=[i[j]]
maxx=max(maxx,k)
print(maxx)
```
| 3
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,696,000,890
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 31
| 0
|
nums = input()
x , y , z = map(int , nums.split())
a = x * y
b = z * z
if a % b == 0 :
a = a / b
else :
while b :
a , b = b , a % b
print(int(a))
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
nums = input()
x , y , z = map(int , nums.split())
a = x * y
b = z * z
if a % b == 0 :
a = a / b
else :
while b :
a , b = b , a % b
print(int(a))
```
| 0
|
379
|
A
|
New Year Candles
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
|
The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000).
|
Print a single integer — the number of hours Vasily can light up the room for.
|
[
"4 2\n",
"6 3\n"
] |
[
"7\n",
"8\n"
] |
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
| 500
|
[
{
"input": "4 2",
"output": "7"
},
{
"input": "6 3",
"output": "8"
},
{
"input": "1000 1000",
"output": "1001"
},
{
"input": "123 5",
"output": "153"
},
{
"input": "1000 2",
"output": "1999"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "2 2",
"output": "3"
},
{
"input": "3 2",
"output": "5"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "999 2",
"output": "1997"
},
{
"input": "1000 3",
"output": "1499"
},
{
"input": "1000 4",
"output": "1333"
},
{
"input": "1 1000",
"output": "1"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "10 4",
"output": "13"
},
{
"input": "4 3",
"output": "5"
},
{
"input": "91 5",
"output": "113"
},
{
"input": "777 17",
"output": "825"
},
{
"input": "100 4",
"output": "133"
},
{
"input": "5 3",
"output": "7"
},
{
"input": "6 4",
"output": "7"
},
{
"input": "26 8",
"output": "29"
},
{
"input": "9 4",
"output": "11"
},
{
"input": "20 3",
"output": "29"
},
{
"input": "17 3",
"output": "25"
}
] | 1,645,943,302
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 31
| 0
|
x=input()
x=x.split(" ")
a=int(x[0])
b=int(x[1])
sum=a
while a>=b:
sum+=a/b
a=a%b
print(int(sum))
|
Title: New Year Candles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
Input Specification:
The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000).
Output Specification:
Print a single integer — the number of hours Vasily can light up the room for.
Demo Input:
['4 2\n', '6 3\n']
Demo Output:
['7\n', '8\n']
Note:
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
|
```python
x=input()
x=x.split(" ")
a=int(x[0])
b=int(x[1])
sum=a
while a>=b:
sum+=a/b
a=a%b
print(int(sum))
```
| 0
|
|
842
|
B
|
Gleb And Pizza
|
PROGRAMMING
| 1,100
|
[
"geometry"
] | null | null |
Gleb ordered pizza home. When the courier delivered the pizza, he was very upset, because several pieces of sausage lay on the crust, and he does not really like the crust.
The pizza is a circle of radius *r* and center at the origin. Pizza consists of the main part — circle of radius *r*<=-<=*d* with center at the origin, and crust around the main part of the width *d*. Pieces of sausage are also circles. The radius of the *i* -th piece of the sausage is *r**i*, and the center is given as a pair (*x**i*, *y**i*).
Gleb asks you to help determine the number of pieces of sausage caught on the crust. A piece of sausage got on the crust, if it completely lies on the crust.
|
First string contains two integer numbers *r* and *d* (0<=≤<=*d*<=<<=*r*<=≤<=500) — the radius of pizza and the width of crust.
Next line contains one integer number *n* — the number of pieces of sausage (1<=≤<=*n*<=≤<=105).
Each of next *n* lines contains three integer numbers *x**i*, *y**i* and *r**i* (<=-<=500<=≤<=*x**i*,<=*y**i*<=≤<=500, 0<=≤<=*r**i*<=≤<=500), where *x**i* and *y**i* are coordinates of the center of *i*-th peace of sausage, *r**i* — radius of *i*-th peace of sausage.
|
Output the number of pieces of sausage that lay on the crust.
|
[
"8 4\n7\n7 8 1\n-7 3 2\n0 2 1\n0 -2 2\n-3 -3 1\n0 6 2\n5 3 1\n",
"10 8\n4\n0 0 9\n0 0 10\n1 0 1\n1 0 2\n"
] |
[
"2\n",
"0\n"
] |
Below is a picture explaining the first example. Circles of green color denote pieces of sausage lying on the crust.
| 1,000
|
[
{
"input": "8 4\n7\n7 8 1\n-7 3 2\n0 2 1\n0 -2 2\n-3 -3 1\n0 6 2\n5 3 1",
"output": "2"
},
{
"input": "10 8\n4\n0 0 9\n0 0 10\n1 0 1\n1 0 2",
"output": "0"
},
{
"input": "1 0\n1\n1 1 0",
"output": "0"
},
{
"input": "3 0\n5\n3 0 0\n0 3 0\n-3 0 0\n0 -3 0\n3 0 1",
"output": "4"
},
{
"input": "9 0\n5\n8 1 0\n8 2 0\n8 3 0\n-8 3 0\n-8 2 0",
"output": "0"
},
{
"input": "10 2\n11\n1 1 0\n2 2 3\n3 3 0\n4 4 0\n5 5 0\n6 6 0\n7 7 4\n8 8 7\n9 9 3\n10 10 100\n9 0 1",
"output": "2"
},
{
"input": "5 3\n1\n500 500 10",
"output": "0"
}
] | 1,504,020,624
| 1,524
|
Python 3
|
WRONG_ANSWER
|
PRETESTS
| 4
| 46
| 0
|
import sys, os
def lo(a, b, f):
global r, d
k = (a ** 2 + b ** 2) ** 0.5
if d == 0:
if k + f <= r:
return True
if k - f >= d and k + f <= r:
return True
return False
r, d = map(int, input().split())
n = int(input())
res = 0
for i in range(n):
a, b, f = map(int, input().split())
if lo(a, b, f):
res += 1
if [r, d] == [0, 0] or r == d:
res = 0
print(res)
|
Title: Gleb And Pizza
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Gleb ordered pizza home. When the courier delivered the pizza, he was very upset, because several pieces of sausage lay on the crust, and he does not really like the crust.
The pizza is a circle of radius *r* and center at the origin. Pizza consists of the main part — circle of radius *r*<=-<=*d* with center at the origin, and crust around the main part of the width *d*. Pieces of sausage are also circles. The radius of the *i* -th piece of the sausage is *r**i*, and the center is given as a pair (*x**i*, *y**i*).
Gleb asks you to help determine the number of pieces of sausage caught on the crust. A piece of sausage got on the crust, if it completely lies on the crust.
Input Specification:
First string contains two integer numbers *r* and *d* (0<=≤<=*d*<=<<=*r*<=≤<=500) — the radius of pizza and the width of crust.
Next line contains one integer number *n* — the number of pieces of sausage (1<=≤<=*n*<=≤<=105).
Each of next *n* lines contains three integer numbers *x**i*, *y**i* and *r**i* (<=-<=500<=≤<=*x**i*,<=*y**i*<=≤<=500, 0<=≤<=*r**i*<=≤<=500), where *x**i* and *y**i* are coordinates of the center of *i*-th peace of sausage, *r**i* — radius of *i*-th peace of sausage.
Output Specification:
Output the number of pieces of sausage that lay on the crust.
Demo Input:
['8 4\n7\n7 8 1\n-7 3 2\n0 2 1\n0 -2 2\n-3 -3 1\n0 6 2\n5 3 1\n', '10 8\n4\n0 0 9\n0 0 10\n1 0 1\n1 0 2\n']
Demo Output:
['2\n', '0\n']
Note:
Below is a picture explaining the first example. Circles of green color denote pieces of sausage lying on the crust.
|
```python
import sys, os
def lo(a, b, f):
global r, d
k = (a ** 2 + b ** 2) ** 0.5
if d == 0:
if k + f <= r:
return True
if k - f >= d and k + f <= r:
return True
return False
r, d = map(int, input().split())
n = int(input())
res = 0
for i in range(n):
a, b, f = map(int, input().split())
if lo(a, b, f):
res += 1
if [r, d] == [0, 0] or r == d:
res = 0
print(res)
```
| 0
|
|
22
|
A
|
Second Order Statistics
|
PROGRAMMING
| 800
|
[
"brute force"
] |
A. Second Order Statistics
|
2
|
256
|
Once Bob needed to find the second order statistics of a sequence of integer numbers. Lets choose each number from the sequence exactly once and sort them. The value on the second position is the second order statistics of the given sequence. In other words it is the smallest element strictly greater than the minimum. Help Bob solve this problem.
|
The first input line contains integer *n* (1<=≤<=*n*<=≤<=100) — amount of numbers in the sequence. The second line contains *n* space-separated integer numbers — elements of the sequence. These numbers don't exceed 100 in absolute value.
|
If the given sequence has the second order statistics, output this order statistics, otherwise output NO.
|
[
"4\n1 2 2 -4\n",
"5\n1 2 3 1 1\n"
] |
[
"1\n",
"2\n"
] |
none
| 0
|
[
{
"input": "4\n1 2 2 -4",
"output": "1"
},
{
"input": "5\n1 2 3 1 1",
"output": "2"
},
{
"input": "1\n28",
"output": "NO"
},
{
"input": "2\n-28 12",
"output": "12"
},
{
"input": "3\n-83 40 -80",
"output": "-80"
},
{
"input": "8\n93 77 -92 26 21 -48 53 91",
"output": "-48"
},
{
"input": "20\n-72 -9 -86 80 7 -10 40 -27 -94 92 96 56 28 -19 79 36 -3 -73 -63 -49",
"output": "-86"
},
{
"input": "49\n-74 -100 -80 23 -8 -83 -41 -20 48 17 46 -73 -55 67 85 4 40 -60 -69 -75 56 -74 -42 93 74 -95 64 -46 97 -47 55 0 -78 -34 -31 40 -63 -49 -76 48 21 -1 -49 -29 -98 -11 76 26 94",
"output": "-98"
},
{
"input": "88\n63 48 1 -53 -89 -49 64 -70 -49 71 -17 -16 76 81 -26 -50 67 -59 -56 97 2 100 14 18 -91 -80 42 92 -25 -88 59 8 -56 38 48 -71 -78 24 -14 48 -1 69 73 -76 54 16 -92 44 47 33 -34 -17 -81 21 -59 -61 53 26 10 -76 67 35 -29 70 65 -13 -29 81 80 32 74 -6 34 46 57 1 -45 -55 69 79 -58 11 -2 22 -18 -16 -89 -46",
"output": "-91"
},
{
"input": "100\n34 32 88 20 76 53 -71 -39 -98 -10 57 37 63 -3 -54 -64 -78 -82 73 20 -30 -4 22 75 51 -64 -91 29 -52 -48 83 19 18 -47 46 57 -44 95 89 89 -30 84 -83 67 58 -99 -90 -53 92 -60 -5 -56 -61 27 68 -48 52 -95 64 -48 -30 -67 66 89 14 -33 -31 -91 39 7 -94 -54 92 -96 -99 -83 -16 91 -28 -66 81 44 14 -85 -21 18 40 16 -13 -82 -33 47 -10 -40 -19 10 25 60 -34 -89",
"output": "-98"
},
{
"input": "2\n-1 -1",
"output": "NO"
},
{
"input": "3\n-2 -2 -2",
"output": "NO"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100",
"output": "100"
},
{
"input": "10\n40 71 -85 -85 40 -85 -85 64 -85 47",
"output": "40"
},
{
"input": "23\n-90 -90 -41 -64 -64 -90 -15 10 -43 -90 -64 -64 89 -64 36 47 38 -90 -64 -90 -90 68 -90",
"output": "-64"
},
{
"input": "39\n-97 -93 -42 -93 -97 -93 56 -97 -97 -97 76 -33 -60 91 7 82 17 47 -97 -97 -93 73 -97 12 -97 -97 -97 -97 56 -92 -83 -93 -93 49 -93 -97 -97 -17 -93",
"output": "-93"
},
{
"input": "51\n-21 6 -35 -98 -86 -98 -86 -43 -65 32 -98 -40 96 -98 -98 -98 -98 -86 -86 -98 56 -86 -98 -98 -30 -98 -86 -31 -98 -86 -86 -86 -86 -30 96 -86 -86 -86 -60 25 88 -86 -86 58 31 -47 57 -86 37 44 -83",
"output": "-86"
},
{
"input": "66\n-14 -95 65 -95 -95 -97 -90 -71 -97 -97 70 -95 -95 -97 -95 -27 35 -87 -95 -5 -97 -97 87 34 -49 -95 -97 -95 -97 -95 -30 -95 -97 47 -95 -17 -97 -95 -97 -69 51 -97 -97 -95 -75 87 59 21 63 56 76 -91 98 -97 6 -97 -95 -95 -97 -73 11 -97 -35 -95 -95 -43",
"output": "-95"
},
{
"input": "77\n-67 -93 -93 -92 97 29 93 -93 -93 -5 -93 -7 60 -92 -93 44 -84 68 -92 -93 69 -92 -37 56 43 -93 35 -92 -93 19 -79 18 -92 -93 -93 -37 -93 -47 -93 -92 -92 74 67 19 40 -92 -92 -92 -92 -93 -93 -41 -93 -92 -93 -93 -92 -93 51 -80 6 -42 -92 -92 -66 -12 -92 -92 -3 93 -92 -49 -93 40 62 -92 -92",
"output": "-92"
},
{
"input": "89\n-98 40 16 -87 -98 63 -100 55 -96 -98 -21 -100 -93 26 -98 -98 -100 -89 -98 -5 -65 -28 -100 -6 -66 67 -100 -98 -98 10 -98 -98 -70 7 -98 2 -100 -100 -98 25 -100 -100 -98 23 -68 -100 -98 3 98 -100 -98 -98 -98 -98 -24 -100 -100 -9 -98 35 -100 99 -5 -98 -100 -100 37 -100 -84 57 -98 40 -47 -100 -1 -92 -76 -98 -98 -100 -100 -100 -63 30 21 -100 -100 -100 -12",
"output": "-98"
},
{
"input": "99\n10 -84 -100 -100 73 -64 -100 -94 33 -100 -100 -100 -100 71 64 24 7 -100 -32 -100 -100 77 -100 62 -12 55 45 -100 -100 -80 -100 -100 -100 -100 -100 -100 -100 -100 -100 -39 -48 -100 -34 47 -100 -100 -100 -100 -100 -77 -100 -100 -100 -100 -100 -100 -52 40 -55 -100 -44 -100 72 33 70 -100 -100 -78 -100 -3 100 -77 22 -100 95 -30 -100 10 -69 -100 -100 -100 -100 52 -39 -100 -100 -100 7 -100 -98 -66 95 -17 -100 52 -100 68 -100",
"output": "-98"
},
{
"input": "100\n-99 -98 -64 89 53 57 -99 29 -78 18 -3 -54 76 -98 -99 -98 37 -98 19 -47 89 73 -98 -91 -99 -99 -98 -48 -99 22 -99 -98 -99 -99 -98 -60 84 67 -99 -98 20 -98 88 -98 46 -98 -99 -98 -99 -71 -99 -98 -98 -39 83 95 -98 63 -98 -99 32 -98 -99 -64 57 -30 -53 -83 -4 -99 58 20 -98 -10 -99 -44 -99 -99 -99 -99 75 34 -98 -52 -98 -30 -98 -99 -98 -98 51 -99 -99 -99 -98 -99 -99 -82 -90 92",
"output": "-98"
},
{
"input": "3\n1 2 3",
"output": "2"
},
{
"input": "3\n1 3 2",
"output": "2"
},
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "3\n2 3 1",
"output": "2"
},
{
"input": "3\n3 1 2",
"output": "2"
},
{
"input": "3\n3 2 1",
"output": "2"
},
{
"input": "9\n99 99 99 99 100 100 100 100 100",
"output": "100"
},
{
"input": "5\n-100 -100 -100 -100 -100",
"output": "NO"
}
] | 1,691,789,367
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 62
| 0
|
x = int(input())
l = []
i = 0
c = True
while i < x:
i += 1
z = input()
l.append(z)
l.sort()
for i in range(len(l) - 1): # Notice the change in the loop range
if l[i] != l[i + 1]:
print(l[i + 1])
c = False
break
if c == True:
print("NO")
|
Title: Second Order Statistics
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Once Bob needed to find the second order statistics of a sequence of integer numbers. Lets choose each number from the sequence exactly once and sort them. The value on the second position is the second order statistics of the given sequence. In other words it is the smallest element strictly greater than the minimum. Help Bob solve this problem.
Input Specification:
The first input line contains integer *n* (1<=≤<=*n*<=≤<=100) — amount of numbers in the sequence. The second line contains *n* space-separated integer numbers — elements of the sequence. These numbers don't exceed 100 in absolute value.
Output Specification:
If the given sequence has the second order statistics, output this order statistics, otherwise output NO.
Demo Input:
['4\n1 2 2 -4\n', '5\n1 2 3 1 1\n']
Demo Output:
['1\n', '2\n']
Note:
none
|
```python
x = int(input())
l = []
i = 0
c = True
while i < x:
i += 1
z = input()
l.append(z)
l.sort()
for i in range(len(l) - 1): # Notice the change in the loop range
if l[i] != l[i + 1]:
print(l[i + 1])
c = False
break
if c == True:
print("NO")
```
| -1
|
135
|
A
|
Replacement
|
PROGRAMMING
| 1,300
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
Little Petya very much likes arrays consisting of *n* integers, where each of them is in the range from 1 to 109, inclusive. Recently he has received one such array as a gift from his mother. Petya didn't like it at once. He decided to choose exactly one element from the array and replace it with another integer that also lies in the range from 1 to 109, inclusive. It is not allowed to replace a number with itself or to change no number at all.
After the replacement Petya sorted the array by the numbers' non-decreasing. Now he wants to know for each position: what minimum number could occupy it after the replacement and the sorting.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), which represents how many numbers the array has. The next line contains *n* space-separated integers — the array's description. All elements of the array lie in the range from 1 to 109, inclusive.
|
Print *n* space-separated integers — the minimum possible values of each array element after one replacement and the sorting are performed.
|
[
"5\n1 2 3 4 5\n",
"5\n2 3 4 5 6\n",
"3\n2 2 2\n"
] |
[
"1 1 2 3 4\n",
"1 2 3 4 5\n",
"1 2 2\n"
] |
none
| 500
|
[
{
"input": "5\n1 2 3 4 5",
"output": "1 1 2 3 4"
},
{
"input": "5\n2 3 4 5 6",
"output": "1 2 3 4 5"
},
{
"input": "3\n2 2 2",
"output": "1 2 2"
},
{
"input": "4\n1 1 2 3",
"output": "1 1 1 2"
},
{
"input": "3\n1 1 1",
"output": "1 1 2"
},
{
"input": "10\n5 6 1 2 3 1 3 45 7 1000000000",
"output": "1 1 1 2 3 3 5 6 7 45"
},
{
"input": "4\n1000000000 234765 3485636 385634876",
"output": "1 234765 3485636 385634876"
},
{
"input": "1\n1",
"output": "2"
},
{
"input": "25\n1 1 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 1 2",
"output": "1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2"
},
{
"input": "2\n2 1",
"output": "1 1"
},
{
"input": "3\n1 2 1",
"output": "1 1 1"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "1\n4",
"output": "1"
},
{
"input": "3\n1 1 2",
"output": "1 1 1"
},
{
"input": "2\n1 2",
"output": "1 1"
},
{
"input": "2\n1 3",
"output": "1 1"
},
{
"input": "2\n1 1",
"output": "1 2"
},
{
"input": "2\n5 5",
"output": "1 5"
},
{
"input": "1\n5",
"output": "1"
}
] | 1,597,170,154
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 154
| 6,656,000
|
n=int(input())
a=list(map(int,input().split()))
if a[-1]==1:
a[-1]=2
else:
a=[1]+a[1:]
print(*a)
|
Title: Replacement
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Petya very much likes arrays consisting of *n* integers, where each of them is in the range from 1 to 109, inclusive. Recently he has received one such array as a gift from his mother. Petya didn't like it at once. He decided to choose exactly one element from the array and replace it with another integer that also lies in the range from 1 to 109, inclusive. It is not allowed to replace a number with itself or to change no number at all.
After the replacement Petya sorted the array by the numbers' non-decreasing. Now he wants to know for each position: what minimum number could occupy it after the replacement and the sorting.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), which represents how many numbers the array has. The next line contains *n* space-separated integers — the array's description. All elements of the array lie in the range from 1 to 109, inclusive.
Output Specification:
Print *n* space-separated integers — the minimum possible values of each array element after one replacement and the sorting are performed.
Demo Input:
['5\n1 2 3 4 5\n', '5\n2 3 4 5 6\n', '3\n2 2 2\n']
Demo Output:
['1 1 2 3 4\n', '1 2 3 4 5\n', '1 2 2\n']
Note:
none
|
```python
n=int(input())
a=list(map(int,input().split()))
if a[-1]==1:
a[-1]=2
else:
a=[1]+a[1:]
print(*a)
```
| 0
|
|
158
|
B
|
Taxi
|
PROGRAMMING
| 1,100
|
[
"*special",
"greedy",
"implementation"
] | null | null |
After the lessons *n* groups of schoolchildren went outside and decided to visit Polycarpus to celebrate his birthday. We know that the *i*-th group consists of *s**i* friends (1<=≤<=*s**i*<=≤<=4), and they want to go to Polycarpus together. They decided to get there by taxi. Each car can carry at most four passengers. What minimum number of cars will the children need if all members of each group should ride in the same taxi (but one taxi can take more than one group)?
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of groups of schoolchildren. The second line contains a sequence of integers *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*s**i*<=≤<=4). The integers are separated by a space, *s**i* is the number of children in the *i*-th group.
|
Print the single number — the minimum number of taxis necessary to drive all children to Polycarpus.
|
[
"5\n1 2 4 3 3\n",
"8\n2 3 4 4 2 1 3 1\n"
] |
[
"4\n",
"5\n"
] |
In the first test we can sort the children into four cars like this:
- the third group (consisting of four children), - the fourth group (consisting of three children), - the fifth group (consisting of three children), - the first and the second group (consisting of one and two children, correspondingly).
There are other ways to sort the groups into four cars.
| 1,000
|
[
{
"input": "5\n1 2 4 3 3",
"output": "4"
},
{
"input": "8\n2 3 4 4 2 1 3 1",
"output": "5"
},
{
"input": "5\n4 4 4 4 4",
"output": "5"
},
{
"input": "12\n1 1 1 1 1 1 1 1 1 1 1 1",
"output": "3"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "4\n3 2 1 3",
"output": "3"
},
{
"input": "4\n2 4 1 3",
"output": "3"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "1\n3",
"output": "1"
},
{
"input": "1\n4",
"output": "1"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n2 2",
"output": "1"
},
{
"input": "2\n3 3",
"output": "2"
},
{
"input": "2\n4 4",
"output": "2"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "2\n3 1",
"output": "1"
},
{
"input": "2\n4 1",
"output": "2"
},
{
"input": "2\n2 3",
"output": "2"
},
{
"input": "2\n4 2",
"output": "2"
},
{
"input": "2\n4 3",
"output": "2"
},
{
"input": "4\n2 2 1 1",
"output": "2"
},
{
"input": "4\n3 1 3 1",
"output": "2"
},
{
"input": "4\n1 4 1 4",
"output": "3"
},
{
"input": "4\n2 2 3 3",
"output": "3"
},
{
"input": "4\n2 4 4 2",
"output": "3"
},
{
"input": "4\n3 3 4 4",
"output": "4"
},
{
"input": "3\n1 1 2",
"output": "1"
},
{
"input": "3\n1 3 1",
"output": "2"
},
{
"input": "3\n4 1 1",
"output": "2"
},
{
"input": "3\n3 2 2",
"output": "2"
},
{
"input": "3\n2 4 2",
"output": "2"
},
{
"input": "3\n3 4 3",
"output": "3"
},
{
"input": "3\n2 2 1",
"output": "2"
},
{
"input": "3\n1 3 3",
"output": "2"
},
{
"input": "3\n4 4 1",
"output": "3"
},
{
"input": "3\n3 3 2",
"output": "3"
},
{
"input": "3\n4 2 4",
"output": "3"
},
{
"input": "3\n4 3 4",
"output": "3"
},
{
"input": "3\n4 3 2",
"output": "3"
},
{
"input": "3\n3 1 4",
"output": "2"
},
{
"input": "3\n2 1 4",
"output": "2"
},
{
"input": "3\n3 1 2",
"output": "2"
},
{
"input": "4\n4 4 3 2",
"output": "4"
},
{
"input": "4\n1 4 3 1",
"output": "3"
},
{
"input": "4\n2 2 4 1",
"output": "3"
},
{
"input": "4\n3 2 1 2",
"output": "2"
},
{
"input": "5\n2 4 2 3 4",
"output": "4"
},
{
"input": "5\n1 3 4 1 3",
"output": "3"
},
{
"input": "5\n1 1 2 4 2",
"output": "3"
},
{
"input": "5\n1 3 2 3 2",
"output": "3"
},
{
"input": "8\n1 1 2 1 1 1 3 2",
"output": "3"
},
{
"input": "78\n2 2 2 2 3 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 3 2 2 2 2 2 2 2 1 1 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "39"
},
{
"input": "7\n2 2 2 1 2 1 2",
"output": "3"
},
{
"input": "9\n3 1 2 1 1 1 1 1 1",
"output": "3"
},
{
"input": "10\n3 1 2 2 2 2 2 2 1 2",
"output": "5"
},
{
"input": "18\n1 3 3 3 1 1 3 1 1 1 3 3 3 3 1 3 1 1",
"output": "9"
},
{
"input": "26\n3 1 3 3 1 3 2 3 1 3 3 2 1 2 3 2 2 1 2 1 2 1 1 3 2 1",
"output": "13"
}
] | 1,699,019,153
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 4
| 92
| 0
|
n = int(input())
a = sorted([int(i) for i in input().split()], reverse=True)
ans1 = 0
ans2 = 0
ans3 = 0
ans4 = 0
ans = 0
for i in range(n):
if a[i] == 4:
ans4 += 1
elif a[i] == 3:
ans3 += 1
elif a[i] == 2:
ans2 += 1
else:
ans1 += 1
ans += ans4
ans += min(ans3, ans1)
ans3, ans1 = ans3 - min(ans3, ans1), ans1 - min(ans3, ans1)
ans += ans3
ans += ans2 // 2
ans2 = ans2 % 2
if ans1 > 0:
ans += min(ans2, ans1 // 2)
else:
ans += ans2
ans2, ans1 = ans2 - min(ans2, ans1 // 2), (ans1 // 2 - min(ans2, ans1 // 2)) * 2
ans += ans1 % 4 + ans1 // 4
print(ans)
|
Title: Taxi
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After the lessons *n* groups of schoolchildren went outside and decided to visit Polycarpus to celebrate his birthday. We know that the *i*-th group consists of *s**i* friends (1<=≤<=*s**i*<=≤<=4), and they want to go to Polycarpus together. They decided to get there by taxi. Each car can carry at most four passengers. What minimum number of cars will the children need if all members of each group should ride in the same taxi (but one taxi can take more than one group)?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of groups of schoolchildren. The second line contains a sequence of integers *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*s**i*<=≤<=4). The integers are separated by a space, *s**i* is the number of children in the *i*-th group.
Output Specification:
Print the single number — the minimum number of taxis necessary to drive all children to Polycarpus.
Demo Input:
['5\n1 2 4 3 3\n', '8\n2 3 4 4 2 1 3 1\n']
Demo Output:
['4\n', '5\n']
Note:
In the first test we can sort the children into four cars like this:
- the third group (consisting of four children), - the fourth group (consisting of three children), - the fifth group (consisting of three children), - the first and the second group (consisting of one and two children, correspondingly).
There are other ways to sort the groups into four cars.
|
```python
n = int(input())
a = sorted([int(i) for i in input().split()], reverse=True)
ans1 = 0
ans2 = 0
ans3 = 0
ans4 = 0
ans = 0
for i in range(n):
if a[i] == 4:
ans4 += 1
elif a[i] == 3:
ans3 += 1
elif a[i] == 2:
ans2 += 1
else:
ans1 += 1
ans += ans4
ans += min(ans3, ans1)
ans3, ans1 = ans3 - min(ans3, ans1), ans1 - min(ans3, ans1)
ans += ans3
ans += ans2 // 2
ans2 = ans2 % 2
if ans1 > 0:
ans += min(ans2, ans1 // 2)
else:
ans += ans2
ans2, ans1 = ans2 - min(ans2, ans1 // 2), (ans1 // 2 - min(ans2, ans1 // 2)) * 2
ans += ans1 % 4 + ans1 // 4
print(ans)
```
| 0
|
|
771
|
A
|
Bear and Friendship Condition
|
PROGRAMMING
| 1,500
|
[
"dfs and similar",
"dsu",
"graphs"
] | null | null |
Bear Limak examines a social network. Its main functionality is that two members can become friends (then they can talk with each other and share funny pictures).
There are *n* members, numbered 1 through *n*. *m* pairs of members are friends. Of course, a member can't be a friend with themselves.
Let A-B denote that members A and B are friends. Limak thinks that a network is reasonable if and only if the following condition is satisfied: For every three distinct members (X, Y, Z), if X-Y and Y-Z then also X-Z.
For example: if Alan and Bob are friends, and Bob and Ciri are friends, then Alan and Ciri should be friends as well.
Can you help Limak and check if the network is reasonable? Print "YES" or "NO" accordingly, without the quotes.
|
The first line of the input contain two integers *n* and *m* (3<=≤<=*n*<=≤<=150<=000, ) — the number of members and the number of pairs of members that are friends.
The *i*-th of the next *m* lines contains two distinct integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=*a**i*<=≠<=*b**i*). Members *a**i* and *b**i* are friends with each other. No pair of members will appear more than once in the input.
|
If the given network is reasonable, print "YES" in a single line (without the quotes). Otherwise, print "NO" in a single line (without the quotes).
|
[
"4 3\n1 3\n3 4\n1 4\n",
"4 4\n3 1\n2 3\n3 4\n1 2\n",
"10 4\n4 3\n5 10\n8 9\n1 2\n",
"3 2\n1 2\n2 3\n"
] |
[
"YES\n",
"NO\n",
"YES\n",
"NO\n"
] |
The drawings below show the situation in the first sample (on the left) and in the second sample (on the right). Each edge represents two members that are friends. The answer is "NO" in the second sample because members (2, 3) are friends and members (3, 4) are friends, while members (2, 4) are not.
| 250
|
[
{
"input": "4 3\n1 3\n3 4\n1 4",
"output": "YES"
},
{
"input": "4 4\n3 1\n2 3\n3 4\n1 2",
"output": "NO"
},
{
"input": "10 4\n4 3\n5 10\n8 9\n1 2",
"output": "YES"
},
{
"input": "3 2\n1 2\n2 3",
"output": "NO"
},
{
"input": "3 0",
"output": "YES"
},
{
"input": "15 42\n8 1\n3 14\n7 14\n12 3\n7 9\n6 7\n6 12\n14 12\n3 10\n10 14\n6 3\n3 13\n13 10\n7 12\n7 2\n6 10\n11 4\n9 3\n8 4\n7 3\n2 3\n2 10\n9 13\n2 14\n6 14\n13 2\n1 4\n13 6\n7 10\n13 14\n12 10\n13 7\n12 2\n9 10\n13 12\n2 6\n9 14\n6 9\n12 9\n11 1\n2 9\n11 8",
"output": "YES"
},
{
"input": "20 80\n17 4\n10 1\n11 10\n17 7\n15 10\n14 15\n13 1\n18 13\n3 13\n12 7\n9 13\n10 12\n14 12\n18 11\n4 7\n10 13\n11 3\n19 8\n14 7\n10 17\n14 3\n7 11\n11 14\n19 5\n10 14\n15 17\n3 1\n9 10\n11 1\n4 1\n11 4\n9 1\n12 3\n13 7\n1 14\n11 12\n7 1\n9 12\n18 15\n17 3\n7 15\n4 10\n7 18\n7 9\n12 17\n14 18\n3 18\n18 17\n9 15\n14 4\n14 9\n9 18\n12 4\n7 10\n15 4\n4 18\n15 13\n1 12\n7 3\n13 11\n4 13\n5 8\n12 18\n12 15\n17 9\n11 15\n3 10\n18 10\n4 3\n15 3\n13 12\n9 4\n9 11\n14 17\n13 17\n3 9\n13 14\n1 17\n15 1\n17 11",
"output": "NO"
},
{
"input": "99 26\n64 17\n48 70\n71 50\n3 50\n9 60\n61 64\n53 50\n25 12\n3 71\n71 53\n3 53\n65 70\n9 25\n9 12\n59 56\n39 60\n64 69\n65 94\n70 94\n25 60\n60 12\n94 48\n17 69\n61 17\n65 48\n61 69",
"output": "NO"
},
{
"input": "3 1\n1 2",
"output": "YES"
},
{
"input": "3 2\n3 2\n1 3",
"output": "NO"
},
{
"input": "3 3\n2 3\n1 2\n1 3",
"output": "YES"
},
{
"input": "4 2\n4 1\n2 1",
"output": "NO"
},
{
"input": "4 3\n3 1\n2 1\n3 2",
"output": "YES"
},
{
"input": "5 9\n1 2\n5 1\n3 1\n1 4\n2 4\n5 3\n5 4\n2 3\n5 2",
"output": "NO"
},
{
"input": "10 5\n9 5\n1 2\n6 8\n6 3\n10 6",
"output": "NO"
},
{
"input": "10 8\n10 7\n9 7\n5 7\n6 8\n3 5\n8 10\n3 4\n7 8",
"output": "NO"
},
{
"input": "10 20\n8 2\n8 3\n1 8\n9 5\n2 4\n10 1\n10 5\n7 5\n7 8\n10 7\n6 5\n3 7\n1 9\n9 8\n7 2\n2 10\n2 1\n6 4\n9 7\n4 3",
"output": "NO"
},
{
"input": "150000 10\n62562 50190\n48849 60549\n139470 18456\n21436 25159\n66845 120884\n99972 114453\n11631 99153\n62951 134848\n78114 146050\n136760 131762",
"output": "YES"
},
{
"input": "150000 0",
"output": "YES"
},
{
"input": "4 4\n1 2\n2 3\n3 4\n1 4",
"output": "NO"
},
{
"input": "30 73\n25 2\n2 16\n20 12\n16 20\n7 18\n11 15\n13 11\n30 29\n16 12\n12 25\n2 1\n18 14\n9 8\n28 16\n2 9\n22 21\n1 25\n12 28\n14 7\n4 9\n26 7\n14 27\n12 2\n29 22\n1 9\n13 15\n3 10\n1 12\n8 20\n30 24\n25 20\n4 1\n4 12\n20 1\n8 4\n2 28\n25 16\n16 8\n20 4\n9 12\n21 30\n23 11\n19 6\n28 4\n29 21\n9 28\n30 10\n22 24\n25 8\n27 26\n25 4\n28 20\n9 25\n24 29\n20 9\n18 26\n1 28\n30 22\n23 15\n28 27\n8 2\n23 13\n12 8\n14 26\n16 4\n28 25\n8 1\n4 2\n9 16\n20 2\n18 27\n28 8\n27 7",
"output": "NO"
},
{
"input": "5 4\n1 2\n2 5\n3 4\n4 5",
"output": "NO"
},
{
"input": "4 4\n1 2\n2 3\n3 4\n4 1",
"output": "NO"
},
{
"input": "6 6\n1 2\n2 4\n4 3\n1 5\n5 6\n6 3",
"output": "NO"
},
{
"input": "3 2\n1 2\n1 3",
"output": "NO"
},
{
"input": "6 6\n1 2\n2 3\n3 4\n4 5\n5 6\n1 6",
"output": "NO"
},
{
"input": "4 4\n1 2\n1 3\n2 4\n3 4",
"output": "NO"
},
{
"input": "6 9\n1 4\n1 5\n1 6\n2 4\n2 5\n2 6\n3 4\n3 5\n3 6",
"output": "NO"
},
{
"input": "4 3\n1 2\n1 3\n3 4",
"output": "NO"
},
{
"input": "4 3\n1 2\n1 3\n2 4",
"output": "NO"
},
{
"input": "6 6\n1 2\n2 3\n3 4\n4 5\n5 6\n6 1",
"output": "NO"
},
{
"input": "4 3\n1 2\n1 3\n1 4",
"output": "NO"
},
{
"input": "150000 3\n150000 149999\n149998 149999\n149998 150000",
"output": "YES"
},
{
"input": "10 15\n1 2\n1 3\n2 4\n2 5\n3 4\n3 5\n4 5\n1 6\n6 7\n6 8\n7 9\n7 10\n8 9\n8 10\n9 10",
"output": "NO"
},
{
"input": "5 5\n1 2\n2 3\n3 4\n4 5\n5 1",
"output": "NO"
},
{
"input": "5 4\n1 2\n1 3\n1 4\n1 5",
"output": "NO"
},
{
"input": "9 9\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 1",
"output": "NO"
},
{
"input": "4 5\n1 2\n1 3\n1 4\n2 3\n3 4",
"output": "NO"
},
{
"input": "4 4\n1 2\n1 3\n4 2\n4 3",
"output": "NO"
},
{
"input": "5 5\n1 4\n5 3\n5 1\n2 3\n4 5",
"output": "NO"
},
{
"input": "4 5\n1 2\n1 3\n2 3\n1 4\n2 4",
"output": "NO"
},
{
"input": "4 5\n1 2\n1 3\n1 4\n2 3\n2 4",
"output": "NO"
},
{
"input": "6 12\n1 2\n1 4\n1 5\n1 6\n2 3\n2 5\n2 6\n3 4\n3 5\n3 6\n4 5\n4 6",
"output": "NO"
},
{
"input": "1000 4\n100 132\n100 164\n196 132\n196 164",
"output": "NO"
}
] | 1,630,055,676
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 327
| 96,972,800
|
import sys,io,os
input=sys.stdin.readline
#input = io.BytesIO(os.read(0, os.fstat(0).st_size)).readline
import math
from math import factorial, inf, gcd, sqrt
from heapq import *
from functools import *
from itertools import *
from collections import *
from typing import *
from bisect import *
import random
sys.setrecursionlimit(10**5)
def dfs(node):
stack =[node]
visited[node]=1
element, edges = 0,0
while stack:
a = stack.pop()
element+=1
edges+= len(adj[a])
for i in adj[a]:
if visited[i]==0:
visited[i]=1
stack.append(i)
return element *(element-1)//2 == edges
n,m = map(int,input().split())
adj=[[] for i in range(n)]
for i in range(m):
a,b = map(int,input().split())
a-=1
b-=1
adj[a].append(b)
adj[b].append(a)
visited=[0]*n
h=0
for i in range(n):
if visited[i]==0:
if not dfs(i):
print('NO')
h+=1
break
if h==0:
print('YES')
|
Title: Bear and Friendship Condition
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bear Limak examines a social network. Its main functionality is that two members can become friends (then they can talk with each other and share funny pictures).
There are *n* members, numbered 1 through *n*. *m* pairs of members are friends. Of course, a member can't be a friend with themselves.
Let A-B denote that members A and B are friends. Limak thinks that a network is reasonable if and only if the following condition is satisfied: For every three distinct members (X, Y, Z), if X-Y and Y-Z then also X-Z.
For example: if Alan and Bob are friends, and Bob and Ciri are friends, then Alan and Ciri should be friends as well.
Can you help Limak and check if the network is reasonable? Print "YES" or "NO" accordingly, without the quotes.
Input Specification:
The first line of the input contain two integers *n* and *m* (3<=≤<=*n*<=≤<=150<=000, ) — the number of members and the number of pairs of members that are friends.
The *i*-th of the next *m* lines contains two distinct integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=*a**i*<=≠<=*b**i*). Members *a**i* and *b**i* are friends with each other. No pair of members will appear more than once in the input.
Output Specification:
If the given network is reasonable, print "YES" in a single line (without the quotes). Otherwise, print "NO" in a single line (without the quotes).
Demo Input:
['4 3\n1 3\n3 4\n1 4\n', '4 4\n3 1\n2 3\n3 4\n1 2\n', '10 4\n4 3\n5 10\n8 9\n1 2\n', '3 2\n1 2\n2 3\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n', 'NO\n']
Note:
The drawings below show the situation in the first sample (on the left) and in the second sample (on the right). Each edge represents two members that are friends. The answer is "NO" in the second sample because members (2, 3) are friends and members (3, 4) are friends, while members (2, 4) are not.
|
```python
import sys,io,os
input=sys.stdin.readline
#input = io.BytesIO(os.read(0, os.fstat(0).st_size)).readline
import math
from math import factorial, inf, gcd, sqrt
from heapq import *
from functools import *
from itertools import *
from collections import *
from typing import *
from bisect import *
import random
sys.setrecursionlimit(10**5)
def dfs(node):
stack =[node]
visited[node]=1
element, edges = 0,0
while stack:
a = stack.pop()
element+=1
edges+= len(adj[a])
for i in adj[a]:
if visited[i]==0:
visited[i]=1
stack.append(i)
return element *(element-1)//2 == edges
n,m = map(int,input().split())
adj=[[] for i in range(n)]
for i in range(m):
a,b = map(int,input().split())
a-=1
b-=1
adj[a].append(b)
adj[b].append(a)
visited=[0]*n
h=0
for i in range(n):
if visited[i]==0:
if not dfs(i):
print('NO')
h+=1
break
if h==0:
print('YES')
```
| 0
|
|
898
|
A
|
Rounding
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Vasya has a non-negative integer *n*. He wants to round it to nearest integer, which ends up with 0. If *n* already ends up with 0, Vasya considers it already rounded.
For example, if *n*<==<=4722 answer is 4720. If *n*<==<=5 Vasya can round it to 0 or to 10. Both ways are correct.
For given *n* find out to which integer will Vasya round it.
|
The first line contains single integer *n* (0<=≤<=*n*<=≤<=109) — number that Vasya has.
|
Print result of rounding *n*. Pay attention that in some cases answer isn't unique. In that case print any correct answer.
|
[
"5\n",
"113\n",
"1000000000\n",
"5432359\n"
] |
[
"0\n",
"110\n",
"1000000000\n",
"5432360\n"
] |
In the first example *n* = 5. Nearest integers, that ends up with zero are 0 and 10. Any of these answers is correct, so you can print 0 or 10.
| 500
|
[
{
"input": "5",
"output": "0"
},
{
"input": "113",
"output": "110"
},
{
"input": "1000000000",
"output": "1000000000"
},
{
"input": "5432359",
"output": "5432360"
},
{
"input": "999999994",
"output": "999999990"
},
{
"input": "10",
"output": "10"
},
{
"input": "9",
"output": "10"
},
{
"input": "1",
"output": "0"
},
{
"input": "0",
"output": "0"
},
{
"input": "3",
"output": "0"
},
{
"input": "4",
"output": "0"
},
{
"input": "6",
"output": "10"
},
{
"input": "7",
"output": "10"
},
{
"input": "8",
"output": "10"
},
{
"input": "19",
"output": "20"
},
{
"input": "100",
"output": "100"
},
{
"input": "997",
"output": "1000"
},
{
"input": "9994",
"output": "9990"
},
{
"input": "10002",
"output": "10000"
},
{
"input": "100000",
"output": "100000"
},
{
"input": "99999",
"output": "100000"
},
{
"input": "999999999",
"output": "1000000000"
},
{
"input": "999999998",
"output": "1000000000"
},
{
"input": "999999995",
"output": "999999990"
},
{
"input": "999999990",
"output": "999999990"
},
{
"input": "1000000",
"output": "1000000"
},
{
"input": "1000010",
"output": "1000010"
},
{
"input": "10000010",
"output": "10000010"
},
{
"input": "100000011",
"output": "100000010"
},
{
"input": "400000003",
"output": "400000000"
},
{
"input": "234234",
"output": "234230"
},
{
"input": "675621",
"output": "675620"
},
{
"input": "43532",
"output": "43530"
},
{
"input": "4576453",
"output": "4576450"
},
{
"input": "65754674",
"output": "65754670"
},
{
"input": "3245526",
"output": "3245530"
},
{
"input": "123445",
"output": "123440"
},
{
"input": "234217",
"output": "234220"
},
{
"input": "23451218",
"output": "23451220"
},
{
"input": "1231239",
"output": "1231240"
},
{
"input": "1923140",
"output": "1923140"
},
{
"input": "307910310",
"output": "307910310"
},
{
"input": "780961030",
"output": "780961030"
},
{
"input": "103509421",
"output": "103509420"
},
{
"input": "576560141",
"output": "576560140"
},
{
"input": "48851642",
"output": "48851640"
},
{
"input": "226935072",
"output": "226935070"
},
{
"input": "844450763",
"output": "844450760"
},
{
"input": "22534183",
"output": "22534180"
},
{
"input": "640049874",
"output": "640049870"
},
{
"input": "818133304",
"output": "818133300"
},
{
"input": "730616285",
"output": "730616280"
},
{
"input": "613732415",
"output": "613732410"
},
{
"input": "380991216",
"output": "380991220"
},
{
"input": "559074636",
"output": "559074640"
},
{
"input": "176590327",
"output": "176590330"
},
{
"input": "354673757",
"output": "354673760"
},
{
"input": "267156738",
"output": "267156740"
},
{
"input": "150272868",
"output": "150272870"
},
{
"input": "62755859",
"output": "62755860"
},
{
"input": "945871979",
"output": "945871980"
},
{
"input": "46",
"output": "50"
},
{
"input": "999",
"output": "1000"
},
{
"input": "1397",
"output": "1400"
}
] | 1,652,283,243
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 64
| 46
| 0
|
n=int(input())
b=str(n)
a=int(b[-1])
if a>5:
b=10-a
print(n+b)
elif a<5:
print(n-a)
elif a==5:
print(n-5)
|
Title: Rounding
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has a non-negative integer *n*. He wants to round it to nearest integer, which ends up with 0. If *n* already ends up with 0, Vasya considers it already rounded.
For example, if *n*<==<=4722 answer is 4720. If *n*<==<=5 Vasya can round it to 0 or to 10. Both ways are correct.
For given *n* find out to which integer will Vasya round it.
Input Specification:
The first line contains single integer *n* (0<=≤<=*n*<=≤<=109) — number that Vasya has.
Output Specification:
Print result of rounding *n*. Pay attention that in some cases answer isn't unique. In that case print any correct answer.
Demo Input:
['5\n', '113\n', '1000000000\n', '5432359\n']
Demo Output:
['0\n', '110\n', '1000000000\n', '5432360\n']
Note:
In the first example *n* = 5. Nearest integers, that ends up with zero are 0 and 10. Any of these answers is correct, so you can print 0 or 10.
|
```python
n=int(input())
b=str(n)
a=int(b[-1])
if a>5:
b=10-a
print(n+b)
elif a<5:
print(n-a)
elif a==5:
print(n-5)
```
| 3
|
|
879
|
B
|
Table Tennis
|
PROGRAMMING
| 1,200
|
[
"data structures",
"implementation"
] | null | null |
*n* people are standing in a line to play table tennis. At first, the first two players in the line play a game. Then the loser goes to the end of the line, and the winner plays with the next person from the line, and so on. They play until someone wins *k* games in a row. This player becomes the winner.
For each of the participants, you know the power to play table tennis, and for all players these values are different. In a game the player with greater power always wins. Determine who will be the winner.
|
The first line contains two integers: *n* and *k* (2<=≤<=*n*<=≤<=500, 2<=≤<=*k*<=≤<=1012) — the number of people and the number of wins.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — powers of the player. It's guaranteed that this line contains a valid permutation, i.e. all *a**i* are distinct.
|
Output a single integer — power of the winner.
|
[
"2 2\n1 2\n",
"4 2\n3 1 2 4\n",
"6 2\n6 5 3 1 2 4\n",
"2 10000000000\n2 1\n"
] |
[
"2 ",
"3 ",
"6 ",
"2\n"
] |
Games in the second sample:
3 plays with 1. 3 wins. 1 goes to the end of the line.
3 plays with 2. 3 wins. He wins twice in a row. He becomes the winner.
| 1,000
|
[
{
"input": "2 2\n1 2",
"output": "2 "
},
{
"input": "4 2\n3 1 2 4",
"output": "3 "
},
{
"input": "6 2\n6 5 3 1 2 4",
"output": "6 "
},
{
"input": "2 10000000000\n2 1",
"output": "2"
},
{
"input": "4 4\n1 3 4 2",
"output": "4 "
},
{
"input": "2 2147483648\n2 1",
"output": "2"
},
{
"input": "3 2\n1 3 2",
"output": "3 "
},
{
"input": "3 3\n1 2 3",
"output": "3 "
},
{
"input": "5 2\n2 1 3 4 5",
"output": "5 "
},
{
"input": "10 2\n7 10 5 8 9 3 4 6 1 2",
"output": "10 "
},
{
"input": "100 2\n62 70 29 14 12 87 94 78 39 92 84 91 61 49 60 33 69 37 19 82 42 8 45 97 81 43 54 67 1 22 77 58 65 17 18 28 25 57 16 90 40 13 4 21 68 35 15 76 73 93 56 95 79 47 74 75 30 71 66 99 41 24 88 83 5 6 31 96 38 80 27 46 51 53 2 86 32 9 20 100 26 36 63 7 52 55 23 3 50 59 48 89 85 44 34 64 10 72 11 98",
"output": "70 "
},
{
"input": "4 10\n2 1 3 4",
"output": "4"
},
{
"input": "10 2\n1 2 3 4 5 6 7 8 9 10",
"output": "10 "
},
{
"input": "10 2\n10 9 8 7 6 5 4 3 2 1",
"output": "10 "
},
{
"input": "4 1000000000000\n3 4 1 2",
"output": "4"
},
{
"input": "100 10\n19 55 91 50 31 23 60 84 38 1 22 51 27 76 28 98 11 44 61 63 15 93 52 3 66 16 53 36 18 62 35 85 78 37 73 64 87 74 46 26 82 69 49 33 83 89 56 67 71 25 39 94 96 17 21 6 47 68 34 42 57 81 13 10 54 2 48 80 20 77 4 5 59 30 90 95 45 75 8 88 24 41 40 14 97 32 7 9 65 70 100 99 72 58 92 29 79 12 86 43",
"output": "91 "
},
{
"input": "100 50\n2 4 82 12 47 63 52 91 87 45 53 1 17 25 64 50 9 13 22 54 21 30 43 24 38 33 68 11 41 78 99 23 28 18 58 67 79 10 71 56 49 61 26 29 59 20 90 74 5 75 89 8 39 95 72 42 66 98 44 32 88 35 92 3 97 55 65 51 77 27 81 76 84 69 73 85 19 46 62 100 60 37 7 36 57 6 14 83 40 48 16 70 96 15 31 93 80 86 94 34",
"output": "100 "
},
{
"input": "2 1000000000000\n1 2",
"output": "2"
},
{
"input": "5 2\n1 4 3 5 2",
"output": "4 "
},
{
"input": "5 2\n1 3 2 4 5",
"output": "3 "
},
{
"input": "4 1000000000000\n3 1 2 4",
"output": "4"
},
{
"input": "4 2\n1 3 2 4",
"output": "3 "
},
{
"input": "10 3\n8 1 9 2 3 10 4 5 6 7",
"output": "9 "
},
{
"input": "5 2\n2 1 4 3 5",
"output": "4 "
},
{
"input": "3 4294967297\n2 1 3",
"output": "3"
},
{
"input": "4 4294967297\n3 2 1 4",
"output": "4"
},
{
"input": "5 4294967298\n3 2 1 4 5",
"output": "5"
},
{
"input": "10 4\n5 4 7 1 2 9 3 6 8 10",
"output": "9 "
},
{
"input": "11 21474836489\n10 1 2 3 4 5 6 7 8 9 11",
"output": "11"
}
] | 1,659,243,851
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 32
| 46
| 0
|
n,k = map(int,input().split())
l = [*map(int,input().split())]
cnt = 0; m = l[0]; ans = 0
for i in range(1,n):
if(m>l[i]): cnt += 1
else: cnt = 0; m = l[i]
if(cnt == k): ans = m; break
if(i==n-1): ans = max(l); break
print(ans)
|
Title: Table Tennis
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
*n* people are standing in a line to play table tennis. At first, the first two players in the line play a game. Then the loser goes to the end of the line, and the winner plays with the next person from the line, and so on. They play until someone wins *k* games in a row. This player becomes the winner.
For each of the participants, you know the power to play table tennis, and for all players these values are different. In a game the player with greater power always wins. Determine who will be the winner.
Input Specification:
The first line contains two integers: *n* and *k* (2<=≤<=*n*<=≤<=500, 2<=≤<=*k*<=≤<=1012) — the number of people and the number of wins.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — powers of the player. It's guaranteed that this line contains a valid permutation, i.e. all *a**i* are distinct.
Output Specification:
Output a single integer — power of the winner.
Demo Input:
['2 2\n1 2\n', '4 2\n3 1 2 4\n', '6 2\n6 5 3 1 2 4\n', '2 10000000000\n2 1\n']
Demo Output:
['2 ', '3 ', '6 ', '2\n']
Note:
Games in the second sample:
3 plays with 1. 3 wins. 1 goes to the end of the line.
3 plays with 2. 3 wins. He wins twice in a row. He becomes the winner.
|
```python
n,k = map(int,input().split())
l = [*map(int,input().split())]
cnt = 0; m = l[0]; ans = 0
for i in range(1,n):
if(m>l[i]): cnt += 1
else: cnt = 0; m = l[i]
if(cnt == k): ans = m; break
if(i==n-1): ans = max(l); break
print(ans)
```
| 0
|
|
745
|
A
|
Hongcow Learns the Cyclic Shift
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] | null | null |
Hongcow is learning to spell! One day, his teacher gives him a word that he needs to learn to spell. Being a dutiful student, he immediately learns how to spell the word.
Hongcow has decided to try to make new words from this one. He starts by taking the word he just learned how to spell, and moves the last character of the word to the beginning of the word. He calls this a cyclic shift. He can apply cyclic shift many times. For example, consecutively applying cyclic shift operation to the word "abracadabra" Hongcow will get words "aabracadabr", "raabracadab" and so on.
Hongcow is now wondering how many distinct words he can generate by doing the cyclic shift arbitrarily many times. The initial string is also counted.
|
The first line of input will be a single string *s* (1<=≤<=|*s*|<=≤<=50), the word Hongcow initially learns how to spell. The string *s* consists only of lowercase English letters ('a'–'z').
|
Output a single integer equal to the number of distinct strings that Hongcow can obtain by applying the cyclic shift arbitrarily many times to the given string.
|
[
"abcd\n",
"bbb\n",
"yzyz\n"
] |
[
"4\n",
"1\n",
"2\n"
] |
For the first sample, the strings Hongcow can generate are "abcd", "dabc", "cdab", and "bcda".
For the second sample, no matter how many times Hongcow does the cyclic shift, Hongcow can only generate "bbb".
For the third sample, the two strings Hongcow can generate are "yzyz" and "zyzy".
| 500
|
[
{
"input": "abcd",
"output": "4"
},
{
"input": "bbb",
"output": "1"
},
{
"input": "yzyz",
"output": "2"
},
{
"input": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxy",
"output": "25"
},
{
"input": "zclkjadoprqronzclkjadoprqronzclkjadoprqron",
"output": "14"
},
{
"input": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz",
"output": "1"
},
{
"input": "xyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxy",
"output": "2"
},
{
"input": "y",
"output": "1"
},
{
"input": "ervbfotfedpozygoumbmxeaqegouaqqzqerlykhmvxvvlcaos",
"output": "49"
},
{
"input": "zyzzzyyzyyyzyyzyzyzyzyzzzyyyzzyzyyzzzzzyyyzzzzyzyy",
"output": "50"
},
{
"input": "zzfyftdezzfyftdezzfyftdezzfyftdezzfyftdezzfyftde",
"output": "8"
},
{
"input": "yehcqdlllqpuxdsaicyjjxiylahgxbygmsopjbxhtimzkashs",
"output": "49"
},
{
"input": "yyyyzzzyzzzyzyzyzyyyyyzzyzyzyyyyyzyzyyyzyzzyyzzzz",
"output": "49"
},
{
"input": "zkqcrhzlzsnwzkqcrhzlzsnwzkqcrhzlzsnwzkqcrhzlzsnw",
"output": "12"
},
{
"input": "xxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxy",
"output": "3"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaabaaaaaaaaaaaaaaaaaaaaaaaab",
"output": "25"
},
{
"input": "aabaaabaaabaaabaaabaaabaaabaaabaaabaaabaaabaaaba",
"output": "4"
},
{
"input": "pqqpqqpqqpqqpqqpqqpqqpqqpqqpqqpqqppqppqppqppqppq",
"output": "48"
},
{
"input": "zxkljaqzxkljaqzxkljaqzxkljaqzxrljaqzxkljaqzxkljaq",
"output": "49"
},
{
"input": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwx",
"output": "50"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaz",
"output": "50"
},
{
"input": "abcddcba",
"output": "8"
},
{
"input": "aabaabaabaacaabaabaabaacaabaabaabaacaabaabaabaac",
"output": "12"
},
{
"input": "aabaabcaabaabcdaabaabcaabaabcd",
"output": "15"
},
{
"input": "ababaababaaababaababaaaababaababaaababaababaaaa",
"output": "47"
},
{
"input": "ababaababaaababaababaaaababaababaaababaababaaa",
"output": "23"
},
{
"input": "aaababaab",
"output": "9"
},
{
"input": "aba",
"output": "3"
}
] | 1,532,876,391
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 108
| 0
|
def different_words(s):
return len(set(s))
print(different_words(input()))
|
Title: Hongcow Learns the Cyclic Shift
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Hongcow is learning to spell! One day, his teacher gives him a word that he needs to learn to spell. Being a dutiful student, he immediately learns how to spell the word.
Hongcow has decided to try to make new words from this one. He starts by taking the word he just learned how to spell, and moves the last character of the word to the beginning of the word. He calls this a cyclic shift. He can apply cyclic shift many times. For example, consecutively applying cyclic shift operation to the word "abracadabra" Hongcow will get words "aabracadabr", "raabracadab" and so on.
Hongcow is now wondering how many distinct words he can generate by doing the cyclic shift arbitrarily many times. The initial string is also counted.
Input Specification:
The first line of input will be a single string *s* (1<=≤<=|*s*|<=≤<=50), the word Hongcow initially learns how to spell. The string *s* consists only of lowercase English letters ('a'–'z').
Output Specification:
Output a single integer equal to the number of distinct strings that Hongcow can obtain by applying the cyclic shift arbitrarily many times to the given string.
Demo Input:
['abcd\n', 'bbb\n', 'yzyz\n']
Demo Output:
['4\n', '1\n', '2\n']
Note:
For the first sample, the strings Hongcow can generate are "abcd", "dabc", "cdab", and "bcda".
For the second sample, no matter how many times Hongcow does the cyclic shift, Hongcow can only generate "bbb".
For the third sample, the two strings Hongcow can generate are "yzyz" and "zyzy".
|
```python
def different_words(s):
return len(set(s))
print(different_words(input()))
```
| 0
|
|
337
|
A
|
Puzzles
|
PROGRAMMING
| 900
|
[
"greedy"
] | null | null |
The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces).
The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on.
Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*.
|
The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop.
|
Print a single integer — the least possible difference the teacher can obtain.
|
[
"4 6\n10 12 10 7 5 22\n"
] |
[
"5\n"
] |
Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
| 500
|
[
{
"input": "4 6\n10 12 10 7 5 22",
"output": "5"
},
{
"input": "2 2\n4 4",
"output": "0"
},
{
"input": "2 10\n4 5 6 7 8 9 10 11 12 12",
"output": "0"
},
{
"input": "4 5\n818 136 713 59 946",
"output": "759"
},
{
"input": "3 20\n446 852 783 313 549 965 40 88 86 617 479 118 768 34 47 826 366 957 463 903",
"output": "13"
},
{
"input": "2 25\n782 633 152 416 432 825 115 97 386 357 836 310 530 413 354 373 847 882 913 682 729 582 671 674 94",
"output": "3"
},
{
"input": "4 25\n226 790 628 528 114 64 239 279 619 39 894 763 763 847 525 93 882 697 999 643 650 244 159 884 190",
"output": "31"
},
{
"input": "2 50\n971 889 628 39 253 157 925 694 129 516 660 272 738 319 611 816 142 717 514 392 41 105 132 676 958 118 306 768 600 685 103 857 704 346 857 309 23 718 618 161 176 379 846 834 640 468 952 878 164 997",
"output": "0"
},
{
"input": "25 50\n582 146 750 905 313 509 402 21 488 512 32 898 282 64 579 869 37 996 377 929 975 697 666 837 311 205 116 992 533 298 648 268 54 479 792 595 152 69 267 417 184 433 894 603 988 712 24 414 301 176",
"output": "412"
},
{
"input": "49 50\n58 820 826 960 271 294 473 102 925 318 729 672 244 914 796 646 868 6 893 882 726 203 528 498 271 195 355 459 721 680 547 147 631 116 169 804 145 996 133 559 110 257 771 476 576 251 607 314 427 886",
"output": "938"
},
{
"input": "50 50\n374 573 323 744 190 806 485 247 628 336 491 606 702 321 991 678 337 579 86 240 993 208 668 686 855 205 363 177 719 249 896 919 782 434 59 647 787 996 286 216 636 212 546 903 958 559 544 126 608 993",
"output": "937"
},
{
"input": "6 50\n6 8 7 8 5 4 4 5 7 8 6 5 7 4 7 7 7 8 6 4 6 6 8 8 7 7 8 7 5 8 5 4 4 7 8 4 4 6 6 6 8 7 4 7 6 6 5 8 4 7",
"output": "0"
},
{
"input": "37 50\n14 5 11 17 8 20 19 16 20 11 17 20 16 9 14 14 13 18 11 20 8 8 8 5 19 17 6 18 10 20 9 7 12 6 14 17 4 4 10 13 7 4 11 6 20 19 12 12 15 19",
"output": "12"
},
{
"input": "40 50\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "0"
},
{
"input": "40 50\n17 20 43 26 41 37 14 8 30 35 30 24 43 8 42 9 41 50 41 35 27 32 35 43 28 36 31 16 5 7 23 16 14 29 8 39 12 16 36 18 49 39 33 37 38 6 6 27 23 17",
"output": "31"
},
{
"input": "2 2\n1000 4",
"output": "996"
},
{
"input": "2 3\n4 502 1000",
"output": "498"
},
{
"input": "3 3\n4 1000 4",
"output": "996"
}
] | 1,680,102,972
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 18
| 92
| 0
|
# n, m = map(int, input().split(' '))
# li = list(map(int, input().split(' ')))
# li.sort()
# a = li[:n]
# # print(a)
# print(max(a)-min(a))
# n, m = map(int, input().split(' '))
# li = list(map(int, input().split(' ')))
# a = []
# li.sort()
# print(li)
# for i in range(0, len(li)-n+1):
# a.append(li[i:n+i])
# print(a)
# val = 1000000000
# for i in a:
# if(max(i)-min(i) < val):
# val = max(i)-min(i)
# # print(val)
# print(val)
n, m = map(int, input().split(' '))
li = list(map(int, input().split(' ')))
a = []
val = 1000000000
li.sort()
# print(li)
for i in range(0, len(li)-n+1):
if(max(li[i:n+i])-min(li[i:n+i]) < val):
val = max(li[i:n+i])-min(li[i:n+i])
# a.append(li[i:n+i])
# if()
# print(a)
# for i in a:
# if(max(i)-min(i) < val):
# val = max(i)-min(i)
# print(val)
print(val)
|
Title: Puzzles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces).
The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on.
Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*.
Input Specification:
The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop.
Output Specification:
Print a single integer — the least possible difference the teacher can obtain.
Demo Input:
['4 6\n10 12 10 7 5 22\n']
Demo Output:
['5\n']
Note:
Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
|
```python
# n, m = map(int, input().split(' '))
# li = list(map(int, input().split(' ')))
# li.sort()
# a = li[:n]
# # print(a)
# print(max(a)-min(a))
# n, m = map(int, input().split(' '))
# li = list(map(int, input().split(' ')))
# a = []
# li.sort()
# print(li)
# for i in range(0, len(li)-n+1):
# a.append(li[i:n+i])
# print(a)
# val = 1000000000
# for i in a:
# if(max(i)-min(i) < val):
# val = max(i)-min(i)
# # print(val)
# print(val)
n, m = map(int, input().split(' '))
li = list(map(int, input().split(' ')))
a = []
val = 1000000000
li.sort()
# print(li)
for i in range(0, len(li)-n+1):
if(max(li[i:n+i])-min(li[i:n+i]) < val):
val = max(li[i:n+i])-min(li[i:n+i])
# a.append(li[i:n+i])
# if()
# print(a)
# for i in a:
# if(max(i)-min(i) < val):
# val = max(i)-min(i)
# print(val)
print(val)
```
| 3
|
|
469
|
A
|
I Wanna Be the Guy
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation"
] | null | null |
There is a game called "I Wanna Be the Guy", consisting of *n* levels. Little X and his friend Little Y are addicted to the game. Each of them wants to pass the whole game.
Little X can pass only *p* levels of the game. And Little Y can pass only *q* levels of the game. You are given the indices of levels Little X can pass and the indices of levels Little Y can pass. Will Little X and Little Y pass the whole game, if they cooperate each other?
|
The first line contains a single integer *n* (1<=≤<=<=*n*<=≤<=100).
The next line contains an integer *p* (0<=≤<=*p*<=≤<=*n*) at first, then follows *p* distinct integers *a*1,<=*a*2,<=...,<=*a**p* (1<=≤<=*a**i*<=≤<=*n*). These integers denote the indices of levels Little X can pass. The next line contains the levels Little Y can pass in the same format. It's assumed that levels are numbered from 1 to *n*.
|
If they can pass all the levels, print "I become the guy.". If it's impossible, print "Oh, my keyboard!" (without the quotes).
|
[
"4\n3 1 2 3\n2 2 4\n",
"4\n3 1 2 3\n2 2 3\n"
] |
[
"I become the guy.\n",
"Oh, my keyboard!\n"
] |
In the first sample, Little X can pass levels [1 2 3], and Little Y can pass level [2 4], so they can pass all the levels both.
In the second sample, no one can pass level 4.
| 500
|
[
{
"input": "4\n3 1 2 3\n2 2 4",
"output": "I become the guy."
},
{
"input": "4\n3 1 2 3\n2 2 3",
"output": "Oh, my keyboard!"
},
{
"input": "10\n5 8 6 1 5 4\n6 1 3 2 9 4 6",
"output": "Oh, my keyboard!"
},
{
"input": "10\n8 8 10 7 3 1 4 2 6\n8 9 5 10 3 7 2 4 8",
"output": "I become the guy."
},
{
"input": "10\n9 6 1 8 3 9 7 5 10 4\n7 1 3 2 7 6 9 5",
"output": "I become the guy."
},
{
"input": "100\n75 83 69 73 30 76 37 48 14 41 42 21 35 15 50 61 86 85 46 3 31 13 78 10 2 44 80 95 56 82 38 75 77 4 99 9 84 53 12 11 36 74 39 72 43 89 57 28 54 1 51 66 27 22 93 59 68 88 91 29 7 20 63 8 52 23 64 58 100 79 65 49 96 71 33 45\n83 50 89 73 34 28 99 67 77 44 19 60 68 42 8 27 94 85 14 39 17 78 24 21 29 63 92 32 86 22 71 81 31 82 65 48 80 59 98 3 70 55 37 12 15 72 47 9 11 33 16 7 91 74 13 64 38 84 6 61 93 90 45 69 1 54 52 100 57 10 35 49 53 75 76 43 62 5 4 18 36 96 79 23",
"output": "Oh, my keyboard!"
},
{
"input": "1\n1 1\n1 1",
"output": "I become the guy."
},
{
"input": "1\n0\n1 1",
"output": "I become the guy."
},
{
"input": "1\n1 1\n0",
"output": "I become the guy."
},
{
"input": "1\n0\n0",
"output": "Oh, my keyboard!"
},
{
"input": "100\n0\n0",
"output": "Oh, my keyboard!"
},
{
"input": "100\n44 71 70 55 49 43 16 53 7 95 58 56 38 76 67 94 20 73 29 90 25 30 8 84 5 14 77 52 99 91 66 24 39 37 22 44 78 12 63 59 32 51 15 82 34\n56 17 10 96 80 69 13 81 31 57 4 48 68 89 50 45 3 33 36 2 72 100 64 87 21 75 54 74 92 65 23 40 97 61 18 28 98 93 35 83 9 79 46 27 41 62 88 6 47 60 86 26 42 85 19 1 11",
"output": "I become the guy."
},
{
"input": "100\n78 63 59 39 11 58 4 2 80 69 22 95 90 26 65 16 30 100 66 99 67 79 54 12 23 28 45 56 70 74 60 82 73 91 68 43 92 75 51 21 17 97 86 44 62 47 85 78 72 64 50 81 71 5 57 13 31 76 87 9 49 96 25 42 19 35 88 53 7 83 38 27 29 41 89 93 10 84 18\n78 1 16 53 72 99 9 36 59 49 75 77 94 79 35 4 92 42 82 83 76 97 20 68 55 47 65 50 14 30 13 67 98 8 7 40 64 32 87 10 33 90 93 18 26 71 17 46 24 28 89 58 37 91 39 34 25 48 84 31 96 95 80 88 3 51 62 52 85 61 12 15 27 6 45 38 2 22 60",
"output": "I become the guy."
},
{
"input": "2\n2 2 1\n0",
"output": "I become the guy."
},
{
"input": "2\n1 2\n2 1 2",
"output": "I become the guy."
},
{
"input": "80\n57 40 1 47 36 69 24 76 5 72 26 4 29 62 6 60 3 70 8 64 18 37 16 14 13 21 25 7 66 68 44 74 61 39 38 33 15 63 34 65 10 23 56 51 80 58 49 75 71 12 50 57 2 30 54 27 17 52\n61 22 67 15 28 41 26 1 80 44 3 38 18 37 79 57 11 7 65 34 9 36 40 5 48 29 64 31 51 63 27 4 50 13 24 32 58 23 19 46 8 73 39 2 21 56 77 53 59 78 43 12 55 45 30 74 33 68 42 47 17 54",
"output": "Oh, my keyboard!"
},
{
"input": "100\n78 87 96 18 73 32 38 44 29 64 40 70 47 91 60 69 24 1 5 34 92 94 99 22 83 65 14 68 15 20 74 31 39 100 42 4 97 46 25 6 8 56 79 9 71 35 54 19 59 93 58 62 10 85 57 45 33 7 86 81 30 98 26 61 84 41 23 28 88 36 66 51 80 53 37 63 43 95 75\n76 81 53 15 26 37 31 62 24 87 41 39 75 86 46 76 34 4 51 5 45 65 67 48 68 23 71 27 94 47 16 17 9 96 84 89 88 100 18 52 69 42 6 92 7 64 49 12 98 28 21 99 25 55 44 40 82 19 36 30 77 90 14 43 50 3 13 95 78 35 20 54 58 11 2 1 33",
"output": "Oh, my keyboard!"
},
{
"input": "100\n77 55 26 98 13 91 78 60 23 76 12 11 36 62 84 80 18 1 68 92 81 67 19 4 2 10 17 77 96 63 15 69 46 97 82 42 83 59 50 72 14 40 89 9 52 29 56 31 74 39 45 85 22 99 44 65 95 6 90 38 54 32 49 34 3 70 75 33 94 53 21 71 5 66 73 41 100 24\n69 76 93 5 24 57 59 6 81 4 30 12 44 15 67 45 73 3 16 8 47 95 20 64 68 85 54 17 90 86 66 58 13 37 42 51 35 32 1 28 43 80 7 14 48 19 62 55 2 91 25 49 27 26 38 79 89 99 22 60 75 53 88 82 34 21 87 71 72 61",
"output": "I become the guy."
},
{
"input": "100\n74 96 32 63 12 69 72 99 15 22 1 41 79 77 71 31 20 28 75 73 85 37 38 59 42 100 86 89 55 87 68 4 24 57 52 8 92 27 56 98 95 58 34 9 45 14 11 36 66 76 61 19 25 23 78 49 90 26 80 43 70 13 65 10 5 74 81 21 44 60 97 3 47 93 6\n64 68 21 27 16 91 23 22 33 12 71 88 90 50 62 43 28 29 57 59 5 74 10 95 35 1 67 93 36 32 86 40 6 64 78 46 89 15 84 53 18 30 17 85 2 3 47 92 25 48 76 51 20 82 52 83 99 63 80 11 94 54 39 7 58",
"output": "I become the guy."
},
{
"input": "100\n75 11 98 44 47 88 94 23 78 59 70 2 43 39 34 63 71 19 42 61 30 74 14 77 97 53 92 60 67 36 37 13 6 86 62 46 41 3 25 93 7 12 27 48 55 49 31 35 51 10 57 54 95 82 28 90 73 26 17 50 81 56 20 87 40 85 72 64 99 29 91 5 80 18 24 52\n72 93 59 5 88 47 9 58 48 1 43 50 100 87 61 91 45 98 99 56 25 84 53 73 78 54 63 38 37 2 77 95 89 85 4 90 10 33 12 22 74 32 34 70 71 52 96 57 15 66 31 27 75 8 21 39 62 44 67 94 81 68 14 19 36 28 11 79 16 65 46 83 76",
"output": "Oh, my keyboard!"
},
{
"input": "3\n1 2\n2 2 3",
"output": "Oh, my keyboard!"
},
{
"input": "4\n1 2\n3 1 3 4",
"output": "I become the guy."
},
{
"input": "6\n2 1 2\n3 4 5 6",
"output": "Oh, my keyboard!"
}
] | 1,694,840,848
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
l = int(input())
1lev = set(map(int, input().split()[1:]))
2lev = set(map(int, input().split()[1:]))
levels = set(range(1, l + 1))
if levels.issubset(1lev.union(2lev)):
print("I become the guy.")
else:
print("Oh, my keyboard!")
|
Title: I Wanna Be the Guy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a game called "I Wanna Be the Guy", consisting of *n* levels. Little X and his friend Little Y are addicted to the game. Each of them wants to pass the whole game.
Little X can pass only *p* levels of the game. And Little Y can pass only *q* levels of the game. You are given the indices of levels Little X can pass and the indices of levels Little Y can pass. Will Little X and Little Y pass the whole game, if they cooperate each other?
Input Specification:
The first line contains a single integer *n* (1<=≤<=<=*n*<=≤<=100).
The next line contains an integer *p* (0<=≤<=*p*<=≤<=*n*) at first, then follows *p* distinct integers *a*1,<=*a*2,<=...,<=*a**p* (1<=≤<=*a**i*<=≤<=*n*). These integers denote the indices of levels Little X can pass. The next line contains the levels Little Y can pass in the same format. It's assumed that levels are numbered from 1 to *n*.
Output Specification:
If they can pass all the levels, print "I become the guy.". If it's impossible, print "Oh, my keyboard!" (without the quotes).
Demo Input:
['4\n3 1 2 3\n2 2 4\n', '4\n3 1 2 3\n2 2 3\n']
Demo Output:
['I become the guy.\n', 'Oh, my keyboard!\n']
Note:
In the first sample, Little X can pass levels [1 2 3], and Little Y can pass level [2 4], so they can pass all the levels both.
In the second sample, no one can pass level 4.
|
```python
l = int(input())
1lev = set(map(int, input().split()[1:]))
2lev = set(map(int, input().split()[1:]))
levels = set(range(1, l + 1))
if levels.issubset(1lev.union(2lev)):
print("I become the guy.")
else:
print("Oh, my keyboard!")
```
| -1
|
|
478
|
A
|
Initial Bet
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
There are five people playing a game called "Generosity". Each person gives some non-zero number of coins *b* as an initial bet. After all players make their bets of *b* coins, the following operation is repeated for several times: a coin is passed from one player to some other player.
Your task is to write a program that can, given the number of coins each player has at the end of the game, determine the size *b* of the initial bet or find out that such outcome of the game cannot be obtained for any positive number of coins *b* in the initial bet.
|
The input consists of a single line containing five integers *c*1,<=*c*2,<=*c*3,<=*c*4 and *c*5 — the number of coins that the first, second, third, fourth and fifth players respectively have at the end of the game (0<=≤<=*c*1,<=*c*2,<=*c*3,<=*c*4,<=*c*5<=≤<=100).
|
Print the only line containing a single positive integer *b* — the number of coins in the initial bet of each player. If there is no such value of *b*, then print the only value "-1" (quotes for clarity).
|
[
"2 5 4 0 4\n",
"4 5 9 2 1\n"
] |
[
"3\n",
"-1\n"
] |
In the first sample the following sequence of operations is possible:
1. One coin is passed from the fourth player to the second player; 1. One coin is passed from the fourth player to the fifth player; 1. One coin is passed from the first player to the third player; 1. One coin is passed from the fourth player to the second player.
| 500
|
[
{
"input": "2 5 4 0 4",
"output": "3"
},
{
"input": "4 5 9 2 1",
"output": "-1"
},
{
"input": "0 0 0 0 0",
"output": "-1"
},
{
"input": "1 2 1 2 3",
"output": "-1"
},
{
"input": "100 0 0 0 0",
"output": "20"
},
{
"input": "2 3 4 5 6",
"output": "4"
},
{
"input": "1 1 1 1 1",
"output": "1"
},
{
"input": "0 1 2 3 4",
"output": "2"
},
{
"input": "100 100 100 100 100",
"output": "100"
},
{
"input": "93 100 99 90 98",
"output": "96"
},
{
"input": "99 99 99 99 99",
"output": "99"
},
{
"input": "99 98 98 99 100",
"output": "-1"
},
{
"input": "43 83 1 0 23",
"output": "30"
},
{
"input": "43 83 1 100 23",
"output": "50"
},
{
"input": "57 83 11 4 93",
"output": "-1"
},
{
"input": "87 38 19 33 100",
"output": "-1"
},
{
"input": "56 0 0 0 4",
"output": "12"
},
{
"input": "0 0 0 0 1",
"output": "-1"
},
{
"input": "99 100 100 100 100",
"output": "-1"
}
] | 1,675,067,860
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 19
| 61
| 0
|
a, b, c, d, e=map(int, input().split())
sum=a+b+c+d+e
if(sum%5==0 and sum!=0):
print(sum//5)
else:
print(-1)
|
Title: Initial Bet
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are five people playing a game called "Generosity". Each person gives some non-zero number of coins *b* as an initial bet. After all players make their bets of *b* coins, the following operation is repeated for several times: a coin is passed from one player to some other player.
Your task is to write a program that can, given the number of coins each player has at the end of the game, determine the size *b* of the initial bet or find out that such outcome of the game cannot be obtained for any positive number of coins *b* in the initial bet.
Input Specification:
The input consists of a single line containing five integers *c*1,<=*c*2,<=*c*3,<=*c*4 and *c*5 — the number of coins that the first, second, third, fourth and fifth players respectively have at the end of the game (0<=≤<=*c*1,<=*c*2,<=*c*3,<=*c*4,<=*c*5<=≤<=100).
Output Specification:
Print the only line containing a single positive integer *b* — the number of coins in the initial bet of each player. If there is no such value of *b*, then print the only value "-1" (quotes for clarity).
Demo Input:
['2 5 4 0 4\n', '4 5 9 2 1\n']
Demo Output:
['3\n', '-1\n']
Note:
In the first sample the following sequence of operations is possible:
1. One coin is passed from the fourth player to the second player; 1. One coin is passed from the fourth player to the fifth player; 1. One coin is passed from the first player to the third player; 1. One coin is passed from the fourth player to the second player.
|
```python
a, b, c, d, e=map(int, input().split())
sum=a+b+c+d+e
if(sum%5==0 and sum!=0):
print(sum//5)
else:
print(-1)
```
| 3
|
|
867
|
A
|
Between the Offices
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
|
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
|
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower).
|
[
"4\nFSSF\n",
"2\nSF\n",
"10\nFFFFFFFFFF\n",
"10\nSSFFSFFSFF\n"
] |
[
"NO\n",
"YES\n",
"NO\n",
"YES\n"
] |
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though.
| 500
|
[
{
"input": "4\nFSSF",
"output": "NO"
},
{
"input": "2\nSF",
"output": "YES"
},
{
"input": "10\nFFFFFFFFFF",
"output": "NO"
},
{
"input": "10\nSSFFSFFSFF",
"output": "YES"
},
{
"input": "20\nSFSFFFFSSFFFFSSSSFSS",
"output": "NO"
},
{
"input": "20\nSSFFFFFSFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "20\nSSFSFSFSFSFSFSFSSFSF",
"output": "YES"
},
{
"input": "20\nSSSSFSFSSFSFSSSSSSFS",
"output": "NO"
},
{
"input": "100\nFFFSFSFSFSSFSFFSSFFFFFSSSSFSSFFFFSFFFFFSFFFSSFSSSFFFFSSFFSSFSFFSSFSSSFSFFSFSFFSFSFFSSFFSFSSSSFSFSFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFSFFFFFFFFFSFSSFFFFFFFFFFFFFFFFFFFFFFSFFSFFFFFSFFFFFFFFSFFFFFFFFFFFFFSFFFFFFFFSFFFFFFFSF",
"output": "NO"
},
{
"input": "100\nSFFSSFFFFFFSSFFFSSFSFFFFFSSFFFSFFFFFFSFSSSFSFSFFFFSFSSFFFFFFFFSFFFFFSFFFFFSSFFFSFFSFSFFFFSFFSFFFFFFF",
"output": "YES"
},
{
"input": "100\nFFFFSSSSSFFSSSFFFSFFFFFSFSSFSFFSFFSSFFSSFSFFFFFSFSFSFSFFFFFFFFFSFSFFSFFFFSFSFFFFFFFFFFFFSFSSFFSSSSFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFSSFFFFSFSFFFSFSSSFSSSSSFSSSSFFSSFFFSFSFSSFFFSSSFFSFSFSSFSFSSFSFFFSFFFFFSSFSFFFSSSFSSSFFS",
"output": "NO"
},
{
"input": "100\nFFFSSSFSFSSSSFSSFSFFSSSFFSSFSSFFSSFFSFSSSSFFFSFFFSFSFSSSFSSFSFSFSFFSSSSSFSSSFSFSFFSSFSFSSFFSSFSFFSFS",
"output": "NO"
},
{
"input": "100\nFFSSSSFSSSFSSSSFSSSFFSFSSFFSSFSSSFSSSFFSFFSSSSSSSSSSSSFSSFSSSSFSFFFSSFFFFFFSFSFSSSSSSFSSSFSFSSFSSFSS",
"output": "NO"
},
{
"input": "100\nSSSFFFSSSSFFSSSSSFSSSSFSSSFSSSSSFSSSSSSSSFSFFSSSFFSSFSSSSFFSSSSSSFFSSSSFSSSSSSFSSSFSSSSSSSFSSSSFSSSS",
"output": "NO"
},
{
"input": "100\nFSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSSSSSSFSSSSSSSSSSSSSFSSFSSSSSFSSFSSSSSSSSSFFSSSSSFSFSSSFFSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSFSSSSSSSSSSSSFSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSFS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFSFFFFFFFFFFFSFSFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFSSFFFFSFFFFFFFFFFFFFFFFFFFSFFFSSFFFFSFSFFFSFFFFFFFFFFFFFFFSSFFFFFFFFSSFFFFFFFFFFFFFFSFF",
"output": "YES"
},
{
"input": "100\nSFFSSSFFSFSFSFFFFSSFFFFSFFFFFFFFSFSFFFSFFFSFFFSFFFFSFSFFFFFFFSFFFFFFFFFFSFFSSSFFSSFFFFSFFFFSFFFFSFFF",
"output": "YES"
},
{
"input": "100\nSFFFSFFFFSFFFSSFFFSFSFFFSFFFSSFSFFFFFSFFFFFFFFSFSFSFFSFFFSFSSFSFFFSFSFFSSFSFSSSFFFFFFSSFSFFSFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSSSSFFFFSFFFFFFFSFFFFSFSFFFFSSFFFFFFFFFSFFSSFFFFFFSFSFSSFSSSFFFFFFFSFSFFFSSSFFFFFFFSFFFSSFFFFSSFFFSF",
"output": "YES"
},
{
"input": "100\nSSSFSSFFFSFSSSSFSSFSSSSFSSFFFFFSFFSSSSFFSSSFSSSFSSSSFSSSSFSSSSSSSFSFSSFFFSSFFSFFSSSSFSSFFSFSSFSFFFSF",
"output": "YES"
},
{
"input": "100\nSFFSFSSSSSSSFFSSSFSSSSFSFSSFFFSSSSSSFSSSSFSSFSSSFSSSSSSSFSSFSFFFSSFSSFSFSFSSSSSSSSSSSSFFFFSSSSSFSFFF",
"output": "YES"
},
{
"input": "100\nSSSFSFFSFSFFSSSSSFSSSFSSSFFFSSSSSSSSSFSFSFSSSSFSFSSFFFFFSSSSSSSSSSSSSSSSSSSFFSSSSSFSFSSSSFFSSSSFSSSF",
"output": "YES"
},
{
"input": "100\nSSSFSSSSSSSSSSFSSSSFSSSSSSFSSSSSSFSSSSSSSSSSSSSSFSSSFSSSFSSSSSSSSSSSFSSSSSSFSFSSSSFSSSSSSFSSSSSSSSFF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFFSSSSSSSSSFSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "2\nSS",
"output": "NO"
}
] | 1,632,783,110
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 77
| 6,758,400
|
input()
s = input()
print(["NO", "YES"][s.count("SF") > s.count("FS")])
|
Title: Between the Offices
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
Input Specification:
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
Output Specification:
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower).
Demo Input:
['4\nFSSF\n', '2\nSF\n', '10\nFFFFFFFFFF\n', '10\nSSFFSFFSFF\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n', 'YES\n']
Note:
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though.
|
```python
input()
s = input()
print(["NO", "YES"][s.count("SF") > s.count("FS")])
```
| 3
|
|
350
|
A
|
TL
|
PROGRAMMING
| 1,200
|
[
"brute force",
"greedy",
"implementation"
] | null | null |
Valera wanted to prepare a Codesecrof round. He's already got one problem and he wants to set a time limit (TL) on it.
Valera has written *n* correct solutions. For each correct solution, he knows its running time (in seconds). Valera has also wrote *m* wrong solutions and for each wrong solution he knows its running time (in seconds).
Let's suppose that Valera will set *v* seconds TL in the problem. Then we can say that a solution passes the system testing if its running time is at most *v* seconds. We can also say that a solution passes the system testing with some "extra" time if for its running time, *a* seconds, an inequality 2*a*<=≤<=*v* holds.
As a result, Valera decided to set *v* seconds TL, that the following conditions are met:
1. *v* is a positive integer; 1. all correct solutions pass the system testing; 1. at least one correct solution passes the system testing with some "extra" time; 1. all wrong solutions do not pass the system testing; 1. value *v* is minimum among all TLs, for which points 1, 2, 3, 4 hold.
Help Valera and find the most suitable TL or else state that such TL doesn't exist.
|
The first line contains two integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100). The second line contains *n* space-separated positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) — the running time of each of the *n* correct solutions in seconds. The third line contains *m* space-separated positive integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=100) — the running time of each of *m* wrong solutions in seconds.
|
If there is a valid TL value, print it. Otherwise, print -1.
|
[
"3 6\n4 5 2\n8 9 6 10 7 11\n",
"3 1\n3 4 5\n6\n"
] |
[
"5",
"-1\n"
] |
none
| 500
|
[
{
"input": "3 6\n4 5 2\n8 9 6 10 7 11",
"output": "5"
},
{
"input": "3 1\n3 4 5\n6",
"output": "-1"
},
{
"input": "2 5\n45 99\n49 41 77 83 45",
"output": "-1"
},
{
"input": "50 50\n18 13 5 34 10 36 36 12 15 11 16 17 14 36 23 45 32 24 31 18 24 32 7 1 31 3 49 8 16 23 3 39 47 43 42 38 40 22 41 1 49 47 9 8 19 15 29 30 16 18\n91 58 86 51 94 94 73 84 98 69 74 56 52 80 88 61 53 99 88 50 55 95 65 84 87 79 51 52 69 60 74 73 93 61 73 59 64 56 95 78 86 72 79 70 93 78 54 61 71 50",
"output": "49"
},
{
"input": "55 44\n93 17 74 15 34 16 41 80 26 54 94 94 86 93 20 44 63 72 39 43 67 4 37 49 76 94 5 51 64 74 11 47 77 97 57 30 42 72 71 26 8 14 67 64 49 57 30 23 40 4 76 78 87 78 79\n38 55 17 65 26 7 36 65 48 28 49 93 18 98 31 90 26 57 1 26 88 56 48 56 23 13 8 67 80 2 51 3 21 33 20 54 2 45 21 36 3 98 62 2",
"output": "-1"
},
{
"input": "32 100\n30 8 4 35 18 41 18 12 33 39 39 18 39 19 33 46 45 33 34 27 14 39 40 21 38 9 42 35 27 10 14 14\n65 49 89 64 47 78 59 52 73 51 84 82 88 63 91 99 67 87 53 99 75 47 85 82 58 47 80 50 65 91 83 90 77 52 100 88 97 74 98 99 50 93 65 61 65 65 65 96 61 51 84 67 79 90 92 83 100 100 100 95 80 54 77 51 98 64 74 62 60 96 73 74 94 55 89 60 92 65 74 79 66 81 53 47 71 51 54 85 74 97 68 72 88 94 100 85 65 63 65 90",
"output": "46"
},
{
"input": "1 50\n7\n65 52 99 78 71 19 96 72 80 15 50 94 20 35 79 95 44 41 45 53 77 50 74 66 59 96 26 84 27 48 56 84 36 78 89 81 67 34 79 74 99 47 93 92 90 96 72 28 78 66",
"output": "14"
},
{
"input": "1 1\n4\n9",
"output": "8"
},
{
"input": "1 1\n2\n4",
"output": "-1"
},
{
"input": "22 56\n49 20 42 68 15 46 98 78 82 8 7 33 50 30 75 96 36 88 35 99 19 87\n15 18 81 24 35 89 25 32 23 3 48 24 52 69 18 32 23 61 48 98 50 38 5 17 70 20 38 32 49 54 68 11 51 81 46 22 19 59 29 38 45 83 18 13 91 17 84 62 25 60 97 32 23 13 83 58",
"output": "-1"
},
{
"input": "1 1\n50\n100",
"output": "-1"
},
{
"input": "1 1\n49\n100",
"output": "98"
},
{
"input": "1 1\n100\n100",
"output": "-1"
},
{
"input": "1 1\n99\n100",
"output": "-1"
},
{
"input": "8 4\n1 2 49 99 99 95 78 98\n100 100 100 100",
"output": "99"
},
{
"input": "68 85\n43 55 2 4 72 45 19 56 53 81 18 90 11 87 47 8 94 88 24 4 67 9 21 70 25 66 65 27 46 13 8 51 65 99 37 43 71 59 71 79 32 56 49 43 57 85 95 81 40 28 60 36 72 81 60 40 16 78 61 37 29 26 15 95 70 27 50 97\n6 6 48 72 54 31 1 50 29 64 93 9 29 93 66 63 25 90 52 1 66 13 70 30 24 87 32 90 84 72 44 13 25 45 31 16 92 60 87 40 62 7 20 63 86 78 73 88 5 36 74 100 64 34 9 5 62 29 58 48 81 46 84 56 27 1 60 14 54 88 31 93 62 7 9 69 27 48 10 5 33 10 53 66 2",
"output": "-1"
},
{
"input": "5 100\n1 1 1 1 1\n77 53 38 29 97 33 64 17 78 100 27 12 42 44 20 24 44 68 58 57 65 90 8 24 4 6 74 68 61 43 25 69 8 62 36 85 67 48 69 30 35 41 42 12 87 66 50 92 53 76 38 67 85 7 80 78 53 76 94 8 37 50 4 100 4 71 10 48 34 47 83 42 25 81 64 72 25 51 53 75 43 98 53 77 94 38 81 15 89 91 72 76 7 36 27 41 88 18 19 75",
"output": "2"
},
{
"input": "3 3\n2 3 4\n8 9 10",
"output": "4"
},
{
"input": "2 1\n2 3\n15",
"output": "4"
},
{
"input": "2 1\n2 4\n4",
"output": "-1"
},
{
"input": "2 3\n4 5\n10 11 12",
"output": "8"
},
{
"input": "3 1\n2 3 3\n5",
"output": "4"
},
{
"input": "2 1\n9 10\n100",
"output": "18"
},
{
"input": "3 3\n3 12 15\n7 8 9",
"output": "-1"
},
{
"input": "2 2\n3 5\n7 8",
"output": "6"
},
{
"input": "3 3\n4 5 6\n10 11 12",
"output": "8"
},
{
"input": "3 5\n2 3 3\n6 6 6 6 2",
"output": "-1"
},
{
"input": "3 6\n4 5 3\n8 9 7 10 7 11",
"output": "6"
},
{
"input": "3 6\n4 5 2\n8 9 6 10 7 4",
"output": "-1"
},
{
"input": "2 1\n4 6\n10",
"output": "8"
},
{
"input": "1 2\n1\n3 1",
"output": "-1"
},
{
"input": "2 1\n5 6\n20",
"output": "10"
},
{
"input": "2 1\n1 5\n5",
"output": "-1"
},
{
"input": "3 2\n10 20 30\n30 40",
"output": "-1"
},
{
"input": "2 2\n5 6\n7 100",
"output": "-1"
},
{
"input": "2 1\n2 5\n7",
"output": "5"
},
{
"input": "1 1\n5\n20",
"output": "10"
},
{
"input": "2 1\n10 11\n100",
"output": "20"
},
{
"input": "1 1\n1\n10",
"output": "2"
},
{
"input": "1 1\n10\n100",
"output": "20"
}
] | 1,543,904,116
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 248
| 0
|
n, m = map(int, input().split())
a = list(map(int, input().split()))
a.sort()
b = list(map(int, input().split()))
b.sort()
res = max(2 * a[0], a[-1])
print(res if res < b[0] else -1)
|
Title: TL
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera wanted to prepare a Codesecrof round. He's already got one problem and he wants to set a time limit (TL) on it.
Valera has written *n* correct solutions. For each correct solution, he knows its running time (in seconds). Valera has also wrote *m* wrong solutions and for each wrong solution he knows its running time (in seconds).
Let's suppose that Valera will set *v* seconds TL in the problem. Then we can say that a solution passes the system testing if its running time is at most *v* seconds. We can also say that a solution passes the system testing with some "extra" time if for its running time, *a* seconds, an inequality 2*a*<=≤<=*v* holds.
As a result, Valera decided to set *v* seconds TL, that the following conditions are met:
1. *v* is a positive integer; 1. all correct solutions pass the system testing; 1. at least one correct solution passes the system testing with some "extra" time; 1. all wrong solutions do not pass the system testing; 1. value *v* is minimum among all TLs, for which points 1, 2, 3, 4 hold.
Help Valera and find the most suitable TL or else state that such TL doesn't exist.
Input Specification:
The first line contains two integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100). The second line contains *n* space-separated positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) — the running time of each of the *n* correct solutions in seconds. The third line contains *m* space-separated positive integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=100) — the running time of each of *m* wrong solutions in seconds.
Output Specification:
If there is a valid TL value, print it. Otherwise, print -1.
Demo Input:
['3 6\n4 5 2\n8 9 6 10 7 11\n', '3 1\n3 4 5\n6\n']
Demo Output:
['5', '-1\n']
Note:
none
|
```python
n, m = map(int, input().split())
a = list(map(int, input().split()))
a.sort()
b = list(map(int, input().split()))
b.sort()
res = max(2 * a[0], a[-1])
print(res if res < b[0] else -1)
```
| 3
|
|
546
|
A
|
Soldier and Bananas
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"math"
] | null | null |
A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*·*k* dollars for the *i*-th banana).
He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas?
|
The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=≤<=<=*k*,<=*w*<=<=≤<=<=1000, 0<=≤<=*n*<=≤<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants.
|
Output one integer — the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0.
|
[
"3 17 4\n"
] |
[
"13"
] |
none
| 500
|
[
{
"input": "3 17 4",
"output": "13"
},
{
"input": "1 2 1",
"output": "0"
},
{
"input": "1 1 1",
"output": "0"
},
{
"input": "1 5 6",
"output": "16"
},
{
"input": "1 1000000000 1",
"output": "0"
},
{
"input": "1000 0 1000",
"output": "500500000"
},
{
"input": "859 453892 543",
"output": "126416972"
},
{
"input": "1000 1000000000 1000",
"output": "0"
},
{
"input": "1000 500500000 1000",
"output": "0"
},
{
"input": "1000 500500001 1000",
"output": "0"
},
{
"input": "1000 500499999 1000",
"output": "1"
},
{
"input": "634 87973 214",
"output": "14497197"
},
{
"input": "432 10000 241",
"output": "12587552"
},
{
"input": "111 111111111 111",
"output": "0"
},
{
"input": "20 43 3",
"output": "77"
}
] | 1,694,229,129
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 15
| 46
| 0
|
k,n,w=map(int,input().split())
t=(w*(w+1)//2)*k
print(max(0,t-n))
|
Title: Soldier and Bananas
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*·*k* dollars for the *i*-th banana).
He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas?
Input Specification:
The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=≤<=<=*k*,<=*w*<=<=≤<=<=1000, 0<=≤<=*n*<=≤<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants.
Output Specification:
Output one integer — the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0.
Demo Input:
['3 17 4\n']
Demo Output:
['13']
Note:
none
|
```python
k,n,w=map(int,input().split())
t=(w*(w+1)//2)*k
print(max(0,t-n))
```
| 3
|
|
669
|
A
|
Little Artem and Presents
|
PROGRAMMING
| 800
|
[
"math"
] | null | null |
Little Artem got *n* stones on his birthday and now wants to give some of them to Masha. He knows that Masha cares more about the fact of receiving the present, rather than the value of that present, so he wants to give her stones as many times as possible. However, Masha remembers the last present she received, so Artem can't give her the same number of stones twice in a row. For example, he can give her 3 stones, then 1 stone, then again 3 stones, but he can't give her 3 stones and then again 3 stones right after that.
How many times can Artem give presents to Masha?
|
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=109) — number of stones Artem received on his birthday.
|
Print the maximum possible number of times Artem can give presents to Masha.
|
[
"1\n",
"2\n",
"3\n",
"4\n"
] |
[
"1\n",
"1\n",
"2\n",
"3\n"
] |
In the first sample, Artem can only give 1 stone to Masha.
In the second sample, Atrem can give Masha 1 or 2 stones, though he can't give her 1 stone two times.
In the third sample, Atrem can first give Masha 2 stones, a then 1 more stone.
In the fourth sample, Atrem can first give Masha 1 stone, then 2 stones, and finally 1 stone again.
| 500
|
[
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "1"
},
{
"input": "3",
"output": "2"
},
{
"input": "4",
"output": "3"
},
{
"input": "100",
"output": "67"
},
{
"input": "101",
"output": "67"
},
{
"input": "102",
"output": "68"
},
{
"input": "1000000000",
"output": "666666667"
},
{
"input": "5",
"output": "3"
},
{
"input": "6",
"output": "4"
},
{
"input": "999999999",
"output": "666666666"
},
{
"input": "999999998",
"output": "666666665"
},
{
"input": "999999997",
"output": "666666665"
},
{
"input": "999999996",
"output": "666666664"
},
{
"input": "999999995",
"output": "666666663"
},
{
"input": "999999994",
"output": "666666663"
},
{
"input": "999999993",
"output": "666666662"
},
{
"input": "999999992",
"output": "666666661"
},
{
"input": "999999991",
"output": "666666661"
},
{
"input": "1000",
"output": "667"
},
{
"input": "10000",
"output": "6667"
},
{
"input": "100000",
"output": "66667"
},
{
"input": "1000000",
"output": "666667"
},
{
"input": "10000000",
"output": "6666667"
},
{
"input": "100000000",
"output": "66666667"
},
{
"input": "7",
"output": "5"
}
] | 1,569,527,496
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 26
| 140
| 0
|
n = int(input())
if(n%3 == 0):
ans = (n//3)*2
else:
ans = (n//3)*2 + 1
print(ans)
|
Title: Little Artem and Presents
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Artem got *n* stones on his birthday and now wants to give some of them to Masha. He knows that Masha cares more about the fact of receiving the present, rather than the value of that present, so he wants to give her stones as many times as possible. However, Masha remembers the last present she received, so Artem can't give her the same number of stones twice in a row. For example, he can give her 3 stones, then 1 stone, then again 3 stones, but he can't give her 3 stones and then again 3 stones right after that.
How many times can Artem give presents to Masha?
Input Specification:
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=109) — number of stones Artem received on his birthday.
Output Specification:
Print the maximum possible number of times Artem can give presents to Masha.
Demo Input:
['1\n', '2\n', '3\n', '4\n']
Demo Output:
['1\n', '1\n', '2\n', '3\n']
Note:
In the first sample, Artem can only give 1 stone to Masha.
In the second sample, Atrem can give Masha 1 or 2 stones, though he can't give her 1 stone two times.
In the third sample, Atrem can first give Masha 2 stones, a then 1 more stone.
In the fourth sample, Atrem can first give Masha 1 stone, then 2 stones, and finally 1 stone again.
|
```python
n = int(input())
if(n%3 == 0):
ans = (n//3)*2
else:
ans = (n//3)*2 + 1
print(ans)
```
| 3
|
|
268
|
A
|
Games
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different.
There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number.
You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
|
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
|
In a single line print the number of games where the host team is going to play in the guest uniform.
|
[
"3\n1 2\n2 4\n3 4\n",
"4\n100 42\n42 100\n5 42\n100 5\n",
"2\n1 2\n1 2\n"
] |
[
"1\n",
"5\n",
"0\n"
] |
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2.
In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
| 500
|
[
{
"input": "3\n1 2\n2 4\n3 4",
"output": "1"
},
{
"input": "4\n100 42\n42 100\n5 42\n100 5",
"output": "5"
},
{
"input": "2\n1 2\n1 2",
"output": "0"
},
{
"input": "7\n4 7\n52 55\n16 4\n55 4\n20 99\n3 4\n7 52",
"output": "6"
},
{
"input": "10\n68 42\n1 35\n25 70\n59 79\n65 63\n46 6\n28 82\n92 62\n43 96\n37 28",
"output": "1"
},
{
"input": "30\n10 39\n89 1\n78 58\n75 99\n36 13\n77 50\n6 97\n79 28\n27 52\n56 5\n93 96\n40 21\n33 74\n26 37\n53 59\n98 56\n61 65\n42 57\n9 7\n25 63\n74 34\n96 84\n95 47\n12 23\n34 21\n71 6\n27 13\n15 47\n64 14\n12 77",
"output": "6"
},
{
"input": "30\n46 100\n87 53\n34 84\n44 66\n23 20\n50 34\n90 66\n17 39\n13 22\n94 33\n92 46\n63 78\n26 48\n44 61\n3 19\n41 84\n62 31\n65 89\n23 28\n58 57\n19 85\n26 60\n75 66\n69 67\n76 15\n64 15\n36 72\n90 89\n42 69\n45 35",
"output": "4"
},
{
"input": "2\n46 6\n6 46",
"output": "2"
},
{
"input": "29\n8 18\n33 75\n69 22\n97 95\n1 97\n78 10\n88 18\n13 3\n19 64\n98 12\n79 92\n41 72\n69 15\n98 31\n57 74\n15 56\n36 37\n15 66\n63 100\n16 42\n47 56\n6 4\n73 15\n30 24\n27 71\n12 19\n88 69\n85 6\n50 11",
"output": "10"
},
{
"input": "23\n43 78\n31 28\n58 80\n66 63\n20 4\n51 95\n40 20\n50 14\n5 34\n36 39\n77 42\n64 97\n62 89\n16 56\n8 34\n58 16\n37 35\n37 66\n8 54\n50 36\n24 8\n68 48\n85 33",
"output": "6"
},
{
"input": "13\n76 58\n32 85\n99 79\n23 58\n96 59\n72 35\n53 43\n96 55\n41 78\n75 10\n28 11\n72 7\n52 73",
"output": "0"
},
{
"input": "18\n6 90\n70 79\n26 52\n67 81\n29 95\n41 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 2",
"output": "1"
},
{
"input": "18\n6 90\n100 79\n26 100\n67 100\n29 100\n100 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 100",
"output": "8"
},
{
"input": "30\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1",
"output": "450"
},
{
"input": "30\n100 99\n58 59\n56 57\n54 55\n52 53\n50 51\n48 49\n46 47\n44 45\n42 43\n40 41\n38 39\n36 37\n34 35\n32 33\n30 31\n28 29\n26 27\n24 25\n22 23\n20 21\n18 19\n16 17\n14 15\n12 13\n10 11\n8 9\n6 7\n4 5\n2 3",
"output": "0"
},
{
"input": "15\n9 3\n2 6\n7 6\n5 10\n9 5\n8 1\n10 5\n2 8\n4 5\n9 8\n5 3\n3 8\n9 8\n4 10\n8 5",
"output": "20"
},
{
"input": "15\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n1 2",
"output": "108"
},
{
"input": "25\n2 1\n1 2\n1 2\n1 2\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n1 2\n2 1\n2 1\n2 1\n2 1\n1 2",
"output": "312"
},
{
"input": "25\n91 57\n2 73\n54 57\n2 57\n23 57\n2 6\n57 54\n57 23\n91 54\n91 23\n57 23\n91 57\n54 2\n6 91\n57 54\n2 57\n57 91\n73 91\n57 23\n91 57\n2 73\n91 2\n23 6\n2 73\n23 6",
"output": "96"
},
{
"input": "28\n31 66\n31 91\n91 31\n97 66\n31 66\n31 66\n66 91\n91 31\n97 31\n91 97\n97 31\n66 31\n66 97\n91 31\n31 66\n31 66\n66 31\n31 97\n66 97\n97 31\n31 91\n66 91\n91 66\n31 66\n91 66\n66 31\n66 31\n91 97",
"output": "210"
},
{
"input": "29\n78 27\n50 68\n24 26\n68 43\n38 78\n26 38\n78 28\n28 26\n27 24\n23 38\n24 26\n24 43\n61 50\n38 78\n27 23\n61 26\n27 28\n43 23\n28 78\n43 27\n43 78\n27 61\n28 38\n61 78\n50 26\n43 27\n26 78\n28 50\n43 78",
"output": "73"
},
{
"input": "29\n80 27\n69 80\n27 80\n69 80\n80 27\n80 27\n80 27\n80 69\n27 69\n80 69\n80 27\n27 69\n69 27\n80 69\n27 69\n69 80\n27 69\n80 69\n80 27\n69 27\n27 69\n27 80\n80 27\n69 80\n27 69\n80 69\n69 80\n69 80\n27 80",
"output": "277"
},
{
"input": "30\n19 71\n7 89\n89 71\n21 7\n19 21\n7 89\n19 71\n89 8\n89 21\n19 8\n21 7\n8 89\n19 89\n7 21\n19 8\n19 7\n7 19\n8 21\n71 21\n71 89\n7 19\n7 19\n21 7\n21 19\n21 19\n71 8\n21 8\n71 19\n19 71\n8 21",
"output": "154"
},
{
"input": "30\n44 17\n44 17\n44 17\n17 44\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n44 17\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n17 44\n44 17\n44 17\n44 17\n17 44\n17 44\n44 17\n17 44\n44 17\n44 17\n44 17",
"output": "418"
},
{
"input": "22\n78 92\n15 92\n92 78\n78 80\n92 16\n24 80\n92 16\n16 92\n78 16\n24 78\n80 78\n92 80\n16 80\n80 78\n15 78\n92 16\n24 15\n24 80\n80 16\n16 80\n92 80\n24 80",
"output": "74"
},
{
"input": "24\n9 83\n90 31\n83 3\n83 3\n21 31\n83 3\n32 31\n12 21\n31 21\n90 32\n32 21\n12 9\n12 31\n9 83\n83 12\n32 3\n32 83\n90 31\n9 32\n31 21\n83 90\n32 21\n21 3\n32 9",
"output": "59"
},
{
"input": "30\n67 21\n85 39\n85 87\n21 39\n66 85\n10 95\n10 21\n87 85\n82 21\n67 21\n95 10\n21 39\n82 21\n21 66\n66 39\n95 30\n67 85\n66 82\n85 82\n21 66\n10 39\n67 10\n21 85\n10 82\n85 95\n10 85\n21 39\n85 39\n39 10\n95 67",
"output": "100"
},
{
"input": "4\n8 7\n8 7\n7 8\n7 8",
"output": "8"
},
{
"input": "6\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1",
"output": "10"
},
{
"input": "12\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1",
"output": "72"
},
{
"input": "4\n1 2\n1 2\n2 1\n2 1",
"output": "8"
}
] | 1,694,733,992
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 92
| 0
|
n=int(input())
s=[[int(i) for i in input().split()] for j in range(n)]
z=0
for i in s:
for j in s:
if(i[0]==j[1]):
z+=1
print(z)
|
Title: Games
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different.
There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number.
You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
Input Specification:
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
Output Specification:
In a single line print the number of games where the host team is going to play in the guest uniform.
Demo Input:
['3\n1 2\n2 4\n3 4\n', '4\n100 42\n42 100\n5 42\n100 5\n', '2\n1 2\n1 2\n']
Demo Output:
['1\n', '5\n', '0\n']
Note:
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2.
In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
|
```python
n=int(input())
s=[[int(i) for i in input().split()] for j in range(n)]
z=0
for i in s:
for j in s:
if(i[0]==j[1]):
z+=1
print(z)
```
| 3
|
|
632
|
C
|
The Smallest String Concatenation
|
PROGRAMMING
| 1,700
|
[
"sortings",
"strings"
] | null | null |
You're given a list of *n* strings *a*1,<=*a*2,<=...,<=*a**n*. You'd like to concatenate them together in some order such that the resulting string would be lexicographically smallest.
Given the list of strings, output the lexicographically smallest concatenation.
|
The first line contains integer *n* — the number of strings (1<=≤<=*n*<=≤<=5·104).
Each of the next *n* lines contains one string *a**i* (1<=≤<=|*a**i*|<=≤<=50) consisting of only lowercase English letters. The sum of string lengths will not exceed 5·104.
|
Print the only string *a* — the lexicographically smallest string concatenation.
|
[
"4\nabba\nabacaba\nbcd\ner\n",
"5\nx\nxx\nxxa\nxxaa\nxxaaa\n",
"3\nc\ncb\ncba\n"
] |
[
"abacabaabbabcder\n",
"xxaaaxxaaxxaxxx\n",
"cbacbc\n"
] |
none
| 0
|
[
{
"input": "4\nabba\nabacaba\nbcd\ner",
"output": "abacabaabbabcder"
},
{
"input": "5\nx\nxx\nxxa\nxxaa\nxxaaa",
"output": "xxaaaxxaaxxaxxx"
},
{
"input": "3\nc\ncb\ncba",
"output": "cbacbc"
},
{
"input": "10\naba\nabaaca\naba\nacaaaabbac\nabaacac\nb\ncabbcccaab\nbaacbb\nbcab\ncc",
"output": "abaabaabaacaabaacacacaaaabbacbaacbbbbcabcabbcccaabcc"
},
{
"input": "13\nclgknjjojyuvdtv\nclgknjjojyuvdtvzxz\nclgknjjojyuvdtvzxzxradqhm\ngvzpnckalbaubfviyhijosiixvxaydxagvymq\nclgknjjojyuvdtvjgcwarwvgilcctdiytmvmvfxxkezymt\nbvwzpuut\nclgknjjojyuvdtvjgcwarwvgilcctdiytmvmvfxxkezymth\nclgknjjojyuvdtvjgcwarwvgilcctdiytmvmvfxxkezymtlkdl\nrbwvaayhhunlvmwexvkmqbquypsnjbdkkeytthekttywypud\nqlvkfkshkxyrfefigtngifxsuhpjgkb\nlhxtkfjrrwcvzuamizotupjqckaq\nenngvhxvpaoiyhctddyscasyqtilvbvgfphayykjeoylcvmjz\nxkazwk",
"output": "bvwzpuutclgknjjojyuvdtvclgknjjojyuvdtvjgcwarwvgilcctdiytmvmvfxxkezymtclgknjjojyuvdtvjgcwarwvgilcctdiytmvmvfxxkezymthclgknjjojyuvdtvjgcwarwvgilcctdiytmvmvfxxkezymtlkdlclgknjjojyuvdtvzxzclgknjjojyuvdtvzxzxradqhmenngvhxvpaoiyhctddyscasyqtilvbvgfphayykjeoylcvmjzgvzpnckalbaubfviyhijosiixvxaydxagvymqlhxtkfjrrwcvzuamizotupjqckaqqlvkfkshkxyrfefigtngifxsuhpjgkbrbwvaayhhunlvmwexvkmqbquypsnjbdkkeytthekttywypudxkazwk"
}
] | 1,457,006,035
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 62
| 307,200
|
n = int(input())
a , b = [] , []
for _ in range(n): a.append(input())
l = max(map(len,a))
b = list(map(list,list(a)))
for i in range(len(b)):
if len(b[i])<l:
while len(b[i]) != l:
b[i].append(b[i][0])
b = map(str,b)
b = list(zip(b,range(50010)))
b.sort()
for _,i in b:
print(a[i],end='')
|
Title: The Smallest String Concatenation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You're given a list of *n* strings *a*1,<=*a*2,<=...,<=*a**n*. You'd like to concatenate them together in some order such that the resulting string would be lexicographically smallest.
Given the list of strings, output the lexicographically smallest concatenation.
Input Specification:
The first line contains integer *n* — the number of strings (1<=≤<=*n*<=≤<=5·104).
Each of the next *n* lines contains one string *a**i* (1<=≤<=|*a**i*|<=≤<=50) consisting of only lowercase English letters. The sum of string lengths will not exceed 5·104.
Output Specification:
Print the only string *a* — the lexicographically smallest string concatenation.
Demo Input:
['4\nabba\nabacaba\nbcd\ner\n', '5\nx\nxx\nxxa\nxxaa\nxxaaa\n', '3\nc\ncb\ncba\n']
Demo Output:
['abacabaabbabcder\n', 'xxaaaxxaaxxaxxx\n', 'cbacbc\n']
Note:
none
|
```python
n = int(input())
a , b = [] , []
for _ in range(n): a.append(input())
l = max(map(len,a))
b = list(map(list,list(a)))
for i in range(len(b)):
if len(b[i])<l:
while len(b[i]) != l:
b[i].append(b[i][0])
b = map(str,b)
b = list(zip(b,range(50010)))
b.sort()
for _,i in b:
print(a[i],end='')
```
| 0
|
|
116
|
A
|
Tram
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty.
Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram.
|
The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops.
Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement.
- The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0.
|
Print a single integer denoting the minimum possible capacity of the tram (0 is allowed).
|
[
"4\n0 3\n2 5\n4 2\n4 0\n"
] |
[
"6\n"
] |
For the first example, a capacity of 6 is sufficient:
- At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints.
Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
| 500
|
[
{
"input": "4\n0 3\n2 5\n4 2\n4 0",
"output": "6"
},
{
"input": "5\n0 4\n4 6\n6 5\n5 4\n4 0",
"output": "6"
},
{
"input": "10\n0 5\n1 7\n10 8\n5 3\n0 5\n3 3\n8 8\n0 6\n10 1\n9 0",
"output": "18"
},
{
"input": "3\n0 1\n1 1\n1 0",
"output": "1"
},
{
"input": "4\n0 1\n0 1\n1 0\n1 0",
"output": "2"
},
{
"input": "3\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "3\n0 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "5\n0 73\n73 189\n189 766\n766 0\n0 0",
"output": "766"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 1\n1 0",
"output": "1"
},
{
"input": "5\n0 917\n917 923\n904 992\n1000 0\n11 0",
"output": "1011"
},
{
"input": "5\n0 1\n1 2\n2 1\n1 2\n2 0",
"output": "2"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "20\n0 7\n2 1\n2 2\n5 7\n2 6\n6 10\n2 4\n0 4\n7 4\n8 0\n10 6\n2 1\n6 1\n1 7\n0 3\n8 7\n6 3\n6 3\n1 1\n3 0",
"output": "22"
},
{
"input": "5\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "10\n0 592\n258 598\n389 203\n249 836\n196 635\n478 482\n994 987\n1000 0\n769 0\n0 0",
"output": "1776"
},
{
"input": "10\n0 1\n1 0\n0 0\n0 0\n0 0\n0 1\n1 1\n0 1\n1 0\n1 0",
"output": "2"
},
{
"input": "10\n0 926\n926 938\n938 931\n931 964\n937 989\n983 936\n908 949\n997 932\n945 988\n988 0",
"output": "1016"
},
{
"input": "10\n0 1\n1 2\n1 2\n2 2\n2 2\n2 2\n1 1\n1 1\n2 1\n2 0",
"output": "3"
},
{
"input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "10\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "50\n0 332\n332 268\n268 56\n56 711\n420 180\n160 834\n149 341\n373 777\n763 93\n994 407\n86 803\n700 132\n471 608\n429 467\n75 5\n638 305\n405 853\n316 478\n643 163\n18 131\n648 241\n241 766\n316 847\n640 380\n923 759\n789 41\n125 421\n421 9\n9 388\n388 829\n408 108\n462 856\n816 411\n518 688\n290 7\n405 912\n397 772\n396 652\n394 146\n27 648\n462 617\n514 433\n780 35\n710 705\n460 390\n194 508\n643 56\n172 469\n1000 0\n194 0",
"output": "2071"
},
{
"input": "50\n0 0\n0 1\n1 1\n0 1\n0 0\n1 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 1\n1 0\n0 1\n0 0\n1 1\n1 0\n0 1\n0 0\n1 1\n0 1\n1 0\n1 1\n1 0\n0 0\n1 1\n1 0\n0 1\n0 0\n0 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 0\n0 1\n1 0\n0 0\n0 1\n1 1\n1 1\n0 1\n0 0\n1 0\n1 0",
"output": "3"
},
{
"input": "50\n0 926\n926 971\n915 980\n920 965\n954 944\n928 952\n955 980\n916 980\n906 935\n944 913\n905 923\n912 922\n965 934\n912 900\n946 930\n931 983\n979 905\n925 969\n924 926\n910 914\n921 977\n934 979\n962 986\n942 909\n976 903\n982 982\n991 941\n954 929\n902 980\n947 983\n919 924\n917 943\n916 905\n907 913\n964 977\n984 904\n905 999\n950 970\n986 906\n993 970\n960 994\n963 983\n918 986\n980 900\n931 986\n993 997\n941 909\n907 909\n1000 0\n278 0",
"output": "1329"
},
{
"input": "2\n0 863\n863 0",
"output": "863"
},
{
"input": "50\n0 1\n1 2\n2 2\n1 1\n1 1\n1 2\n1 2\n1 1\n1 2\n1 1\n1 1\n1 2\n1 2\n1 1\n2 1\n2 2\n1 2\n2 2\n1 2\n2 1\n2 1\n2 2\n2 1\n1 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n2 2\n2 1\n1 2\n2 2\n1 2\n1 1\n1 1\n2 1\n2 1\n2 2\n2 1\n2 1\n1 2\n1 2\n1 2\n1 2\n2 0\n2 0\n2 0\n0 0",
"output": "8"
},
{
"input": "50\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "100\n0 1\n0 0\n0 0\n1 0\n0 0\n0 1\n0 1\n1 1\n0 0\n0 0\n1 1\n0 0\n1 1\n0 1\n1 1\n0 1\n1 1\n1 0\n1 0\n0 0\n1 0\n0 1\n1 0\n0 0\n0 0\n1 1\n1 1\n0 1\n0 0\n1 0\n1 1\n0 1\n1 0\n1 1\n0 1\n1 1\n1 0\n0 0\n0 0\n0 1\n0 0\n0 1\n1 1\n0 0\n1 1\n1 1\n0 0\n0 1\n1 0\n0 1\n0 0\n0 1\n0 1\n1 1\n1 1\n1 1\n0 0\n0 0\n1 1\n0 1\n0 1\n1 0\n0 0\n0 0\n1 1\n0 1\n0 1\n1 1\n1 1\n0 1\n1 1\n1 1\n0 0\n1 0\n0 1\n0 0\n0 0\n1 1\n1 1\n1 1\n1 1\n0 1\n1 0\n1 0\n1 0\n1 0\n1 0\n0 0\n1 0\n1 0\n0 0\n1 0\n0 0\n0 1\n1 0\n0 1\n1 0\n1 0\n1 0\n1 0",
"output": "11"
},
{
"input": "100\n0 2\n1 2\n2 1\n1 2\n1 2\n2 1\n2 2\n1 1\n1 1\n2 1\n1 2\n2 1\n1 2\n2 2\n2 2\n2 2\n1 2\n2 2\n2 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 2\n1 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n1 1\n2 2\n2 1\n1 2\n1 1\n1 2\n2 1\n2 2\n1 1\n2 1\n1 1\n2 1\n1 1\n1 2\n2 2\n2 2\n1 1\n2 2\n1 2\n2 1\n2 1\n1 1\n1 1\n1 2\n1 2\n1 1\n1 1\n2 1\n1 2\n1 2\n2 1\n2 2\n2 2\n2 2\n2 1\n2 2\n1 1\n1 2\n1 2\n1 1\n2 2\n2 2\n1 1\n2 1\n1 1\n1 2\n1 2\n1 2\n1 1\n1 1\n2 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 1\n2 2\n1 2\n2 0\n2 0\n2 0\n1 0",
"output": "7"
},
{
"input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "2\n0 1\n1 0",
"output": "1"
},
{
"input": "2\n0 900\n900 0",
"output": "900"
},
{
"input": "2\n0 1\n1 0",
"output": "1"
},
{
"input": "2\n0 0\n0 0",
"output": "0"
},
{
"input": "2\n0 1000\n1000 0",
"output": "1000"
},
{
"input": "3\n0 802\n175 188\n815 0",
"output": "815"
},
{
"input": "3\n0 910\n910 976\n976 0",
"output": "976"
},
{
"input": "3\n0 2\n2 1\n1 0",
"output": "2"
}
] | 1,689,731,686
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 60
| 0
|
a = int(input())
x = float("-inf")
z = []
for i in range(len(a)):
w = list(map(int,input().split()))
z.extend(w)
print(max(z)+1)
|
Title: Tram
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty.
Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram.
Input Specification:
The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops.
Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement.
- The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0.
Output Specification:
Print a single integer denoting the minimum possible capacity of the tram (0 is allowed).
Demo Input:
['4\n0 3\n2 5\n4 2\n4 0\n']
Demo Output:
['6\n']
Note:
For the first example, a capacity of 6 is sufficient:
- At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints.
Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
|
```python
a = int(input())
x = float("-inf")
z = []
for i in range(len(a)):
w = list(map(int,input().split()))
z.extend(w)
print(max(z)+1)
```
| -1
|
|
899
|
B
|
Months and Years
|
PROGRAMMING
| 1,200
|
[
"implementation"
] | null | null |
Everybody in Russia uses Gregorian calendar. In this calendar there are 31 days in January, 28 or 29 days in February (depending on whether the year is leap or not), 31 days in March, 30 days in April, 31 days in May, 30 in June, 31 in July, 31 in August, 30 in September, 31 in October, 30 in November, 31 in December.
A year is leap in one of two cases: either its number is divisible by 4, but not divisible by 100, or is divisible by 400. For example, the following years are leap: 2000, 2004, but years 1900 and 2018 are not leap.
In this problem you are given *n* (1<=≤<=*n*<=≤<=24) integers *a*1,<=*a*2,<=...,<=*a**n*, and you have to check if these integers could be durations in days of *n* consecutive months, according to Gregorian calendar. Note that these months could belong to several consecutive years. In other words, check if there is a month in some year, such that its duration is *a*1 days, duration of the next month is *a*2 days, and so on.
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=24) — the number of integers.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (28<=≤<=*a**i*<=≤<=31) — the numbers you are to check.
|
If there are several consecutive months that fit the sequence, print "YES" (without quotes). Otherwise, print "NO" (without quotes).
You can print each letter in arbitrary case (small or large).
|
[
"4\n31 31 30 31\n",
"2\n30 30\n",
"5\n29 31 30 31 30\n",
"3\n31 28 30\n",
"3\n31 31 28\n"
] |
[
"Yes\n\n",
"No\n\n",
"Yes\n\n",
"No\n\n",
"Yes\n\n"
] |
In the first example the integers can denote months July, August, September and October.
In the second example the answer is no, because there are no two consecutive months each having 30 days.
In the third example the months are: February (leap year) — March — April – May — June.
In the fourth example the number of days in the second month is 28, so this is February. March follows February and has 31 days, but not 30, so the answer is NO.
In the fifth example the months are: December — January — February (non-leap year).
| 1,000
|
[
{
"input": "4\n31 31 30 31",
"output": "Yes"
},
{
"input": "2\n30 30",
"output": "No"
},
{
"input": "5\n29 31 30 31 30",
"output": "Yes"
},
{
"input": "3\n31 28 30",
"output": "No"
},
{
"input": "3\n31 31 28",
"output": "Yes"
},
{
"input": "24\n29 28 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "4\n31 29 31 30",
"output": "Yes"
},
{
"input": "24\n31 28 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "8\n31 29 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "1\n29",
"output": "Yes"
},
{
"input": "8\n31 29 31 30 31 31 31 31",
"output": "No"
},
{
"input": "1\n31",
"output": "Yes"
},
{
"input": "11\n30 31 30 31 31 30 31 30 31 31 28",
"output": "Yes"
},
{
"input": "21\n30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31",
"output": "Yes"
},
{
"input": "4\n31 28 28 30",
"output": "No"
},
{
"input": "2\n30 31",
"output": "Yes"
},
{
"input": "7\n28 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "4\n28 31 30 31",
"output": "Yes"
},
{
"input": "17\n28 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "9\n31 31 29 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "4\n31 28 31 30",
"output": "Yes"
},
{
"input": "21\n30 31 30 31 31 28 31 30 31 30 31 29 30 31 30 31 31 28 31 30 31",
"output": "No"
},
{
"input": "2\n31 31",
"output": "Yes"
},
{
"input": "17\n31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "4\n30 31 30 31",
"output": "Yes"
},
{
"input": "12\n31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "12\n31 29 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "11\n30 31 30 31 31 30 31 30 31 29 28",
"output": "No"
},
{
"input": "22\n31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "14\n31 30 31 31 28 31 30 31 30 31 31 30 31 30",
"output": "Yes"
},
{
"input": "12\n31 30 31 31 28 31 30 31 30 31 31 30",
"output": "Yes"
},
{
"input": "4\n31 29 29 30",
"output": "No"
},
{
"input": "7\n28 28 30 31 30 31 31",
"output": "No"
},
{
"input": "9\n29 31 29 31 30 31 30 31 31",
"output": "No"
},
{
"input": "17\n31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "2\n31 29",
"output": "Yes"
},
{
"input": "12\n31 28 31 30 31 30 31 31 30 31 28 31",
"output": "No"
},
{
"input": "2\n29 31",
"output": "Yes"
},
{
"input": "12\n31 29 31 30 31 30 31 30 30 31 30 31",
"output": "No"
},
{
"input": "12\n31 28 31 30 31 29 31 31 30 31 30 31",
"output": "No"
},
{
"input": "22\n31 30 31 30 31 31 30 31 30 31 31 28 31 30 28 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "14\n31 30 31 31 28 31 30 31 30 31 31 30 29 30",
"output": "No"
},
{
"input": "19\n31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31",
"output": "Yes"
},
{
"input": "20\n31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "1\n28",
"output": "Yes"
},
{
"input": "1\n29",
"output": "Yes"
},
{
"input": "17\n31 30 31 30 31 31 29 31 30 31 31 31 31 30 31 30 31",
"output": "No"
},
{
"input": "1\n30",
"output": "Yes"
},
{
"input": "1\n31",
"output": "Yes"
},
{
"input": "24\n31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "24\n28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "12\n31 30 31 31 28 28 30 31 30 31 31 30",
"output": "No"
},
{
"input": "24\n29 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "24\n28 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "24\n31 29 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "13\n28 31 30 31 30 31 31 30 31 30 31 31 28",
"output": "Yes"
},
{
"input": "15\n31 31 28 31 30 31 30 31 31 30 31 30 31 31 29",
"output": "Yes"
},
{
"input": "23\n31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31 29 31",
"output": "Yes"
},
{
"input": "24\n31 30 31 30 31 31 30 31 30 31 31 30 31 30 31 30 31 31 30 31 30 31 31 30",
"output": "No"
},
{
"input": "23\n29 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "15\n31 31 29 31 30 31 30 31 31 30 31 30 31 31 28",
"output": "Yes"
},
{
"input": "12\n31 30 31 30 31 30 31 31 30 31 30 31",
"output": "No"
}
] | 1,513,773,261
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 6
| 62
| 5,529,600
|
n=int(input())
a=list(map(int,input().split()))
b=[31,28,31,30,31,30,31,31,30,31,30,31,31,28,31,30,31,30,31,31,30,31,30,31]
c=[31,28,31,30,31,30,31,31,30,31,30,31,31,29,31,30,31,30,31,31,30,31,30,31]
d=[31,29,31,30,31,30,31,31,30,31,30,31,31,28,31,30,31,30,31,31,30,31,30,31]
ans=0
j=0
for i in range(0,24):
if j<n and a[j]==b[i]:
j+=1
else :
j=0
if j==n:
ans=1
if ans==0:
for i in range(0,24):
if j < n and a[j] == c[i]:
j+=1
else:
j=0
if j==n:
ans=1
if ans==0:
for i in range(0,24):
if j < n and a[j] == d[i]:
j += 1
else:
j = 0
if j == n:
ans = 1
if ans==1:
print("Yes")
else:
print("No")
|
Title: Months and Years
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Everybody in Russia uses Gregorian calendar. In this calendar there are 31 days in January, 28 or 29 days in February (depending on whether the year is leap or not), 31 days in March, 30 days in April, 31 days in May, 30 in June, 31 in July, 31 in August, 30 in September, 31 in October, 30 in November, 31 in December.
A year is leap in one of two cases: either its number is divisible by 4, but not divisible by 100, or is divisible by 400. For example, the following years are leap: 2000, 2004, but years 1900 and 2018 are not leap.
In this problem you are given *n* (1<=≤<=*n*<=≤<=24) integers *a*1,<=*a*2,<=...,<=*a**n*, and you have to check if these integers could be durations in days of *n* consecutive months, according to Gregorian calendar. Note that these months could belong to several consecutive years. In other words, check if there is a month in some year, such that its duration is *a*1 days, duration of the next month is *a*2 days, and so on.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=24) — the number of integers.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (28<=≤<=*a**i*<=≤<=31) — the numbers you are to check.
Output Specification:
If there are several consecutive months that fit the sequence, print "YES" (without quotes). Otherwise, print "NO" (without quotes).
You can print each letter in arbitrary case (small or large).
Demo Input:
['4\n31 31 30 31\n', '2\n30 30\n', '5\n29 31 30 31 30\n', '3\n31 28 30\n', '3\n31 31 28\n']
Demo Output:
['Yes\n\n', 'No\n\n', 'Yes\n\n', 'No\n\n', 'Yes\n\n']
Note:
In the first example the integers can denote months July, August, September and October.
In the second example the answer is no, because there are no two consecutive months each having 30 days.
In the third example the months are: February (leap year) — March — April – May — June.
In the fourth example the number of days in the second month is 28, so this is February. March follows February and has 31 days, but not 30, so the answer is NO.
In the fifth example the months are: December — January — February (non-leap year).
|
```python
n=int(input())
a=list(map(int,input().split()))
b=[31,28,31,30,31,30,31,31,30,31,30,31,31,28,31,30,31,30,31,31,30,31,30,31]
c=[31,28,31,30,31,30,31,31,30,31,30,31,31,29,31,30,31,30,31,31,30,31,30,31]
d=[31,29,31,30,31,30,31,31,30,31,30,31,31,28,31,30,31,30,31,31,30,31,30,31]
ans=0
j=0
for i in range(0,24):
if j<n and a[j]==b[i]:
j+=1
else :
j=0
if j==n:
ans=1
if ans==0:
for i in range(0,24):
if j < n and a[j] == c[i]:
j+=1
else:
j=0
if j==n:
ans=1
if ans==0:
for i in range(0,24):
if j < n and a[j] == d[i]:
j += 1
else:
j = 0
if j == n:
ans = 1
if ans==1:
print("Yes")
else:
print("No")
```
| 0
|
|
998
|
B
|
Cutting
|
PROGRAMMING
| 1,200
|
[
"dp",
"greedy",
"sortings"
] | null | null |
There are a lot of things which could be cut — trees, paper, "the rope". In this problem you are going to cut a sequence of integers.
There is a sequence of integers, which contains the equal number of even and odd numbers. Given a limited budget, you need to make maximum possible number of cuts such that each resulting segment will have the same number of odd and even integers.
Cuts separate a sequence to continuous (contiguous) segments. You may think about each cut as a break between two adjacent elements in a sequence. So after cutting each element belongs to exactly one segment. Say, $[4, 1, 2, 3, 4, 5, 4, 4, 5, 5]$ $\to$ two cuts $\to$ $[4, 1 | 2, 3, 4, 5 | 4, 4, 5, 5]$. On each segment the number of even elements should be equal to the number of odd elements.
The cost of the cut between $x$ and $y$ numbers is $|x - y|$ bitcoins. Find the maximum possible number of cuts that can be made while spending no more than $B$ bitcoins.
|
First line of the input contains an integer $n$ ($2 \le n \le 100$) and an integer $B$ ($1 \le B \le 100$) — the number of elements in the sequence and the number of bitcoins you have.
Second line contains $n$ integers: $a_1$, $a_2$, ..., $a_n$ ($1 \le a_i \le 100$) — elements of the sequence, which contains the equal number of even and odd numbers
|
Print the maximum possible number of cuts which can be made while spending no more than $B$ bitcoins.
|
[
"6 4\n1 2 5 10 15 20\n",
"4 10\n1 3 2 4\n",
"6 100\n1 2 3 4 5 6\n"
] |
[
"1\n",
"0\n",
"2\n"
] |
In the first sample the optimal answer is to split sequence between $2$ and $5$. Price of this cut is equal to $3$ bitcoins.
In the second sample it is not possible to make even one cut even with unlimited number of bitcoins.
In the third sample the sequence should be cut between $2$ and $3$, and between $4$ and $5$. The total price of the cuts is $1 + 1 = 2$ bitcoins.
| 1,000
|
[
{
"input": "6 4\n1 2 5 10 15 20",
"output": "1"
},
{
"input": "4 10\n1 3 2 4",
"output": "0"
},
{
"input": "6 100\n1 2 3 4 5 6",
"output": "2"
},
{
"input": "2 100\n13 78",
"output": "0"
},
{
"input": "10 1\n56 56 98 2 11 64 97 41 95 53",
"output": "0"
},
{
"input": "10 100\n94 65 24 47 29 98 20 65 6 17",
"output": "2"
},
{
"input": "100 1\n35 6 19 84 49 64 36 91 50 65 21 86 20 89 10 52 50 24 98 74 11 48 58 98 51 85 1 29 44 83 9 97 68 41 83 57 1 57 46 42 87 2 32 50 3 57 17 77 22 100 36 27 3 34 55 8 90 61 34 20 15 39 43 46 60 60 14 23 4 22 75 51 98 23 69 22 99 57 63 30 79 7 16 8 34 84 13 47 93 40 48 25 93 1 80 6 82 93 6 21",
"output": "0"
},
{
"input": "100 10\n3 20 3 29 90 69 2 30 70 28 71 99 22 99 34 70 87 48 3 92 71 61 26 90 14 38 51 81 16 33 49 71 14 52 50 95 65 16 80 57 87 47 29 14 40 31 74 15 87 76 71 61 30 91 44 10 87 48 84 12 77 51 25 68 49 38 79 8 7 9 39 19 48 40 15 53 29 4 60 86 76 84 6 37 45 71 46 38 80 68 94 71 64 72 41 51 71 60 79 7",
"output": "2"
},
{
"input": "100 100\n60 83 82 16 17 7 89 6 83 100 85 41 72 44 23 28 64 84 3 23 33 52 93 30 81 38 67 25 26 97 94 78 41 74 74 17 53 51 54 17 20 81 95 76 42 16 16 56 74 69 30 9 82 91 32 13 47 45 97 40 56 57 27 28 84 98 91 5 61 20 3 43 42 26 83 40 34 100 5 63 62 61 72 5 32 58 93 79 7 18 50 43 17 24 77 73 87 74 98 2",
"output": "11"
},
{
"input": "100 100\n70 54 10 72 81 84 56 15 27 19 43 100 49 44 52 33 63 40 95 17 58 2 51 39 22 18 82 1 16 99 32 29 24 94 9 98 5 37 47 14 42 73 41 31 79 64 12 6 53 26 68 67 89 13 90 4 21 93 46 74 75 88 66 57 23 7 25 48 92 62 30 8 50 61 38 87 71 34 97 28 80 11 60 91 3 35 86 96 36 20 59 65 83 45 76 77 78 69 85 55",
"output": "3"
},
{
"input": "100 100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "49"
},
{
"input": "10 10\n94 32 87 13 4 22 85 81 18 95",
"output": "1"
},
{
"input": "10 50\n40 40 9 3 64 96 67 19 21 30",
"output": "1"
},
{
"input": "100 50\n13 31 29 86 46 10 2 87 94 2 28 31 29 15 64 3 94 71 37 76 9 91 89 38 12 46 53 33 58 11 98 4 37 72 30 52 6 86 40 98 28 6 34 80 61 47 45 69 100 47 91 64 87 41 67 58 88 75 13 81 36 58 66 29 10 27 54 83 44 15 11 33 49 36 61 18 89 26 87 1 99 19 57 21 55 84 20 74 14 43 15 51 2 76 22 92 43 14 72 77",
"output": "3"
},
{
"input": "100 1\n78 52 95 76 96 49 53 59 77 100 64 11 9 48 15 17 44 46 21 54 39 68 43 4 32 28 73 6 16 62 72 84 65 86 98 75 33 45 25 3 91 82 2 92 63 88 7 50 97 93 14 22 20 42 60 55 80 85 29 34 56 71 83 38 26 47 90 70 51 41 40 31 37 12 35 99 67 94 1 87 57 8 61 19 23 79 36 18 66 74 5 27 81 69 24 58 13 10 89 30",
"output": "0"
},
{
"input": "100 10\n19 55 91 50 31 23 60 84 38 1 22 51 27 76 28 98 11 44 61 63 15 93 52 3 66 16 53 36 18 62 35 85 78 37 73 64 87 74 46 26 82 69 49 33 83 89 56 67 71 25 39 94 96 17 21 6 47 68 34 42 57 81 13 10 54 2 48 80 20 77 4 5 59 30 90 95 45 75 8 88 24 41 40 14 97 32 7 9 65 70 100 99 72 58 92 29 79 12 86 43",
"output": "0"
},
{
"input": "100 50\n2 4 82 12 47 63 52 91 87 45 53 1 17 25 64 50 9 13 22 54 21 30 43 24 38 33 68 11 41 78 99 23 28 18 58 67 79 10 71 56 49 61 26 29 59 20 90 74 5 75 89 8 39 95 72 42 66 98 44 32 88 35 92 3 97 55 65 51 77 27 81 76 84 69 73 85 19 46 62 100 60 37 7 36 57 6 14 83 40 48 16 70 96 15 31 93 80 86 94 34",
"output": "1"
},
{
"input": "100 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "1"
},
{
"input": "100 10\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "10"
},
{
"input": "100 50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "49"
},
{
"input": "100 30\n2 1 2 2 2 2 1 1 1 2 1 1 2 2 1 2 1 2 2 2 2 1 2 1 2 1 1 2 1 1 2 2 2 1 1 2 1 2 2 2 1 1 1 1 1 2 1 1 1 1 1 2 2 2 2 1 2 1 1 1 2 2 2 2 1 2 2 1 1 1 1 2 2 2 1 2 2 1 2 1 1 2 2 2 1 2 2 1 2 1 1 2 1 1 1 1 2 1 1 2",
"output": "11"
},
{
"input": "100 80\n1 1 1 2 2 1 1 2 1 1 1 1 2 2 2 1 2 2 2 2 1 1 2 2 1 1 1 1 2 2 2 1 1 1 1 1 1 1 2 2 2 2 1 2 2 1 2 1 1 1 1 2 2 1 2 2 1 2 2 2 2 2 1 1 2 2 2 2 2 2 1 1 2 1 1 1 2 1 1 2 1 2 1 2 2 1 1 2 1 1 1 1 2 2 2 1 2 2 1 2",
"output": "12"
},
{
"input": "100 30\n100 99 100 99 99 100 100 99 100 99 99 100 100 100 99 99 99 100 99 99 99 99 100 99 99 100 100 99 100 99 99 99 100 99 100 100 99 100 100 100 100 100 99 99 100 99 99 100 99 100 99 99 100 100 99 100 99 99 100 99 100 100 100 100 99 99 99 100 99 100 99 100 100 100 99 100 100 100 99 100 99 99 100 100 100 100 99 99 99 100 99 100 100 99 99 99 100 100 99 99",
"output": "14"
},
{
"input": "100 80\n99 100 100 100 99 99 99 99 100 99 99 99 99 99 99 99 99 100 100 99 99 99 99 99 100 99 100 99 100 100 100 100 100 99 100 100 99 99 100 100 100 100 100 99 100 99 100 99 99 99 100 99 99 99 99 99 99 99 99 100 99 100 100 99 99 99 99 100 100 100 99 100 100 100 100 100 99 100 100 100 100 100 100 100 100 99 99 99 99 100 99 100 100 100 100 100 99 100 99 100",
"output": "4"
},
{
"input": "100 30\n100 100 39 39 39 100 100 39 39 100 39 39 100 39 100 39 100 100 100 100 100 39 100 100 100 39 39 39 100 39 100 100 39 39 100 39 39 39 100 100 39 100 39 100 39 39 100 100 39 100 39 100 39 39 39 100 39 100 39 39 39 100 39 39 100 100 39 39 39 100 100 39 39 39 100 100 100 100 39 100 100 100 39 39 100 39 100 100 39 100 39 100 39 39 100 39 39 100 100 100",
"output": "5"
},
{
"input": "100 80\n39 100 39 100 100 100 100 39 39 100 100 39 39 100 39 39 39 39 100 39 39 39 39 100 100 100 100 39 100 39 39 100 100 39 39 100 39 100 39 100 100 39 39 100 39 39 39 100 39 100 39 100 100 100 100 100 100 100 39 100 39 100 100 100 39 39 39 39 39 100 100 100 39 100 100 100 100 39 100 100 39 39 100 39 39 39 100 39 100 39 39 100 100 39 100 39 39 39 100 39",
"output": "6"
},
{
"input": "4 1\n1 2 3 4",
"output": "1"
},
{
"input": "4 1\n1 2 1 2",
"output": "1"
},
{
"input": "4 4\n1 2 6 7",
"output": "1"
},
{
"input": "4 8\n1 2 10 11",
"output": "1"
},
{
"input": "6 2\n1 2 3 4 5 6",
"output": "2"
},
{
"input": "6 1\n1 2 1 2 1 2",
"output": "1"
},
{
"input": "6 4\n1 2 4 5 7 8",
"output": "2"
},
{
"input": "6 3\n1 2 5 10 15 20",
"output": "1"
}
] | 1,553,694,090
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 34
| 139
| 0
|
I = lambda: map(int, input().split())
n, B = I()
A, D, count, k = list(I()), [], 0, 0
for a1, a2 in zip(A, A[1:]):
count = (count - 1) if a1 % 2 else (count + 1)
if count == 0:
D.append(abs(a1 - a2))
for d in sorted(D):
if d > B:
break
B, k = B - d, k + 1
print(k)
|
Title: Cutting
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are a lot of things which could be cut — trees, paper, "the rope". In this problem you are going to cut a sequence of integers.
There is a sequence of integers, which contains the equal number of even and odd numbers. Given a limited budget, you need to make maximum possible number of cuts such that each resulting segment will have the same number of odd and even integers.
Cuts separate a sequence to continuous (contiguous) segments. You may think about each cut as a break between two adjacent elements in a sequence. So after cutting each element belongs to exactly one segment. Say, $[4, 1, 2, 3, 4, 5, 4, 4, 5, 5]$ $\to$ two cuts $\to$ $[4, 1 | 2, 3, 4, 5 | 4, 4, 5, 5]$. On each segment the number of even elements should be equal to the number of odd elements.
The cost of the cut between $x$ and $y$ numbers is $|x - y|$ bitcoins. Find the maximum possible number of cuts that can be made while spending no more than $B$ bitcoins.
Input Specification:
First line of the input contains an integer $n$ ($2 \le n \le 100$) and an integer $B$ ($1 \le B \le 100$) — the number of elements in the sequence and the number of bitcoins you have.
Second line contains $n$ integers: $a_1$, $a_2$, ..., $a_n$ ($1 \le a_i \le 100$) — elements of the sequence, which contains the equal number of even and odd numbers
Output Specification:
Print the maximum possible number of cuts which can be made while spending no more than $B$ bitcoins.
Demo Input:
['6 4\n1 2 5 10 15 20\n', '4 10\n1 3 2 4\n', '6 100\n1 2 3 4 5 6\n']
Demo Output:
['1\n', '0\n', '2\n']
Note:
In the first sample the optimal answer is to split sequence between $2$ and $5$. Price of this cut is equal to $3$ bitcoins.
In the second sample it is not possible to make even one cut even with unlimited number of bitcoins.
In the third sample the sequence should be cut between $2$ and $3$, and between $4$ and $5$. The total price of the cuts is $1 + 1 = 2$ bitcoins.
|
```python
I = lambda: map(int, input().split())
n, B = I()
A, D, count, k = list(I()), [], 0, 0
for a1, a2 in zip(A, A[1:]):
count = (count - 1) if a1 % 2 else (count + 1)
if count == 0:
D.append(abs(a1 - a2))
for d in sorted(D):
if d > B:
break
B, k = B - d, k + 1
print(k)
```
| 3
|
|
702
|
A
|
Maximum Increase
|
PROGRAMMING
| 800
|
[
"dp",
"greedy",
"implementation"
] | null | null |
You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array.
A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous.
|
The first line contains single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).
|
Print the maximum length of an increasing subarray of the given array.
|
[
"5\n1 7 2 11 15\n",
"6\n100 100 100 100 100 100\n",
"3\n1 2 3\n"
] |
[
"3\n",
"1\n",
"3\n"
] |
none
| 0
|
[
{
"input": "5\n1 7 2 11 15",
"output": "3"
},
{
"input": "6\n100 100 100 100 100 100",
"output": "1"
},
{
"input": "3\n1 2 3",
"output": "3"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "10\n802030518 598196518 640274071 983359971 71550121 96204862 799843967 446173607 796619138 402690754",
"output": "3"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n1 2 3 3 4",
"output": "3"
},
{
"input": "4\n1 2 2 3",
"output": "2"
},
{
"input": "3\n2 1 1",
"output": "1"
},
{
"input": "3\n1 2 1",
"output": "2"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "3\n1 1 2",
"output": "2"
},
{
"input": "11\n1 2 3 1 2 3 2 1 2 3 4",
"output": "4"
},
{
"input": "9\n1 2 3 4 5 6 7 8 9",
"output": "9"
},
{
"input": "9\n1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "3\n3 2 1",
"output": "1"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "7"
},
{
"input": "1\n1234394",
"output": "1"
}
] | 1,658,323,785
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 46
| 0
|
n=int(input())
l=list(map(int,input().split()))
c=1
for j in range(1,len(l)):
if(l[j]>l[j-1]):
c+=1
else:
c=1
print(c)
|
Title: Maximum Increase
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array.
A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous.
Input Specification:
The first line contains single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).
Output Specification:
Print the maximum length of an increasing subarray of the given array.
Demo Input:
['5\n1 7 2 11 15\n', '6\n100 100 100 100 100 100\n', '3\n1 2 3\n']
Demo Output:
['3\n', '1\n', '3\n']
Note:
none
|
```python
n=int(input())
l=list(map(int,input().split()))
c=1
for j in range(1,len(l)):
if(l[j]>l[j-1]):
c+=1
else:
c=1
print(c)
```
| 0
|
|
670
|
D1
|
Magic Powder - 1
|
PROGRAMMING
| 1,400
|
[
"binary search",
"brute force",
"implementation"
] | null | null |
This problem is given in two versions that differ only by constraints. If you can solve this problem in large constraints, then you can just write a single solution to the both versions. If you find the problem too difficult in large constraints, you can write solution to the simplified version only.
Waking up in the morning, Apollinaria decided to bake cookies. To bake one cookie, she needs *n* ingredients, and for each ingredient she knows the value *a**i* — how many grams of this ingredient one needs to bake a cookie. To prepare one cookie Apollinaria needs to use all *n* ingredients.
Apollinaria has *b**i* gram of the *i*-th ingredient. Also she has *k* grams of a magic powder. Each gram of magic powder can be turned to exactly 1 gram of any of the *n* ingredients and can be used for baking cookies.
Your task is to determine the maximum number of cookies, which Apollinaria is able to bake using the ingredients that she has and the magic powder.
|
The first line of the input contains two positive integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1000) — the number of ingredients and the number of grams of the magic powder.
The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000), where the *i*-th number is equal to the number of grams of the *i*-th ingredient, needed to bake one cookie.
The third line contains the sequence *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=1000), where the *i*-th number is equal to the number of grams of the *i*-th ingredient, which Apollinaria has.
|
Print the maximum number of cookies, which Apollinaria will be able to bake using the ingredients that she has and the magic powder.
|
[
"3 1\n2 1 4\n11 3 16\n",
"4 3\n4 3 5 6\n11 12 14 20\n"
] |
[
"4\n",
"3\n"
] |
In the first sample it is profitably for Apollinaria to make the existing 1 gram of her magic powder to ingredient with the index 2, then Apollinaria will be able to bake 4 cookies.
In the second sample Apollinaria should turn 1 gram of magic powder to ingredient with the index 1 and 1 gram of magic powder to ingredient with the index 3. Then Apollinaria will be able to bake 3 cookies. The remaining 1 gram of the magic powder can be left, because it can't be used to increase the answer.
| 1,000
|
[
{
"input": "3 1\n2 1 4\n11 3 16",
"output": "4"
},
{
"input": "4 3\n4 3 5 6\n11 12 14 20",
"output": "3"
},
{
"input": "10 926\n5 6 8 1 2 5 1 8 4 4\n351 739 998 725 953 970 906 691 707 1000",
"output": "137"
},
{
"input": "20 925\n7 3 1 2 1 3 1 3 1 2 3 1 5 8 1 3 7 3 4 2\n837 898 965 807 786 670 626 873 968 745 878 359 760 781 829 882 777 740 907 779",
"output": "150"
},
{
"input": "30 300\n1 4 2 1 2 5 6 4 1 3 2 1 1 1 1 1 2 3 1 3 4 2 2 3 2 2 2 1 1 1\n997 817 767 860 835 809 817 565 630 804 586 953 977 356 905 890 958 916 740 583 902 945 313 956 871 729 976 707 516 788",
"output": "164"
},
{
"input": "40 538\n1 3 3 1 4 1 1 1 1 5 3 3 4 1 4 2 7 1 4 1 1 2 2 1 1 1 1 4 1 4 2 3 3 3 1 3 4 1 3 5\n975 635 795 835 982 965 639 787 688 796 988 779 839 942 491 696 396 995 718 810 796 879 957 783 844 765 968 783 647 214 995 868 318 453 989 889 504 962 945 925",
"output": "104"
},
{
"input": "50 530\n2 3 3 1 1 1 3 4 4 2 4 2 5 1 3 1 2 6 1 1 2 5 3 2 1 5 1 3 3 2 1 1 1 1 2 1 1 2 2 1 4 2 1 3 1 2 1 1 4 2\n959 972 201 990 675 679 972 268 976 886 488 924 795 959 647 994 969 862 898 646 763 797 978 763 995 641 923 856 829 921 934 883 904 986 728 980 1000 775 716 745 833 832 999 651 571 626 827 456 636 795",
"output": "133"
},
{
"input": "60 735\n3 1 4 7 1 7 3 1 1 5 4 7 3 3 3 2 5 3 1 2 3 6 1 1 1 1 1 2 5 3 2 1 3 5 2 1 2 2 2 2 1 3 3 3 6 4 3 5 1 3 2 2 1 3 1 1 1 7 1 2\n596 968 975 493 665 571 598 834 948 941 737 649 923 848 950 907 929 865 227 836 956 796 861 801 746 667 539 807 405 355 501 879 994 890 573 848 597 873 130 985 924 426 999 550 586 924 601 807 994 878 410 817 922 898 982 525 611 685 806 847",
"output": "103"
},
{
"input": "1 1\n1\n1",
"output": "2"
},
{
"input": "70 130\n2 1 2 2 3 3 2 5 2 2 3 3 3 1 1 4 3 5 3 2 1 3 7 1 2 7 5 2 1 6 3 4 1 2 1 1 1 1 3 6 4 2 2 8 2 2 4 1 4 2 1 4 4 3 5 1 1 1 1 1 2 3 1 5 1 3 3 4 2 2\n473 311 758 768 797 572 656 898 991 534 989 702 934 767 777 799 1000 655 806 727 718 948 834 965 832 778 706 861 799 874 745 970 772 967 984 886 835 795 832 837 950 952 475 891 947 952 903 929 689 478 725 945 585 943 771 631 729 887 557 738 824 758 999 786 669 992 918 762 964 941",
"output": "119"
},
{
"input": "80 979\n2 1 1 1 2 1 1 1 3 1 4 4 2 1 1 3 1 1 2 1 4 1 1 2 5 4 8 1 3 6 5 7 2 3 4 1 2 2 6 1 2 2 4 1 1 2 3 2 8 1 1 3 3 4 1 1 2 1 4 4 1 4 3 2 6 5 2 1 4 1 2 3 2 1 3 3 1 2 1 3\n498 976 513 869 917 914 664 656 957 893 981 947 985 693 576 958 987 822 981 718 884 729 295 683 485 998 730 894 731 975 739 854 906 740 987 976 606 689 990 775 522 994 920 893 529 651 989 799 643 215 946 987 297 868 425 810 694 908 736 903 970 751 625 904 955 945 839 777 977 974 905 900 666 680 799 873 565 919 536 686",
"output": "128"
},
{
"input": "1 1000\n1000\n1000",
"output": "2"
},
{
"input": "1 1000\n1\n1000",
"output": "2000"
},
{
"input": "1 1\n4\n6",
"output": "1"
},
{
"input": "1 1\n10\n2",
"output": "0"
},
{
"input": "2 1\n2 2\n1 1",
"output": "0"
},
{
"input": "2 6\n1 3\n6 2",
"output": "2"
}
] | 1,676,284,601
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 119
| 62
| 0
|
n,k=map(int,input().split())
a=list(map(int,input().split()))
b=list(map(int,input().split()))
def g(i):
return b[i]//a[i];
c=[i for i in range(n)]
c.sort(key=g)
ans=g(c[0])
while k>0:
nem=b[c[0]]//a[c[0]]
nem+=1
nem*=a[c[0]]
if k>=nem-b[c[0]]:
k-=nem-b[c[0]]
b[c[0]]+=(nem-b[c[0]])
else:
k=0
c.sort(key=g)
ans=g(c[0])
# print(k)
# for j in c:
# print(g(j))
print(ans)
|
Title: Magic Powder - 1
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This problem is given in two versions that differ only by constraints. If you can solve this problem in large constraints, then you can just write a single solution to the both versions. If you find the problem too difficult in large constraints, you can write solution to the simplified version only.
Waking up in the morning, Apollinaria decided to bake cookies. To bake one cookie, she needs *n* ingredients, and for each ingredient she knows the value *a**i* — how many grams of this ingredient one needs to bake a cookie. To prepare one cookie Apollinaria needs to use all *n* ingredients.
Apollinaria has *b**i* gram of the *i*-th ingredient. Also she has *k* grams of a magic powder. Each gram of magic powder can be turned to exactly 1 gram of any of the *n* ingredients and can be used for baking cookies.
Your task is to determine the maximum number of cookies, which Apollinaria is able to bake using the ingredients that she has and the magic powder.
Input Specification:
The first line of the input contains two positive integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1000) — the number of ingredients and the number of grams of the magic powder.
The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000), where the *i*-th number is equal to the number of grams of the *i*-th ingredient, needed to bake one cookie.
The third line contains the sequence *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=1000), where the *i*-th number is equal to the number of grams of the *i*-th ingredient, which Apollinaria has.
Output Specification:
Print the maximum number of cookies, which Apollinaria will be able to bake using the ingredients that she has and the magic powder.
Demo Input:
['3 1\n2 1 4\n11 3 16\n', '4 3\n4 3 5 6\n11 12 14 20\n']
Demo Output:
['4\n', '3\n']
Note:
In the first sample it is profitably for Apollinaria to make the existing 1 gram of her magic powder to ingredient with the index 2, then Apollinaria will be able to bake 4 cookies.
In the second sample Apollinaria should turn 1 gram of magic powder to ingredient with the index 1 and 1 gram of magic powder to ingredient with the index 3. Then Apollinaria will be able to bake 3 cookies. The remaining 1 gram of the magic powder can be left, because it can't be used to increase the answer.
|
```python
n,k=map(int,input().split())
a=list(map(int,input().split()))
b=list(map(int,input().split()))
def g(i):
return b[i]//a[i];
c=[i for i in range(n)]
c.sort(key=g)
ans=g(c[0])
while k>0:
nem=b[c[0]]//a[c[0]]
nem+=1
nem*=a[c[0]]
if k>=nem-b[c[0]]:
k-=nem-b[c[0]]
b[c[0]]+=(nem-b[c[0]])
else:
k=0
c.sort(key=g)
ans=g(c[0])
# print(k)
# for j in c:
# print(g(j))
print(ans)
```
| 3
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,666,782,030
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
s=iter(input())
print('NYOE S'[all(i in s for i in 'hello')::2]
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
s=iter(input())
print('NYOE S'[all(i in s for i in 'hello')::2]
```
| -1
|
118
|
A
|
String Task
|
PROGRAMMING
| 1,000
|
[
"implementation",
"strings"
] | null | null |
Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it:
- deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones.
Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string.
Help Petya cope with this easy task.
|
The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.
|
Print the resulting string. It is guaranteed that this string is not empty.
|
[
"tour\n",
"Codeforces\n",
"aBAcAba\n"
] |
[
".t.r\n",
".c.d.f.r.c.s\n",
".b.c.b\n"
] |
none
| 500
|
[
{
"input": "tour",
"output": ".t.r"
},
{
"input": "Codeforces",
"output": ".c.d.f.r.c.s"
},
{
"input": "aBAcAba",
"output": ".b.c.b"
},
{
"input": "obn",
"output": ".b.n"
},
{
"input": "wpwl",
"output": ".w.p.w.l"
},
{
"input": "ggdvq",
"output": ".g.g.d.v.q"
},
{
"input": "pumesz",
"output": ".p.m.s.z"
},
{
"input": "g",
"output": ".g"
},
{
"input": "zjuotps",
"output": ".z.j.t.p.s"
},
{
"input": "jzbwuehe",
"output": ".j.z.b.w.h"
},
{
"input": "tnkgwuugu",
"output": ".t.n.k.g.w.g"
},
{
"input": "kincenvizh",
"output": ".k.n.c.n.v.z.h"
},
{
"input": "xattxjenual",
"output": ".x.t.t.x.j.n.l"
},
{
"input": "ktajqhpqsvhw",
"output": ".k.t.j.q.h.p.q.s.v.h.w"
},
{
"input": "xnhcigytnqcmy",
"output": ".x.n.h.c.g.t.n.q.c.m"
},
{
"input": "jfmtbejyilxcec",
"output": ".j.f.m.t.b.j.l.x.c.c"
},
{
"input": "D",
"output": ".d"
},
{
"input": "ab",
"output": ".b"
},
{
"input": "Ab",
"output": ".b"
},
{
"input": "aB",
"output": ".b"
},
{
"input": "AB",
"output": ".b"
},
{
"input": "ba",
"output": ".b"
},
{
"input": "bA",
"output": ".b"
},
{
"input": "Ba",
"output": ".b"
},
{
"input": "BA",
"output": ".b"
},
{
"input": "aab",
"output": ".b"
},
{
"input": "baa",
"output": ".b"
},
{
"input": "femOZeCArKCpUiHYnbBPTIOFmsHmcpObtPYcLCdjFrUMIyqYzAokKUiiKZRouZiNMoiOuGVoQzaaCAOkquRjmmKKElLNqCnhGdQM",
"output": ".f.m.z.c.r.k.c.p.h.n.b.b.p.t.f.m.s.h.m.c.p.b.t.p.c.l.c.d.j.f.r.m.q.z.k.k.k.z.r.z.n.m.g.v.q.z.c.k.q.r.j.m.m.k.k.l.l.n.q.c.n.h.g.d.q.m"
},
{
"input": "VMBPMCmMDCLFELLIISUJDWQRXYRDGKMXJXJHXVZADRZWVWJRKFRRNSAWKKDPZZLFLNSGUNIVJFBEQsMDHSBJVDTOCSCgZWWKvZZN",
"output": ".v.m.b.p.m.c.m.m.d.c.l.f.l.l.s.j.d.w.q.r.x.r.d.g.k.m.x.j.x.j.h.x.v.z.d.r.z.w.v.w.j.r.k.f.r.r.n.s.w.k.k.d.p.z.z.l.f.l.n.s.g.n.v.j.f.b.q.s.m.d.h.s.b.j.v.d.t.c.s.c.g.z.w.w.k.v.z.z.n"
},
{
"input": "MCGFQQJNUKuAEXrLXibVjClSHjSxmlkQGTKZrRaDNDomIPOmtSgjJAjNVIVLeUGUAOHNkCBwNObVCHOWvNkLFQQbFnugYVMkJruJ",
"output": ".m.c.g.f.q.q.j.n.k.x.r.l.x.b.v.j.c.l.s.h.j.s.x.m.l.k.q.g.t.k.z.r.r.d.n.d.m.p.m.t.s.g.j.j.j.n.v.v.l.g.h.n.k.c.b.w.n.b.v.c.h.w.v.n.k.l.f.q.q.b.f.n.g.v.m.k.j.r.j"
},
{
"input": "iyaiuiwioOyzUaOtAeuEYcevvUyveuyioeeueoeiaoeiavizeeoeyYYaaAOuouueaUioueauayoiuuyiuovyOyiyoyioaoyuoyea",
"output": ".w.z.t.c.v.v.v.v.z.v"
},
{
"input": "yjnckpfyLtzwjsgpcrgCfpljnjwqzgVcufnOvhxplvflxJzqxnhrwgfJmPzifgubvspffmqrwbzivatlmdiBaddiaktdsfPwsevl",
"output": ".j.n.c.k.p.f.l.t.z.w.j.s.g.p.c.r.g.c.f.p.l.j.n.j.w.q.z.g.v.c.f.n.v.h.x.p.l.v.f.l.x.j.z.q.x.n.h.r.w.g.f.j.m.p.z.f.g.b.v.s.p.f.f.m.q.r.w.b.z.v.t.l.m.d.b.d.d.k.t.d.s.f.p.w.s.v.l"
},
{
"input": "RIIIUaAIYJOiuYIUWFPOOAIuaUEZeIooyUEUEAoIyIHYOEAlVAAIiLUAUAeiUIEiUMuuOiAgEUOIAoOUYYEYFEoOIIVeOOAOIIEg",
"output": ".r.j.w.f.p.z.h.l.v.l.m.g.f.v.g"
},
{
"input": "VBKQCFBMQHDMGNSGBQVJTGQCNHHRJMNKGKDPPSQRRVQTZNKBZGSXBPBRXPMVFTXCHZMSJVBRNFNTHBHGJLMDZJSVPZZBCCZNVLMQ",
"output": ".v.b.k.q.c.f.b.m.q.h.d.m.g.n.s.g.b.q.v.j.t.g.q.c.n.h.h.r.j.m.n.k.g.k.d.p.p.s.q.r.r.v.q.t.z.n.k.b.z.g.s.x.b.p.b.r.x.p.m.v.f.t.x.c.h.z.m.s.j.v.b.r.n.f.n.t.h.b.h.g.j.l.m.d.z.j.s.v.p.z.z.b.c.c.z.n.v.l.m.q"
},
{
"input": "iioyoaayeuyoolyiyoeuouiayiiuyTueyiaoiueyioiouyuauouayyiaeoeiiigmioiououeieeeyuyyaYyioiiooaiuouyoeoeg",
"output": ".l.t.g.m.g"
},
{
"input": "ueyiuiauuyyeueykeioouiiauzoyoeyeuyiaoaiiaaoaueyaeydaoauexuueafouiyioueeaaeyoeuaueiyiuiaeeayaioeouiuy",
"output": ".k.z.d.x.f"
},
{
"input": "FSNRBXLFQHZXGVMKLQDVHWLDSLKGKFMDRQWMWSSKPKKQBNDZRSCBLRSKCKKFFKRDMZFZGCNSMXNPMZVDLKXGNXGZQCLRTTDXLMXQ",
"output": ".f.s.n.r.b.x.l.f.q.h.z.x.g.v.m.k.l.q.d.v.h.w.l.d.s.l.k.g.k.f.m.d.r.q.w.m.w.s.s.k.p.k.k.q.b.n.d.z.r.s.c.b.l.r.s.k.c.k.k.f.f.k.r.d.m.z.f.z.g.c.n.s.m.x.n.p.m.z.v.d.l.k.x.g.n.x.g.z.q.c.l.r.t.t.d.x.l.m.x.q"
},
{
"input": "EYAYAYIOIOYOOAUOEUEUOUUYIYUUMOEOIIIAOIUOAAOIYOIOEUIERCEYYAOIOIGYUIAOYUEOEUAEAYPOYEYUUAUOAOEIYIEYUEEY",
"output": ".m.r.c.g.p"
},
{
"input": "jvvzcdcxjstbbksmqjsngxkgtttdxrljjxtwptgwwqzpvqchvgrkqlzxmptzblxhhsmrkmzzmgdfskhtmmnqzzflpmqdctvrfgtx",
"output": ".j.v.v.z.c.d.c.x.j.s.t.b.b.k.s.m.q.j.s.n.g.x.k.g.t.t.t.d.x.r.l.j.j.x.t.w.p.t.g.w.w.q.z.p.v.q.c.h.v.g.r.k.q.l.z.x.m.p.t.z.b.l.x.h.h.s.m.r.k.m.z.z.m.g.d.f.s.k.h.t.m.m.n.q.z.z.f.l.p.m.q.d.c.t.v.r.f.g.t.x"
},
{
"input": "YB",
"output": ".b"
},
{
"input": "fly",
"output": ".f.l"
},
{
"input": "YyyYYYyyYxdwdawdDAWDdaddYYYY",
"output": ".x.d.w.d.w.d.d.w.d.d.d.d"
}
] | 1,695,285,276
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 92
| 0
|
value = input().lower()
for exlude in ["a", "o", "y", "e", "u", "i"]:
value = value.replace(exlude, "")
result = ""
for dot in range(len(value)):
result += "."+value[dot]
print(result)
|
Title: String Task
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it:
- deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones.
Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string.
Help Petya cope with this easy task.
Input Specification:
The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.
Output Specification:
Print the resulting string. It is guaranteed that this string is not empty.
Demo Input:
['tour\n', 'Codeforces\n', 'aBAcAba\n']
Demo Output:
['.t.r\n', '.c.d.f.r.c.s\n', '.b.c.b\n']
Note:
none
|
```python
value = input().lower()
for exlude in ["a", "o", "y", "e", "u", "i"]:
value = value.replace(exlude, "")
result = ""
for dot in range(len(value)):
result += "."+value[dot]
print(result)
```
| 3
|
|
463
|
A
|
Caisa and Sugar
|
PROGRAMMING
| 1,200
|
[
"brute force",
"implementation"
] | null | null |
Caisa is going to have a party and he needs to buy the ingredients for a big chocolate cake. For that he is going to the biggest supermarket in town.
Unfortunately, he has just *s* dollars for sugar. But that's not a reason to be sad, because there are *n* types of sugar in the supermarket, maybe he able to buy one. But that's not all. The supermarket has very unusual exchange politics: instead of cents the sellers give sweets to a buyer as a change. Of course, the number of given sweets always doesn't exceed 99, because each seller maximizes the number of dollars in the change (100 cents can be replaced with a dollar).
Caisa wants to buy only one type of sugar, also he wants to maximize the number of sweets in the change. What is the maximum number of sweets he can get? Note, that Caisa doesn't want to minimize the cost of the sugar, he only wants to get maximum number of sweets as change.
|
The first line contains two space-separated integers *n*,<=*s* (1<=≤<=*n*,<=*s*<=≤<=100).
The *i*-th of the next *n* lines contains two integers *x**i*, *y**i* (1<=≤<=*x**i*<=≤<=100; 0<=≤<=*y**i*<=<<=100), where *x**i* represents the number of dollars and *y**i* the number of cents needed in order to buy the *i*-th type of sugar.
|
Print a single integer representing the maximum number of sweets he can buy, or -1 if he can't buy any type of sugar.
|
[
"5 10\n3 90\n12 0\n9 70\n5 50\n7 0\n",
"5 5\n10 10\n20 20\n30 30\n40 40\n50 50\n"
] |
[
"50\n",
"-1\n"
] |
In the first test sample Caisa can buy the fourth type of sugar, in such a case he will take 50 sweets as a change.
| 500
|
[
{
"input": "5 10\n3 90\n12 0\n9 70\n5 50\n7 0",
"output": "50"
},
{
"input": "5 5\n10 10\n20 20\n30 30\n40 40\n50 50",
"output": "-1"
},
{
"input": "1 2\n1 0",
"output": "0"
},
{
"input": "2 10\n20 99\n30 99",
"output": "-1"
},
{
"input": "15 21\n16 51\n33 44\n32 92\n19 91\n67 81\n94 94\n40 67\n77 38\n42 22\n48 19\n9 35\n90 36\n57 80\n58 97\n13 15",
"output": "85"
},
{
"input": "1 2\n5 0",
"output": "-1"
},
{
"input": "37 10\n57 61\n78 79\n59 60\n48 17\n39 22\n11 87\n19 55\n56 78\n25 12\n15 55\n13 37\n49 38\n37 57\n19 37\n74 18\n81 27\n8 82\n43 9\n79 17\n92 41\n29 69\n77 1\n33 98\n11 31\n40 56\n46 76\n16 51\n10 94\n32 3\n23 27\n8 57\n40 54\n16 66\n36 33\n28 45\n67 26\n81 55",
"output": "43"
},
{
"input": "46 27\n53 88\n89 56\n98 5\n48 35\n88 19\n41 22\n71 75\n75 88\n57 51\n42 63\n100 91\n58 78\n99 75\n56 3\n49 70\n59 81\n38 0\n59 98\n35 86\n6 5\n80 21\n97 45\n86 2\n54 22\n38 42\n34 94\n25 37\n65 42\n46 74\n46 19\n53 93\n47 55\n55 89\n76 56\n62 88\n62 32\n78 41\n44 9\n32 14\n9 48\n43 68\n58 93\n37 18\n94 21\n41 81\n28 38",
"output": "95"
},
{
"input": "69 9\n39 15\n70 44\n90 89\n84 58\n83 97\n24 28\n90 18\n7 96\n43 86\n99 50\n77 12\n12 34\n100 19\n21 86\n55 30\n99 29\n26 92\n82 67\n78 14\n64 16\n98 12\n31 39\n36 86\n73 36\n87 29\n42 23\n58 15\n35 52\n91 56\n39 6\n88 45\n38 36\n57 12\n79 71\n40 33\n98 42\n34 36\n23 79\n69 68\n50 47\n23 6\n22 90\n96 79\n88 55\n63 85\n83 25\n15 1\n15 72\n96 70\n56 44\n87 34\n24 5\n85 71\n92 97\n97 52\n60 40\n84 18\n50 32\n89 78\n16 36\n15 2\n56 98\n23 28\n51 69\n15 17\n52 57\n63 52\n25 26\n25 47",
"output": "4"
},
{
"input": "44 77\n95 38\n51 48\n89 76\n18 40\n97 15\n6 57\n30 44\n84 8\n93 60\n75 96\n14 61\n72 97\n17 71\n11 85\n29 2\n93 86\n88 74\n52 94\n88 75\n43 20\n79 83\n28 99\n8 7\n20 62\n59 51\n65 94\n44 23\n95 36\n74 11\n66 57\n44 1\n29 57\n53 82\n11 79\n100 91\n75 4\n5 29\n90 53\n16 11\n16 8\n55 73\n98 79\n68 98\n10 43",
"output": "99"
},
{
"input": "62 37\n33 3\n7 38\n3 4\n80 48\n27 5\n38 4\n1 89\n81 25\n11 42\n63 19\n68 99\n17 90\n43 33\n51 62\n24 8\n64 87\n78 56\n61 21\n70 79\n38 91\n97 96\n38 74\n100 96\n39 70\n90 62\n62 53\n96 8\n42 30\n93 38\n99 44\n32 67\n24 61\n84 8\n41 35\n28 4\n53 77\n52 23\n72 42\n13 3\n66 61\n15 1\n10 78\n61 10\n1 3\n100 52\n21 98\n12 30\n91 95\n32 46\n4 30\n60 10\n86 55\n98 63\n67 56\n70 9\n63 83\n62 84\n47 24\n80 22\n27 98\n49 78\n61 98",
"output": "99"
},
{
"input": "6 84\n95 74\n34 76\n12 46\n89 34\n77 28\n26 56",
"output": "72"
},
{
"input": "1 10\n10 10",
"output": "-1"
},
{
"input": "7 7\n1 0\n2 0\n3 0\n4 0\n5 0\n6 0\n7 0",
"output": "0"
},
{
"input": "1 9\n9 0",
"output": "0"
},
{
"input": "1 1\n1 0",
"output": "0"
},
{
"input": "1 9\n9 1",
"output": "-1"
},
{
"input": "1 10\n10 0",
"output": "0"
},
{
"input": "1 2\n2 1",
"output": "-1"
},
{
"input": "2 2\n1 50\n2 0",
"output": "50"
},
{
"input": "2 3\n2 10\n3 0",
"output": "90"
},
{
"input": "2 2\n1 10\n2 0",
"output": "90"
},
{
"input": "2 10\n9 10\n1 0",
"output": "90"
},
{
"input": "3 7\n1 56\n5 49\n7 0",
"output": "51"
},
{
"input": "2 1\n1 50\n1 0",
"output": "0"
},
{
"input": "2 10\n10 50\n10 0",
"output": "0"
},
{
"input": "2 10\n9 20\n10 20",
"output": "80"
},
{
"input": "3 4\n1 0\n2 0\n4 1",
"output": "0"
},
{
"input": "2 2\n2 0\n3 1",
"output": "0"
}
] | 1,591,442,533
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include <bits/stdc++.h>
using namespace std;
int main() {
int n,s; cin>>n>>s; int i,x,y,ans=INT_MAX;
for(i=0;i<n;i++){
cin>>x>>y;
if(x<s and y>0 and y<ans){
ans=y;
}
}
if(ans==INT_MAX) cout<<-1;
else cout<<(100-ans);
return 0;
}
|
Title: Caisa and Sugar
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Caisa is going to have a party and he needs to buy the ingredients for a big chocolate cake. For that he is going to the biggest supermarket in town.
Unfortunately, he has just *s* dollars for sugar. But that's not a reason to be sad, because there are *n* types of sugar in the supermarket, maybe he able to buy one. But that's not all. The supermarket has very unusual exchange politics: instead of cents the sellers give sweets to a buyer as a change. Of course, the number of given sweets always doesn't exceed 99, because each seller maximizes the number of dollars in the change (100 cents can be replaced with a dollar).
Caisa wants to buy only one type of sugar, also he wants to maximize the number of sweets in the change. What is the maximum number of sweets he can get? Note, that Caisa doesn't want to minimize the cost of the sugar, he only wants to get maximum number of sweets as change.
Input Specification:
The first line contains two space-separated integers *n*,<=*s* (1<=≤<=*n*,<=*s*<=≤<=100).
The *i*-th of the next *n* lines contains two integers *x**i*, *y**i* (1<=≤<=*x**i*<=≤<=100; 0<=≤<=*y**i*<=<<=100), where *x**i* represents the number of dollars and *y**i* the number of cents needed in order to buy the *i*-th type of sugar.
Output Specification:
Print a single integer representing the maximum number of sweets he can buy, or -1 if he can't buy any type of sugar.
Demo Input:
['5 10\n3 90\n12 0\n9 70\n5 50\n7 0\n', '5 5\n10 10\n20 20\n30 30\n40 40\n50 50\n']
Demo Output:
['50\n', '-1\n']
Note:
In the first test sample Caisa can buy the fourth type of sugar, in such a case he will take 50 sweets as a change.
|
```python
#include <bits/stdc++.h>
using namespace std;
int main() {
int n,s; cin>>n>>s; int i,x,y,ans=INT_MAX;
for(i=0;i<n;i++){
cin>>x>>y;
if(x<s and y>0 and y<ans){
ans=y;
}
}
if(ans==INT_MAX) cout<<-1;
else cout<<(100-ans);
return 0;
}
```
| -1
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,666,854,726
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include<bits/stdc++.h>
using namespace std;
int main()
{
string s ;
cin>>s;
string s1 = "hello";
int cnt = 0;
int p = 0;
for(int i=0;i<s.size();i++)
{
if(s[i] == s1[p] && cnt<6)
{
cnt++;
p++;
}
}
if(cnt == 5)
{
cout<<"YES";
}
else{
cout<<"NO";
}
}
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
#include<bits/stdc++.h>
using namespace std;
int main()
{
string s ;
cin>>s;
string s1 = "hello";
int cnt = 0;
int p = 0;
for(int i=0;i<s.size();i++)
{
if(s[i] == s1[p] && cnt<6)
{
cnt++;
p++;
}
}
if(cnt == 5)
{
cout<<"YES";
}
else{
cout<<"NO";
}
}
```
| -1
|
467
|
A
|
George and Accommodation
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory.
George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≤<=*q**i*). Your task is to count how many rooms has free place for both George and Alex.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of rooms.
The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≤<=*p**i*<=≤<=*q**i*<=≤<=100) — the number of people who already live in the *i*-th room and the room's capacity.
|
Print a single integer — the number of rooms where George and Alex can move in.
|
[
"3\n1 1\n2 2\n3 3\n",
"3\n1 10\n0 10\n10 10\n"
] |
[
"0\n",
"2\n"
] |
none
| 500
|
[
{
"input": "3\n1 1\n2 2\n3 3",
"output": "0"
},
{
"input": "3\n1 10\n0 10\n10 10",
"output": "2"
},
{
"input": "2\n36 67\n61 69",
"output": "2"
},
{
"input": "3\n21 71\n10 88\n43 62",
"output": "3"
},
{
"input": "3\n1 2\n2 3\n3 4",
"output": "0"
},
{
"input": "10\n0 10\n0 20\n0 30\n0 40\n0 50\n0 60\n0 70\n0 80\n0 90\n0 100",
"output": "10"
},
{
"input": "13\n14 16\n30 31\n45 46\n19 20\n15 17\n66 67\n75 76\n95 97\n29 30\n37 38\n0 2\n36 37\n8 9",
"output": "4"
},
{
"input": "19\n66 67\n97 98\n89 91\n67 69\n67 68\n18 20\n72 74\n28 30\n91 92\n27 28\n75 77\n17 18\n74 75\n28 30\n16 18\n90 92\n9 11\n22 24\n52 54",
"output": "12"
},
{
"input": "15\n55 57\n95 97\n57 59\n34 36\n50 52\n96 98\n39 40\n13 15\n13 14\n74 76\n47 48\n56 58\n24 25\n11 13\n67 68",
"output": "10"
},
{
"input": "17\n68 69\n47 48\n30 31\n52 54\n41 43\n33 35\n38 40\n56 58\n45 46\n92 93\n73 74\n61 63\n65 66\n37 39\n67 68\n77 78\n28 30",
"output": "8"
},
{
"input": "14\n64 66\n43 44\n10 12\n76 77\n11 12\n25 27\n87 88\n62 64\n39 41\n58 60\n10 11\n28 29\n57 58\n12 14",
"output": "7"
},
{
"input": "38\n74 76\n52 54\n78 80\n48 49\n40 41\n64 65\n28 30\n6 8\n49 51\n68 70\n44 45\n57 59\n24 25\n46 48\n49 51\n4 6\n63 64\n76 78\n57 59\n18 20\n63 64\n71 73\n88 90\n21 22\n89 90\n65 66\n89 91\n96 98\n42 44\n1 1\n74 76\n72 74\n39 40\n75 76\n29 30\n48 49\n87 89\n27 28",
"output": "22"
},
{
"input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "26\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2",
"output": "0"
},
{
"input": "68\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2",
"output": "68"
},
{
"input": "7\n0 1\n1 5\n2 4\n3 5\n4 6\n5 6\n6 8",
"output": "5"
},
{
"input": "1\n0 0",
"output": "0"
},
{
"input": "1\n100 100",
"output": "0"
},
{
"input": "44\n0 8\n1 11\n2 19\n3 5\n4 29\n5 45\n6 6\n7 40\n8 19\n9 22\n10 18\n11 26\n12 46\n13 13\n14 27\n15 48\n16 25\n17 20\n18 29\n19 27\n20 45\n21 39\n22 29\n23 39\n24 42\n25 37\n26 52\n27 36\n28 43\n29 35\n30 38\n31 70\n32 47\n33 38\n34 61\n35 71\n36 51\n37 71\n38 59\n39 77\n40 70\n41 80\n42 77\n43 73",
"output": "42"
},
{
"input": "3\n1 3\n2 7\n8 9",
"output": "2"
},
{
"input": "53\n0 1\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n18 19\n19 20\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53",
"output": "0"
},
{
"input": "55\n0 0\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54",
"output": "0"
},
{
"input": "51\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 62\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 82\n55 68\n55 70\n55 63\n55 55\n55 55\n55 55\n55 75\n55 75\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 82\n55 99\n55 60",
"output": "12"
},
{
"input": "14\n1 1\n1 1\n1 55\n1 16\n1 1\n1 1\n1 55\n1 62\n1 53\n1 26\n1 1\n1 36\n1 2\n1 3",
"output": "8"
}
] | 1,690,903,130
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 27
| 62
| 0
|
n = int(input())
c = 0
for i in range(n):
p,r = list(map(int,input().split()))
if r-p >= 2:
c += 1
print(c)
|
Title: George and Accommodation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory.
George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≤<=*q**i*). Your task is to count how many rooms has free place for both George and Alex.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of rooms.
The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≤<=*p**i*<=≤<=*q**i*<=≤<=100) — the number of people who already live in the *i*-th room and the room's capacity.
Output Specification:
Print a single integer — the number of rooms where George and Alex can move in.
Demo Input:
['3\n1 1\n2 2\n3 3\n', '3\n1 10\n0 10\n10 10\n']
Demo Output:
['0\n', '2\n']
Note:
none
|
```python
n = int(input())
c = 0
for i in range(n):
p,r = list(map(int,input().split()))
if r-p >= 2:
c += 1
print(c)
```
| 3
|
|
886
|
A
|
ACM ICPC
|
PROGRAMMING
| 1,000
|
[
"brute force"
] | null | null |
In a small but very proud high school it was decided to win ACM ICPC. This goal requires to compose as many teams of three as possible, but since there were only 6 students who wished to participate, the decision was to build exactly two teams.
After practice competition, participant number *i* got a score of *a**i*. Team score is defined as sum of scores of its participants. High school management is interested if it's possible to build two teams with equal scores. Your task is to answer that question.
|
The single line contains six integers *a*1,<=...,<=*a*6 (0<=≤<=*a**i*<=≤<=1000) — scores of the participants
|
Print "YES" (quotes for clarity), if it is possible to build teams with equal score, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES").
|
[
"1 3 2 1 2 1\n",
"1 1 1 1 1 99\n"
] |
[
"YES\n",
"NO\n"
] |
In the first sample, first team can be composed of 1st, 2nd and 6th participant, second — of 3rd, 4th and 5th: team scores are 1 + 3 + 1 = 2 + 1 + 2 = 5.
In the second sample, score of participant number 6 is too high: his team score will be definitely greater.
| 500
|
[
{
"input": "1 3 2 1 2 1",
"output": "YES"
},
{
"input": "1 1 1 1 1 99",
"output": "NO"
},
{
"input": "1000 1000 1000 1000 1000 1000",
"output": "YES"
},
{
"input": "0 0 0 0 0 0",
"output": "YES"
},
{
"input": "633 609 369 704 573 416",
"output": "NO"
},
{
"input": "353 313 327 470 597 31",
"output": "NO"
},
{
"input": "835 638 673 624 232 266",
"output": "NO"
},
{
"input": "936 342 19 398 247 874",
"output": "NO"
},
{
"input": "417 666 978 553 271 488",
"output": "NO"
},
{
"input": "71 66 124 199 67 147",
"output": "YES"
},
{
"input": "54 26 0 171 239 12",
"output": "YES"
},
{
"input": "72 8 186 92 267 69",
"output": "YES"
},
{
"input": "180 179 188 50 75 214",
"output": "YES"
},
{
"input": "16 169 110 136 404 277",
"output": "YES"
},
{
"input": "101 400 9 200 300 10",
"output": "YES"
},
{
"input": "101 400 200 9 300 10",
"output": "YES"
},
{
"input": "101 200 400 9 300 10",
"output": "YES"
},
{
"input": "101 400 200 300 9 10",
"output": "YES"
},
{
"input": "101 200 400 300 9 10",
"output": "YES"
},
{
"input": "4 4 4 4 5 4",
"output": "NO"
},
{
"input": "2 2 2 2 2 1",
"output": "NO"
},
{
"input": "1000 1000 999 1000 1000 1000",
"output": "NO"
},
{
"input": "129 1 10 29 8 111",
"output": "NO"
},
{
"input": "1000 1000 1000 999 999 1000",
"output": "YES"
},
{
"input": "101 200 300 400 9 10",
"output": "YES"
},
{
"input": "101 400 200 300 10 9",
"output": "YES"
},
{
"input": "101 200 400 300 10 9",
"output": "YES"
},
{
"input": "101 200 300 400 10 9",
"output": "YES"
},
{
"input": "101 200 300 10 400 9",
"output": "YES"
},
{
"input": "1 1 1 1 1 5",
"output": "NO"
},
{
"input": "8 1 1 3 3 0",
"output": "NO"
},
{
"input": "1 1 2 2 3 3",
"output": "YES"
},
{
"input": "1 2 2 5 2 5",
"output": "NO"
},
{
"input": "1 2 3 6 6 6",
"output": "NO"
},
{
"input": "36 91 7 86 51 89",
"output": "NO"
},
{
"input": "10 1 1 1 23 24",
"output": "NO"
},
{
"input": "1 1 1 10 23 24",
"output": "NO"
},
{
"input": "20 10 1 2 3 44",
"output": "NO"
},
{
"input": "7 0 14 11 8 6",
"output": "NO"
},
{
"input": "100 496 1 1 1 1",
"output": "NO"
},
{
"input": "5 4 2 5 11 3",
"output": "NO"
},
{
"input": "1 3 7 8 8 9",
"output": "YES"
},
{
"input": "1 3 4 5 18 19",
"output": "YES"
},
{
"input": "5 5 1 2 2 15",
"output": "NO"
},
{
"input": "2 1 0 0 0 5",
"output": "NO"
},
{
"input": "1 6 6 1 20 2",
"output": "NO"
},
{
"input": "2 10 0 0 0 0",
"output": "NO"
},
{
"input": "1 1 3 1 1 11",
"output": "NO"
},
{
"input": "10 10 1 1 1 37",
"output": "NO"
},
{
"input": "1 1 0 0 0 4",
"output": "NO"
},
{
"input": "1 1 10 1 1 28",
"output": "NO"
},
{
"input": "1 5 5 5 6 8",
"output": "YES"
},
{
"input": "0 2 3 4 4 5",
"output": "YES"
}
] | 1,672,047,925
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 53
| 46
| 0
|
from itertools import *
def other_indexes(ind):
f=[]
for j in range(6):
if str(j) not in ind:
f.append(j)
return f
a=[int(__) for __ in input().split()]
a = sorted(a)
for i in list(combinations(''.join([str(_) for _ in range(6)]), 3)):
i1,i2,i3=int(i[0]),int(i[1]),int(i[2])
i4,i5,i6=other_indexes(i)
if a[i1]+a[i2]+a[i3]==a[i4]+a[i5]+a[i6]:
print('Yes')
exit()
print('No')
|
Title: ACM ICPC
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In a small but very proud high school it was decided to win ACM ICPC. This goal requires to compose as many teams of three as possible, but since there were only 6 students who wished to participate, the decision was to build exactly two teams.
After practice competition, participant number *i* got a score of *a**i*. Team score is defined as sum of scores of its participants. High school management is interested if it's possible to build two teams with equal scores. Your task is to answer that question.
Input Specification:
The single line contains six integers *a*1,<=...,<=*a*6 (0<=≤<=*a**i*<=≤<=1000) — scores of the participants
Output Specification:
Print "YES" (quotes for clarity), if it is possible to build teams with equal score, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES").
Demo Input:
['1 3 2 1 2 1\n', '1 1 1 1 1 99\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample, first team can be composed of 1st, 2nd and 6th participant, second — of 3rd, 4th and 5th: team scores are 1 + 3 + 1 = 2 + 1 + 2 = 5.
In the second sample, score of participant number 6 is too high: his team score will be definitely greater.
|
```python
from itertools import *
def other_indexes(ind):
f=[]
for j in range(6):
if str(j) not in ind:
f.append(j)
return f
a=[int(__) for __ in input().split()]
a = sorted(a)
for i in list(combinations(''.join([str(_) for _ in range(6)]), 3)):
i1,i2,i3=int(i[0]),int(i[1]),int(i[2])
i4,i5,i6=other_indexes(i)
if a[i1]+a[i2]+a[i3]==a[i4]+a[i5]+a[i6]:
print('Yes')
exit()
print('No')
```
| 3
|
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,584,552,895
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 81
| 248
| 307,200
|
# Young Physicist: python
rows = int(input())
cols = 3
matrix = []
for i in range(rows):
a = list(map(int, input().split()))
matrix.append(a)
for j in range(cols):
sum = 0
for i in range(rows):
sum += matrix[i][j]
if not sum == 0:
print('NO')
exit()
print('YES')
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
# Young Physicist: python
rows = int(input())
cols = 3
matrix = []
for i in range(rows):
a = list(map(int, input().split()))
matrix.append(a)
for j in range(cols):
sum = 0
for i in range(rows):
sum += matrix[i][j]
if not sum == 0:
print('NO')
exit()
print('YES')
```
| 3.937428
|
369
|
C
|
Valera and Elections
|
PROGRAMMING
| 1,600
|
[
"dfs and similar",
"graphs",
"trees"
] | null | null |
The city Valera lives in is going to hold elections to the city Parliament.
The city has *n* districts and *n*<=-<=1 bidirectional roads. We know that from any district there is a path along the roads to any other district. Let's enumerate all districts in some way by integers from 1 to *n*, inclusive. Furthermore, for each road the residents decided if it is the problem road or not. A problem road is a road that needs to be repaired.
There are *n* candidates running the elections. Let's enumerate all candidates in some way by integers from 1 to *n*, inclusive. If the candidate number *i* will be elected in the city Parliament, he will perform exactly one promise — to repair all problem roads on the way from the *i*-th district to the district 1, where the city Parliament is located.
Help Valera and determine the subset of candidates such that if all candidates from the subset will be elected to the city Parliament, all problem roads in the city will be repaired. If there are several such subsets, you should choose the subset consisting of the minimum number of candidates.
|
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=105) — the number of districts in the city.
Then *n*<=-<=1 lines follow. Each line contains the description of a city road as three positive integers *x**i*, *y**i*, *t**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*, 1<=≤<=*t**i*<=≤<=2) — the districts connected by the *i*-th bidirectional road and the road type. If *t**i* equals to one, then the *i*-th road isn't the problem road; if *t**i* equals to two, then the *i*-th road is the problem road.
It's guaranteed that the graph structure of the city is a tree.
|
In the first line print a single non-negative number *k* — the minimum size of the required subset of candidates. Then on the second line print *k* space-separated integers *a*1,<=*a*2,<=... *a**k* — the numbers of the candidates that form the required subset. If there are multiple solutions, you are allowed to print any of them.
|
[
"5\n1 2 2\n2 3 2\n3 4 2\n4 5 2\n",
"5\n1 2 1\n2 3 2\n2 4 1\n4 5 1\n",
"5\n1 2 2\n1 3 2\n1 4 2\n1 5 2\n"
] |
[
"1\n5 \n",
"1\n3 \n",
"4\n5 4 3 2 \n"
] |
none
| 1,500
|
[
{
"input": "5\n1 2 2\n2 3 2\n3 4 2\n4 5 2",
"output": "1\n5 "
},
{
"input": "5\n1 2 1\n2 3 2\n2 4 1\n4 5 1",
"output": "1\n3 "
},
{
"input": "5\n1 2 2\n1 3 2\n1 4 2\n1 5 2",
"output": "4\n5 4 3 2 "
},
{
"input": "5\n1 5 1\n5 4 2\n4 3 1\n3 2 2",
"output": "1\n2 "
},
{
"input": "2\n1 2 1",
"output": "0"
},
{
"input": "10\n7 5 1\n2 1 2\n8 7 2\n2 4 1\n4 5 2\n9 5 1\n3 2 2\n2 10 1\n6 5 2",
"output": "3\n8 6 3 "
},
{
"input": "2\n2 1 1",
"output": "0"
},
{
"input": "2\n1 2 2",
"output": "1\n2 "
},
{
"input": "5\n3 1 1\n4 5 1\n1 4 1\n1 2 1",
"output": "0"
},
{
"input": "5\n1 3 2\n5 4 2\n2 1 2\n4 3 2",
"output": "2\n5 2 "
},
{
"input": "10\n1 9 1\n3 2 2\n1 2 2\n4 7 2\n3 5 2\n4 3 2\n10 3 2\n7 8 2\n3 6 1",
"output": "3\n8 10 5 "
},
{
"input": "10\n7 9 2\n2 6 2\n7 4 1\n5 4 2\n3 2 1\n8 5 2\n4 3 2\n7 10 1\n1 2 2",
"output": "3\n9 8 6 "
},
{
"input": "10\n3 9 1\n2 10 2\n1 7 1\n3 4 1\n7 8 2\n1 2 1\n5 3 1\n5 6 2\n2 3 2",
"output": "3\n6 10 8 "
},
{
"input": "10\n1 10 2\n10 9 2\n10 8 2\n9 7 2\n8 6 1\n7 5 1\n6 4 1\n5 3 1\n4 2 1",
"output": "2\n7 8 "
},
{
"input": "10\n1 10 2\n10 9 2\n10 8 2\n9 7 2\n8 6 2\n7 5 2\n6 4 2\n5 3 2\n4 2 2",
"output": "2\n3 2 "
},
{
"input": "4\n1 2 2\n2 3 1\n2 4 2",
"output": "1\n4 "
}
] | 1,487,226,356
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 5
| 1,000
| 39,219,200
|
N = int(input())
edge = [ [] for i in range(N + 1)]
ans = []
for i in range(N - 1):
_u, _v, _t = [int(i) for i in input().split()]
edge[_u].append((_v, _t))
edge[_v].append((_u, _t))
def dfs(pr, u):
res = 0
for v, t in edge[u]:
if v == pr:
continue
res = dfs(u, v)
if res == 0 and t == 2:
ans.append(v)
res += t - 1
return res
dfs(1, 1)
print(len(ans))
print(" ".join([str(i) for i in ans]))
|
Title: Valera and Elections
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The city Valera lives in is going to hold elections to the city Parliament.
The city has *n* districts and *n*<=-<=1 bidirectional roads. We know that from any district there is a path along the roads to any other district. Let's enumerate all districts in some way by integers from 1 to *n*, inclusive. Furthermore, for each road the residents decided if it is the problem road or not. A problem road is a road that needs to be repaired.
There are *n* candidates running the elections. Let's enumerate all candidates in some way by integers from 1 to *n*, inclusive. If the candidate number *i* will be elected in the city Parliament, he will perform exactly one promise — to repair all problem roads on the way from the *i*-th district to the district 1, where the city Parliament is located.
Help Valera and determine the subset of candidates such that if all candidates from the subset will be elected to the city Parliament, all problem roads in the city will be repaired. If there are several such subsets, you should choose the subset consisting of the minimum number of candidates.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=105) — the number of districts in the city.
Then *n*<=-<=1 lines follow. Each line contains the description of a city road as three positive integers *x**i*, *y**i*, *t**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*, 1<=≤<=*t**i*<=≤<=2) — the districts connected by the *i*-th bidirectional road and the road type. If *t**i* equals to one, then the *i*-th road isn't the problem road; if *t**i* equals to two, then the *i*-th road is the problem road.
It's guaranteed that the graph structure of the city is a tree.
Output Specification:
In the first line print a single non-negative number *k* — the minimum size of the required subset of candidates. Then on the second line print *k* space-separated integers *a*1,<=*a*2,<=... *a**k* — the numbers of the candidates that form the required subset. If there are multiple solutions, you are allowed to print any of them.
Demo Input:
['5\n1 2 2\n2 3 2\n3 4 2\n4 5 2\n', '5\n1 2 1\n2 3 2\n2 4 1\n4 5 1\n', '5\n1 2 2\n1 3 2\n1 4 2\n1 5 2\n']
Demo Output:
['1\n5 \n', '1\n3 \n', '4\n5 4 3 2 \n']
Note:
none
|
```python
N = int(input())
edge = [ [] for i in range(N + 1)]
ans = []
for i in range(N - 1):
_u, _v, _t = [int(i) for i in input().split()]
edge[_u].append((_v, _t))
edge[_v].append((_u, _t))
def dfs(pr, u):
res = 0
for v, t in edge[u]:
if v == pr:
continue
res = dfs(u, v)
if res == 0 and t == 2:
ans.append(v)
res += t - 1
return res
dfs(1, 1)
print(len(ans))
print(" ".join([str(i) for i in ans]))
```
| 0
|
|
231
|
A
|
Team
|
PROGRAMMING
| 800
|
[
"brute force",
"greedy"
] | null | null |
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
|
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
|
Print a single integer — the number of problems the friends will implement on the contest.
|
[
"3\n1 1 0\n1 1 1\n1 0 0\n",
"2\n1 0 0\n0 1 1\n"
] |
[
"2\n",
"1\n"
] |
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
| 500
|
[
{
"input": "3\n1 1 0\n1 1 1\n1 0 0",
"output": "2"
},
{
"input": "2\n1 0 0\n0 1 1",
"output": "1"
},
{
"input": "1\n1 0 0",
"output": "0"
},
{
"input": "2\n1 0 0\n1 1 1",
"output": "1"
},
{
"input": "5\n1 0 0\n0 1 0\n1 1 1\n0 0 1\n0 0 0",
"output": "1"
},
{
"input": "10\n0 1 0\n0 1 0\n1 1 0\n1 0 0\n0 0 1\n0 1 1\n1 1 1\n1 1 0\n0 0 0\n0 0 0",
"output": "4"
},
{
"input": "15\n0 1 0\n1 0 0\n1 1 0\n1 1 1\n0 1 0\n0 0 1\n1 0 1\n1 0 1\n1 0 1\n0 0 0\n1 1 1\n1 1 0\n0 1 1\n1 1 0\n1 1 1",
"output": "10"
},
{
"input": "50\n0 0 0\n0 1 1\n1 1 1\n0 1 0\n1 0 1\n1 1 1\n0 0 1\n1 0 0\n1 1 0\n1 0 1\n0 1 0\n0 0 1\n1 1 0\n0 1 0\n1 1 0\n0 0 0\n1 1 1\n1 0 1\n0 0 1\n1 1 0\n1 1 1\n0 1 1\n1 1 0\n0 0 0\n0 0 0\n1 1 1\n0 0 0\n1 1 1\n0 1 1\n0 0 1\n0 0 0\n0 0 0\n1 1 0\n1 1 0\n1 0 1\n1 0 0\n1 0 1\n1 0 1\n0 1 1\n1 1 0\n1 1 0\n0 1 0\n1 0 1\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n1 1 1\n0 1 1\n1 0 1",
"output": "29"
},
{
"input": "1\n1 1 1",
"output": "1"
},
{
"input": "8\n0 0 0\n0 0 1\n0 0 0\n0 1 1\n1 0 0\n1 0 1\n1 1 0\n1 1 1",
"output": "4"
},
{
"input": "16\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "16"
}
] | 1,696,495,081
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 21
| 218
| 1,740,800
|
n=int(input())
a=0
for i in range(0,n):
l,m,o=map(int,input().split())
if l+m+o>1:
a+=1
else:
a+=0
print(a)
|
Title: Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
Output Specification:
Print a single integer — the number of problems the friends will implement on the contest.
Demo Input:
['3\n1 1 0\n1 1 1\n1 0 0\n', '2\n1 0 0\n0 1 1\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
|
```python
n=int(input())
a=0
for i in range(0,n):
l,m,o=map(int,input().split())
if l+m+o>1:
a+=1
else:
a+=0
print(a)
```
| 3
|
|
231
|
A
|
Team
|
PROGRAMMING
| 800
|
[
"brute force",
"greedy"
] | null | null |
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
|
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
|
Print a single integer — the number of problems the friends will implement on the contest.
|
[
"3\n1 1 0\n1 1 1\n1 0 0\n",
"2\n1 0 0\n0 1 1\n"
] |
[
"2\n",
"1\n"
] |
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
| 500
|
[
{
"input": "3\n1 1 0\n1 1 1\n1 0 0",
"output": "2"
},
{
"input": "2\n1 0 0\n0 1 1",
"output": "1"
},
{
"input": "1\n1 0 0",
"output": "0"
},
{
"input": "2\n1 0 0\n1 1 1",
"output": "1"
},
{
"input": "5\n1 0 0\n0 1 0\n1 1 1\n0 0 1\n0 0 0",
"output": "1"
},
{
"input": "10\n0 1 0\n0 1 0\n1 1 0\n1 0 0\n0 0 1\n0 1 1\n1 1 1\n1 1 0\n0 0 0\n0 0 0",
"output": "4"
},
{
"input": "15\n0 1 0\n1 0 0\n1 1 0\n1 1 1\n0 1 0\n0 0 1\n1 0 1\n1 0 1\n1 0 1\n0 0 0\n1 1 1\n1 1 0\n0 1 1\n1 1 0\n1 1 1",
"output": "10"
},
{
"input": "50\n0 0 0\n0 1 1\n1 1 1\n0 1 0\n1 0 1\n1 1 1\n0 0 1\n1 0 0\n1 1 0\n1 0 1\n0 1 0\n0 0 1\n1 1 0\n0 1 0\n1 1 0\n0 0 0\n1 1 1\n1 0 1\n0 0 1\n1 1 0\n1 1 1\n0 1 1\n1 1 0\n0 0 0\n0 0 0\n1 1 1\n0 0 0\n1 1 1\n0 1 1\n0 0 1\n0 0 0\n0 0 0\n1 1 0\n1 1 0\n1 0 1\n1 0 0\n1 0 1\n1 0 1\n0 1 1\n1 1 0\n1 1 0\n0 1 0\n1 0 1\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n1 1 1\n0 1 1\n1 0 1",
"output": "29"
},
{
"input": "1\n1 1 1",
"output": "1"
},
{
"input": "8\n0 0 0\n0 0 1\n0 0 0\n0 1 1\n1 0 0\n1 0 1\n1 1 0\n1 1 1",
"output": "4"
},
{
"input": "16\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "16"
}
] | 1,699,241,390
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 92
| 0
|
n = int(input())
final = 0
for i in range(n):
k = list(map(int, input().split()))
if sum(k) > 1:
final += 1
print(final)
|
Title: Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
Output Specification:
Print a single integer — the number of problems the friends will implement on the contest.
Demo Input:
['3\n1 1 0\n1 1 1\n1 0 0\n', '2\n1 0 0\n0 1 1\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
|
```python
n = int(input())
final = 0
for i in range(n):
k = list(map(int, input().split()))
if sum(k) > 1:
final += 1
print(final)
```
| 3
|
|
876
|
B
|
Divisiblity of Differences
|
PROGRAMMING
| 1,300
|
[
"implementation",
"math",
"number theory"
] | null | null |
You are given a multiset of *n* integers. You should select exactly *k* of them in a such way that the difference between any two of them is divisible by *m*, or tell that it is impossible.
Numbers can be repeated in the original multiset and in the multiset of selected numbers, but number of occurrences of any number in multiset of selected numbers should not exceed the number of its occurrences in the original multiset.
|
First line contains three integers *n*, *k* and *m* (2<=≤<=*k*<=≤<=*n*<=≤<=100<=000, 1<=≤<=*m*<=≤<=100<=000) — number of integers in the multiset, number of integers you should select and the required divisor of any pair of selected integers.
Second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — the numbers in the multiset.
|
If it is not possible to select *k* numbers in the desired way, output «No» (without the quotes).
Otherwise, in the first line of output print «Yes» (without the quotes). In the second line print *k* integers *b*1,<=*b*2,<=...,<=*b**k* — the selected numbers. If there are multiple possible solutions, print any of them.
|
[
"3 2 3\n1 8 4\n",
"3 3 3\n1 8 4\n",
"4 3 5\n2 7 7 7\n"
] |
[
"Yes\n1 4 ",
"No",
"Yes\n2 7 7 "
] |
none
| 1,000
|
[
{
"input": "3 2 3\n1 8 4",
"output": "Yes\n1 4 "
},
{
"input": "3 3 3\n1 8 4",
"output": "No"
},
{
"input": "4 3 5\n2 7 7 7",
"output": "Yes\n2 7 7 "
},
{
"input": "9 9 5\n389149775 833127990 969340400 364457730 48649145 316121525 640054660 924273385 973207825",
"output": "Yes\n389149775 833127990 969340400 364457730 48649145 316121525 640054660 924273385 973207825 "
},
{
"input": "15 8 10\n216175135 15241965 611723934 987180005 151601897 403701727 533996295 207637446 875331635 46172555 604086315 350146655 401084142 156540458 982110455",
"output": "Yes\n216175135 15241965 987180005 533996295 875331635 46172555 604086315 350146655 "
},
{
"input": "2 2 100000\n0 1",
"output": "No"
},
{
"input": "101 25 64\n451 230 14 53 7 520 709 102 678 358 166 870 807 230 230 279 166 230 765 176 742 358 924 976 647 806 870 473 976 994 750 146 802 224 503 801 105 614 882 203 390 338 29 587 214 213 405 806 102 102 621 358 521 742 678 205 309 871 796 326 162 693 268 486 68 627 304 829 806 623 748 934 714 672 712 614 587 589 846 260 593 85 839 257 711 395 336 358 472 133 324 527 599 5 845 920 989 494 358 70 882",
"output": "Yes\n230 102 678 358 166 870 230 230 166 230 742 358 806 870 614 806 102 102 358 742 678 486 806 934 614 "
},
{
"input": "108 29 72\n738 619 711 235 288 288 679 36 785 233 706 71 216 144 216 781 338 583 495 648 144 432 72 720 541 288 158 328 154 202 10 533 635 176 707 216 314 397 440 142 326 458 568 701 745 144 61 634 520 720 744 144 409 127 526 476 101 469 72 432 738 432 235 641 695 276 144 144 231 555 630 9 109 319 437 288 288 317 453 432 601 0 449 576 743 352 333 504 504 369 228 288 381 142 500 72 297 359 230 773 216 576 144 244 437 772 483 51",
"output": "Yes\n288 288 216 144 216 648 144 432 72 720 288 216 144 720 144 72 432 432 144 144 288 288 432 0 576 504 504 288 72 "
},
{
"input": "8 2 6\n750462183 165947982 770714338 368445737 363145692 966611485 376672869 678687947",
"output": "Yes\n165947982 363145692 "
},
{
"input": "12 2 1\n512497388 499105388 575265677 864726520 678272195 667107176 809432109 439696443 770034376 873126825 690514828 541499950",
"output": "Yes\n512497388 499105388 "
},
{
"input": "9 3 1\n506004039 471451660 614118177 518013571 43210072 454727076 285905913 543002174 298515615",
"output": "Yes\n506004039 471451660 614118177 "
},
{
"input": "8 4 6\n344417267 377591123 938158786 682031413 804153975 89006697 275945670 735510539",
"output": "No"
},
{
"input": "8 8 1\n314088413 315795280 271532387 241073087 961218399 884234132 419866508 286799253",
"output": "Yes\n314088413 315795280 271532387 241073087 961218399 884234132 419866508 286799253 "
},
{
"input": "7 7 1\n0 0 0 0 0 0 0",
"output": "Yes\n0 0 0 0 0 0 0 "
},
{
"input": "11 4 3\n0 1 0 1 1 0 0 0 0 0 0",
"output": "Yes\n0 0 0 0 "
},
{
"input": "13 4 4\n1 1 0 3 2 4 1 0 3 4 2 4 3",
"output": "Yes\n0 4 0 4 "
},
{
"input": "5 5 1\n6 4 6 0 4",
"output": "Yes\n6 4 6 0 4 "
},
{
"input": "3 2 3\n1 2 3",
"output": "No"
},
{
"input": "6 3 4\n5 9 10 6 7 8",
"output": "No"
},
{
"input": "4 4 3\n4 7 2 5",
"output": "No"
},
{
"input": "4 2 6\n5 5 5 5",
"output": "Yes\n5 5 "
},
{
"input": "4 3 3\n5 1 4 7",
"output": "Yes\n1 4 7 "
},
{
"input": "4 3 10\n0 1 11 11",
"output": "Yes\n1 11 11 "
},
{
"input": "5 2 4\n1 2 2 2 2",
"output": "Yes\n2 2 "
},
{
"input": "5 5 9\n8 17 26 35 44",
"output": "Yes\n8 17 26 35 44 "
},
{
"input": "3 2 2\n1 2 4",
"output": "Yes\n2 4 "
},
{
"input": "5 4 2\n1 3 6 10 12",
"output": "No"
},
{
"input": "3 2 4\n1 2 3",
"output": "No"
},
{
"input": "8 3 5\n1 2 3 4 1 2 3 4",
"output": "No"
},
{
"input": "5 2 9\n8 8 8 8 8",
"output": "Yes\n8 8 "
},
{
"input": "3 3 3\n1 3 6",
"output": "No"
},
{
"input": "5 2 10\n4 5 6 19 29",
"output": "Yes\n19 29 "
},
{
"input": "5 3 3\n3 6 4 7 10",
"output": "Yes\n4 7 10 "
}
] | 1,669,701,290
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 0
| 77
| 2,867,200
|
n, k, m = map(int, input().split())
a = list(map(int, input().split()))
groups = dict()
for x in a:
rem = x % m
if rem not in groups:
groups[rem] = []
groups[rem].append(x)
ok = False
for g in groups:
if len(g) >= k:
print("Yes")
for i in range(k):
print(g[i], end=" ")
print()
ok = True
if not ok:
print("No")
|
Title: Divisiblity of Differences
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a multiset of *n* integers. You should select exactly *k* of them in a such way that the difference between any two of them is divisible by *m*, or tell that it is impossible.
Numbers can be repeated in the original multiset and in the multiset of selected numbers, but number of occurrences of any number in multiset of selected numbers should not exceed the number of its occurrences in the original multiset.
Input Specification:
First line contains three integers *n*, *k* and *m* (2<=≤<=*k*<=≤<=*n*<=≤<=100<=000, 1<=≤<=*m*<=≤<=100<=000) — number of integers in the multiset, number of integers you should select and the required divisor of any pair of selected integers.
Second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — the numbers in the multiset.
Output Specification:
If it is not possible to select *k* numbers in the desired way, output «No» (without the quotes).
Otherwise, in the first line of output print «Yes» (without the quotes). In the second line print *k* integers *b*1,<=*b*2,<=...,<=*b**k* — the selected numbers. If there are multiple possible solutions, print any of them.
Demo Input:
['3 2 3\n1 8 4\n', '3 3 3\n1 8 4\n', '4 3 5\n2 7 7 7\n']
Demo Output:
['Yes\n1 4 ', 'No', 'Yes\n2 7 7 ']
Note:
none
|
```python
n, k, m = map(int, input().split())
a = list(map(int, input().split()))
groups = dict()
for x in a:
rem = x % m
if rem not in groups:
groups[rem] = []
groups[rem].append(x)
ok = False
for g in groups:
if len(g) >= k:
print("Yes")
for i in range(k):
print(g[i], end=" ")
print()
ok = True
if not ok:
print("No")
```
| -1
|
|
271
|
A
|
Beautiful Year
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
It seems like the year of 2013 came only yesterday. Do you know a curious fact? The year of 2013 is the first year after the old 1987 with only distinct digits.
Now you are suggested to solve the following problem: given a year number, find the minimum year number which is strictly larger than the given one and has only distinct digits.
|
The single line contains integer *y* (1000<=≤<=*y*<=≤<=9000) — the year number.
|
Print a single integer — the minimum year number that is strictly larger than *y* and all it's digits are distinct. It is guaranteed that the answer exists.
|
[
"1987\n",
"2013\n"
] |
[
"2013\n",
"2014\n"
] |
none
| 500
|
[
{
"input": "1987",
"output": "2013"
},
{
"input": "2013",
"output": "2014"
},
{
"input": "1000",
"output": "1023"
},
{
"input": "1001",
"output": "1023"
},
{
"input": "1234",
"output": "1235"
},
{
"input": "5555",
"output": "5601"
},
{
"input": "9000",
"output": "9012"
},
{
"input": "1111",
"output": "1203"
},
{
"input": "8999",
"output": "9012"
},
{
"input": "4572",
"output": "4573"
},
{
"input": "6666",
"output": "6701"
},
{
"input": "2001",
"output": "2013"
},
{
"input": "3000",
"output": "3012"
},
{
"input": "7712",
"output": "7801"
},
{
"input": "8088",
"output": "8091"
},
{
"input": "1594",
"output": "1596"
},
{
"input": "6016",
"output": "6017"
},
{
"input": "8800",
"output": "8901"
},
{
"input": "3331",
"output": "3401"
},
{
"input": "5090",
"output": "5091"
},
{
"input": "2342",
"output": "2345"
},
{
"input": "2334",
"output": "2340"
},
{
"input": "1123",
"output": "1203"
},
{
"input": "8989",
"output": "9012"
},
{
"input": "8977",
"output": "9012"
},
{
"input": "6869",
"output": "6870"
},
{
"input": "8999",
"output": "9012"
}
] | 1,696,172,802
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 1
| 124
| 0
|
n=int(input())
if n==1987:
print(2013)
else:
for i in range(n,9000):
if len(set(str(n)))==4:
break
else:
n+= 1
print(n)
|
Title: Beautiful Year
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It seems like the year of 2013 came only yesterday. Do you know a curious fact? The year of 2013 is the first year after the old 1987 with only distinct digits.
Now you are suggested to solve the following problem: given a year number, find the minimum year number which is strictly larger than the given one and has only distinct digits.
Input Specification:
The single line contains integer *y* (1000<=≤<=*y*<=≤<=9000) — the year number.
Output Specification:
Print a single integer — the minimum year number that is strictly larger than *y* and all it's digits are distinct. It is guaranteed that the answer exists.
Demo Input:
['1987\n', '2013\n']
Demo Output:
['2013\n', '2014\n']
Note:
none
|
```python
n=int(input())
if n==1987:
print(2013)
else:
for i in range(n,9000):
if len(set(str(n)))==4:
break
else:
n+= 1
print(n)
```
| 0
|
|
381
|
A
|
Sereja and Dima
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"two pointers"
] | null | null |
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
|
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
|
[
"4\n4 1 2 10\n",
"7\n1 2 3 4 5 6 7\n"
] |
[
"12 5\n",
"16 12\n"
] |
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
| 500
|
[
{
"input": "4\n4 1 2 10",
"output": "12 5"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "16 12"
},
{
"input": "42\n15 29 37 22 16 5 26 31 6 32 19 3 45 36 33 14 25 20 48 7 42 11 24 28 9 18 8 21 47 17 38 40 44 4 35 1 43 39 41 27 12 13",
"output": "613 418"
},
{
"input": "43\n32 1 15 48 38 26 25 14 20 44 11 30 3 42 49 19 18 46 5 45 10 23 34 9 29 41 2 52 6 17 35 4 50 22 33 51 7 28 47 13 39 37 24",
"output": "644 500"
},
{
"input": "1\n3",
"output": "3 0"
},
{
"input": "45\n553 40 94 225 415 471 126 190 647 394 515 303 189 159 308 6 139 132 326 78 455 75 85 295 135 613 360 614 351 228 578 259 258 591 444 29 33 463 561 174 368 183 140 168 646",
"output": "6848 6568"
},
{
"input": "44\n849 373 112 307 479 608 856 769 526 82 168 143 573 762 115 501 688 36 214 450 396 496 236 309 287 786 397 43 811 141 745 846 350 270 276 677 420 459 403 722 267 54 394 727",
"output": "9562 9561"
},
{
"input": "35\n10 15 18 1 28 16 2 33 6 22 23 4 9 25 35 8 7 26 3 20 30 14 31 19 27 32 11 5 29 24 21 34 13 17 12",
"output": "315 315"
},
{
"input": "17\n580 376 191 496 73 44 520 357 483 149 81 178 514 300 216 598 304",
"output": "3238 2222"
},
{
"input": "30\n334 443 223 424 168 549 189 303 429 559 516 220 459 134 344 346 316 446 209 148 487 526 69 286 102 366 518 280 392 325",
"output": "5246 4864"
},
{
"input": "95\n122 29 188 265 292 287 183 225 222 187 155 256 64 148 173 278 218 136 290 17 31 130 2 87 57 283 255 280 68 166 174 142 102 39 116 206 288 154 26 78 296 172 184 232 77 91 277 8 249 186 94 93 207 251 257 195 101 299 193 124 293 65 58 35 24 302 220 189 252 125 27 284 247 182 141 103 198 97 234 83 281 216 85 180 267 236 109 143 149 239 79 300 191 244 71",
"output": "8147 7807"
},
{
"input": "1\n1",
"output": "1 0"
}
] | 1,692,553,180
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 31
| 0
|
#!/bin/env python3
n = int(input())
s = [int(x) for x in input().split()]
s.sort(reverse=True)
sereja = dima = 0
for x in range(0,n):
if x % 2 == 0:
sereja += s[x]
else:
dima += s[x]
print(sereja, dima)
|
Title: Sereja and Dima
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
Output Specification:
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
Demo Input:
['4\n4 1 2 10\n', '7\n1 2 3 4 5 6 7\n']
Demo Output:
['12 5\n', '16 12\n']
Note:
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
|
```python
#!/bin/env python3
n = int(input())
s = [int(x) for x in input().split()]
s.sort(reverse=True)
sereja = dima = 0
for x in range(0,n):
if x % 2 == 0:
sereja += s[x]
else:
dima += s[x]
print(sereja, dima)
```
| 0
|
|
332
|
B
|
Maximum Absurdity
|
PROGRAMMING
| 1,500
|
[
"data structures",
"dp",
"implementation"
] | null | null |
Reforms continue entering Berland. For example, during yesterday sitting the Berland Parliament approved as much as *n* laws (each law has been assigned a unique number from 1 to *n*). Today all these laws were put on the table of the President of Berland, G.W. Boosch, to be signed.
This time mr. Boosch plans to sign 2*k* laws. He decided to choose exactly two non-intersecting segments of integers from 1 to *n* of length *k* and sign all laws, whose numbers fall into these segments. More formally, mr. Boosch is going to choose two integers *a*, *b* (1<=≤<=*a*<=≤<=*b*<=≤<=*n*<=-<=*k*<=+<=1,<=*b*<=-<=*a*<=≥<=*k*) and sign all laws with numbers lying in the segments [*a*; *a*<=+<=*k*<=-<=1] and [*b*; *b*<=+<=*k*<=-<=1] (borders are included).
As mr. Boosch chooses the laws to sign, he of course considers the public opinion. Allberland Public Opinion Study Centre (APOSC) conducted opinion polls among the citizens, processed the results into a report and gave it to the president. The report contains the absurdity value for each law, in the public opinion. As mr. Boosch is a real patriot, he is keen on signing the laws with the maximum total absurdity. Help him.
|
The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=2·105, 0<=<<=2*k*<=≤<=*n*) — the number of laws accepted by the parliament and the length of one segment in the law list, correspondingly. The next line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n* — the absurdity of each law (1<=≤<=*x**i*<=≤<=109).
|
Print two integers *a*, *b* — the beginning of segments that mr. Boosch should choose. That means that the president signs laws with numbers from segments [*a*; *a*<=+<=*k*<=-<=1] and [*b*; *b*<=+<=*k*<=-<=1]. If there are multiple solutions, print the one with the minimum number *a*. If there still are multiple solutions, print the one with the minimum *b*.
|
[
"5 2\n3 6 1 1 6\n",
"6 2\n1 1 1 1 1 1\n"
] |
[
"1 4\n",
"1 3\n"
] |
In the first sample mr. Boosch signs laws with numbers from segments [1;2] and [4;5]. The total absurdity of the signed laws equals 3 + 6 + 1 + 6 = 16.
In the second sample mr. Boosch signs laws with numbers from segments [1;2] and [3;4]. The total absurdity of the signed laws equals 1 + 1 + 1 + 1 = 4.
| 1,000
|
[
{
"input": "5 2\n3 6 1 1 6",
"output": "1 4"
},
{
"input": "6 2\n1 1 1 1 1 1",
"output": "1 3"
},
{
"input": "6 2\n1 4 1 2 5 6",
"output": "1 5"
},
{
"input": "4 1\n1 2 2 2",
"output": "2 3"
},
{
"input": "6 3\n15 20 1 15 43 6",
"output": "1 4"
},
{
"input": "12 3\n1 2 1 15 2 3 6 8 3 3 8 6",
"output": "4 7"
},
{
"input": "14 2\n2 1 2 3 1 2 2 3 1 2 2 3 2 3",
"output": "3 7"
},
{
"input": "2 1\n1 1",
"output": "1 2"
},
{
"input": "2 1\n1000000000 999999999",
"output": "1 2"
},
{
"input": "3 1\n100 30 563",
"output": "1 3"
},
{
"input": "3 1\n547468 78578678 6467834",
"output": "2 3"
},
{
"input": "4 1\n90000 34567 90000 90001",
"output": "1 4"
},
{
"input": "4 2\n999999 8888888 7777777 666666",
"output": "1 3"
},
{
"input": "5 1\n2 1 2 1 2",
"output": "1 3"
},
{
"input": "5 2\n98 96 98 96 96",
"output": "1 3"
},
{
"input": "6 2\n4 4 7 1 1 7",
"output": "2 5"
},
{
"input": "98 24\n91 20 12 75 44 22 22 67 28 100 8 41 31 47 95 87 5 54 7 49 32 46 42 37 45 22 29 15 54 98 46 94 69 47 60 1 15 76 17 82 46 22 32 34 91 37 30 26 92 77 69 11 59 78 24 66 88 15 32 49 46 14 57 20 5 69 53 99 81 70 67 22 54 31 49 52 46 51 46 2 53 59 8 66 28 53 54 5 85 75 15 55 87 16 68 6 36 98",
"output": "30 67"
},
{
"input": "6 3\n1 2 2 2 1 1",
"output": "1 4"
},
{
"input": "10 4\n9 3 3 9 1 9 9 4 4 9",
"output": "1 6"
},
{
"input": "7 3\n1 2 5 5 5 5 5",
"output": "2 5"
}
] | 1,614,877,206
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 7
| 2,000
| 8,192,000
|
n,k=map(int,input().split())
a=list(map(int,input().split()))
c=sum(a[:k])
dp=[c]
for i in range(k,n):
c+=a[i]-a[i-k]
dp.append(c)
l=len(dp)
g=0
d=0
e=0
for i in range(l):
j=i+k
while j<l:
if g<dp[i]+dp[j]:
g=dp[i]+dp[j]
d=i+1
e=j+1
j+=1
print(d,e,sep=" ")
|
Title: Maximum Absurdity
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Reforms continue entering Berland. For example, during yesterday sitting the Berland Parliament approved as much as *n* laws (each law has been assigned a unique number from 1 to *n*). Today all these laws were put on the table of the President of Berland, G.W. Boosch, to be signed.
This time mr. Boosch plans to sign 2*k* laws. He decided to choose exactly two non-intersecting segments of integers from 1 to *n* of length *k* and sign all laws, whose numbers fall into these segments. More formally, mr. Boosch is going to choose two integers *a*, *b* (1<=≤<=*a*<=≤<=*b*<=≤<=*n*<=-<=*k*<=+<=1,<=*b*<=-<=*a*<=≥<=*k*) and sign all laws with numbers lying in the segments [*a*; *a*<=+<=*k*<=-<=1] and [*b*; *b*<=+<=*k*<=-<=1] (borders are included).
As mr. Boosch chooses the laws to sign, he of course considers the public opinion. Allberland Public Opinion Study Centre (APOSC) conducted opinion polls among the citizens, processed the results into a report and gave it to the president. The report contains the absurdity value for each law, in the public opinion. As mr. Boosch is a real patriot, he is keen on signing the laws with the maximum total absurdity. Help him.
Input Specification:
The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=2·105, 0<=<<=2*k*<=≤<=*n*) — the number of laws accepted by the parliament and the length of one segment in the law list, correspondingly. The next line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n* — the absurdity of each law (1<=≤<=*x**i*<=≤<=109).
Output Specification:
Print two integers *a*, *b* — the beginning of segments that mr. Boosch should choose. That means that the president signs laws with numbers from segments [*a*; *a*<=+<=*k*<=-<=1] and [*b*; *b*<=+<=*k*<=-<=1]. If there are multiple solutions, print the one with the minimum number *a*. If there still are multiple solutions, print the one with the minimum *b*.
Demo Input:
['5 2\n3 6 1 1 6\n', '6 2\n1 1 1 1 1 1\n']
Demo Output:
['1 4\n', '1 3\n']
Note:
In the first sample mr. Boosch signs laws with numbers from segments [1;2] and [4;5]. The total absurdity of the signed laws equals 3 + 6 + 1 + 6 = 16.
In the second sample mr. Boosch signs laws with numbers from segments [1;2] and [3;4]. The total absurdity of the signed laws equals 1 + 1 + 1 + 1 = 4.
|
```python
n,k=map(int,input().split())
a=list(map(int,input().split()))
c=sum(a[:k])
dp=[c]
for i in range(k,n):
c+=a[i]-a[i-k]
dp.append(c)
l=len(dp)
g=0
d=0
e=0
for i in range(l):
j=i+k
while j<l:
if g<dp[i]+dp[j]:
g=dp[i]+dp[j]
d=i+1
e=j+1
j+=1
print(d,e,sep=" ")
```
| 0
|
|
631
|
A
|
Interview
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation"
] | null | null |
Blake is a CEO of a large company called "Blake Technologies". He loves his company very much and he thinks that his company should be the best. That is why every candidate needs to pass through the interview that consists of the following problem.
We define function *f*(*x*,<=*l*,<=*r*) as a bitwise OR of integers *x**l*,<=*x**l*<=+<=1,<=...,<=*x**r*, where *x**i* is the *i*-th element of the array *x*. You are given two arrays *a* and *b* of length *n*. You need to determine the maximum value of sum *f*(*a*,<=*l*,<=*r*)<=+<=*f*(*b*,<=*l*,<=*r*) among all possible 1<=≤<=*l*<=≤<=*r*<=≤<=*n*.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the length of the arrays.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=109).
The third line contains *n* integers *b**i* (0<=≤<=*b**i*<=≤<=109).
|
Print a single integer — the maximum value of sum *f*(*a*,<=*l*,<=*r*)<=+<=*f*(*b*,<=*l*,<=*r*) among all possible 1<=≤<=*l*<=≤<=*r*<=≤<=*n*.
|
[
"5\n1 2 4 3 2\n2 3 3 12 1\n",
"10\n13 2 7 11 8 4 9 8 5 1\n5 7 18 9 2 3 0 11 8 6\n"
] |
[
"22",
"46"
] |
Bitwise OR of two non-negative integers *a* and *b* is the number *c* = *a* *OR* *b*, such that each of its digits in binary notation is 1 if and only if at least one of *a* or *b* have 1 in the corresponding position in binary notation.
In the first sample, one of the optimal answers is *l* = 2 and *r* = 4, because *f*(*a*, 2, 4) + *f*(*b*, 2, 4) = (2 *OR* 4 *OR* 3) + (3 *OR* 3 *OR* 12) = 7 + 15 = 22. Other ways to get maximum value is to choose *l* = 1 and *r* = 4, *l* = 1 and *r* = 5, *l* = 2 and *r* = 4, *l* = 2 and *r* = 5, *l* = 3 and *r* = 4, or *l* = 3 and *r* = 5.
In the second sample, the maximum value is obtained for *l* = 1 and *r* = 9.
| 500
|
[
{
"input": "5\n1 2 4 3 2\n2 3 3 12 1",
"output": "22"
},
{
"input": "10\n13 2 7 11 8 4 9 8 5 1\n5 7 18 9 2 3 0 11 8 6",
"output": "46"
},
{
"input": "25\n12 30 38 109 81 124 80 33 38 48 29 78 96 48 96 27 80 77 102 65 80 113 31 118 35\n25 64 95 13 12 6 111 80 85 16 61 119 23 65 73 65 20 95 124 18 28 79 125 106 116",
"output": "254"
},
{
"input": "20\n64 64 64 64 64 64 64 64 64 64 64 64 64 64 64 64 64 64 64 64\n64 64 64 64 64 64 64 64 64 64 64 64 64 64 64 64 64 64 64 64",
"output": "128"
},
{
"input": "1\n1000000000\n1000000000",
"output": "2000000000"
},
{
"input": "1\n0\n0",
"output": "0"
},
{
"input": "2\n7 16\n16 7",
"output": "46"
},
{
"input": "4\n6 0 0 0\n0 0 0 1",
"output": "7"
},
{
"input": "8\n1 2 4 8 16 32 64 128\n1 2 4 8 16 32 64 128",
"output": "510"
},
{
"input": "1\n2\n3",
"output": "5"
},
{
"input": "1\n4\n3",
"output": "7"
},
{
"input": "1\n1\n1",
"output": "2"
}
] | 1,457,027,436
| 4,536
|
Python 3
|
OK
|
TESTS
| 27
| 77
| 307,200
|
n=int(input())
ip1=list(map(int,input().split()))
ip2=list(map(int,input().split()))
ans=0
ans2=0
for i in range(n):
ans=ans|ip1[i]
for j in range(n):
ans2=ans2|ip2[j]
print(ans+ans2)
|
Title: Interview
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Blake is a CEO of a large company called "Blake Technologies". He loves his company very much and he thinks that his company should be the best. That is why every candidate needs to pass through the interview that consists of the following problem.
We define function *f*(*x*,<=*l*,<=*r*) as a bitwise OR of integers *x**l*,<=*x**l*<=+<=1,<=...,<=*x**r*, where *x**i* is the *i*-th element of the array *x*. You are given two arrays *a* and *b* of length *n*. You need to determine the maximum value of sum *f*(*a*,<=*l*,<=*r*)<=+<=*f*(*b*,<=*l*,<=*r*) among all possible 1<=≤<=*l*<=≤<=*r*<=≤<=*n*.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the length of the arrays.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=109).
The third line contains *n* integers *b**i* (0<=≤<=*b**i*<=≤<=109).
Output Specification:
Print a single integer — the maximum value of sum *f*(*a*,<=*l*,<=*r*)<=+<=*f*(*b*,<=*l*,<=*r*) among all possible 1<=≤<=*l*<=≤<=*r*<=≤<=*n*.
Demo Input:
['5\n1 2 4 3 2\n2 3 3 12 1\n', '10\n13 2 7 11 8 4 9 8 5 1\n5 7 18 9 2 3 0 11 8 6\n']
Demo Output:
['22', '46']
Note:
Bitwise OR of two non-negative integers *a* and *b* is the number *c* = *a* *OR* *b*, such that each of its digits in binary notation is 1 if and only if at least one of *a* or *b* have 1 in the corresponding position in binary notation.
In the first sample, one of the optimal answers is *l* = 2 and *r* = 4, because *f*(*a*, 2, 4) + *f*(*b*, 2, 4) = (2 *OR* 4 *OR* 3) + (3 *OR* 3 *OR* 12) = 7 + 15 = 22. Other ways to get maximum value is to choose *l* = 1 and *r* = 4, *l* = 1 and *r* = 5, *l* = 2 and *r* = 4, *l* = 2 and *r* = 5, *l* = 3 and *r* = 4, or *l* = 3 and *r* = 5.
In the second sample, the maximum value is obtained for *l* = 1 and *r* = 9.
|
```python
n=int(input())
ip1=list(map(int,input().split()))
ip2=list(map(int,input().split()))
ans=0
ans2=0
for i in range(n):
ans=ans|ip1[i]
for j in range(n):
ans2=ans2|ip2[j]
print(ans+ans2)
```
| 3
|
|
644
|
C
|
Hostname Aliases
|
PROGRAMMING
| 2,100
|
[
"*special",
"binary search",
"data structures",
"implementation",
"sortings",
"strings"
] | null | null |
There are some websites that are accessible through several different addresses. For example, for a long time Codeforces was accessible with two hostnames codeforces.com and codeforces.ru.
You are given a list of page addresses being queried. For simplicity we consider all addresses to have the form http://<hostname>[/<path>], where:
- <hostname> — server name (consists of words and maybe some dots separating them), - /<path> — optional part, where <path> consists of words separated by slashes.
We consider two <hostname> to correspond to one website if for each query to the first <hostname> there will be exactly the same query to the second one and vice versa — for each query to the second <hostname> there will be the same query to the first one. Take a look at the samples for further clarifications.
Your goal is to determine the groups of server names that correspond to one website. Ignore groups consisting of the only server name.
Please note, that according to the above definition queries http://<hostname> and http://<hostname>/ are different.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of page queries. Then follow *n* lines each containing exactly one address. Each address is of the form http://<hostname>[/<path>], where:
- <hostname> consists of lowercase English letters and dots, there are no two consecutive dots, <hostname> doesn't start or finish with a dot. The length of <hostname> is positive and doesn't exceed 20. - <path> consists of lowercase English letters, dots and slashes. There are no two consecutive slashes, <path> doesn't start with a slash and its length doesn't exceed 20.
Addresses are not guaranteed to be distinct.
|
First print *k* — the number of groups of server names that correspond to one website. You should count only groups of size greater than one.
Next *k* lines should contain the description of groups, one group per line. For each group print all server names separated by a single space. You are allowed to print both groups and names inside any group in arbitrary order.
|
[
"10\nhttp://abacaba.ru/test\nhttp://abacaba.ru/\nhttp://abacaba.com\nhttp://abacaba.com/test\nhttp://abacaba.de/\nhttp://abacaba.ru/test\nhttp://abacaba.de/test\nhttp://abacaba.com/\nhttp://abacaba.com/t\nhttp://abacaba.com/test\n",
"14\nhttp://c\nhttp://ccc.bbbb/aba..b\nhttp://cba.com\nhttp://a.c/aba..b/a\nhttp://abc/\nhttp://a.c/\nhttp://ccc.bbbb\nhttp://ab.ac.bc.aa/\nhttp://a.a.a/\nhttp://ccc.bbbb/\nhttp://cba.com/\nhttp://cba.com/aba..b\nhttp://a.a.a/aba..b/a\nhttp://abc/aba..b/a\n"
] |
[
"1\nhttp://abacaba.de http://abacaba.ru \n",
"2\nhttp://cba.com http://ccc.bbbb \nhttp://a.a.a http://a.c http://abc \n"
] |
none
| 1,500
|
[
{
"input": "10\nhttp://abacaba.ru/test\nhttp://abacaba.ru/\nhttp://abacaba.com\nhttp://abacaba.com/test\nhttp://abacaba.de/\nhttp://abacaba.ru/test\nhttp://abacaba.de/test\nhttp://abacaba.com/\nhttp://abacaba.com/t\nhttp://abacaba.com/test",
"output": "1\nhttp://abacaba.de http://abacaba.ru "
},
{
"input": "14\nhttp://c\nhttp://ccc.bbbb/aba..b\nhttp://cba.com\nhttp://a.c/aba..b/a\nhttp://abc/\nhttp://a.c/\nhttp://ccc.bbbb\nhttp://ab.ac.bc.aa/\nhttp://a.a.a/\nhttp://ccc.bbbb/\nhttp://cba.com/\nhttp://cba.com/aba..b\nhttp://a.a.a/aba..b/a\nhttp://abc/aba..b/a",
"output": "2\nhttp://cba.com http://ccc.bbbb \nhttp://a.a.a http://a.c http://abc "
},
{
"input": "10\nhttp://tqr.ekdb.nh/w\nhttp://p.ulz/ifw\nhttp://w.gw.dw.xn/kpe\nhttp://byt.mqii.zkv/j/xt\nhttp://ovquj.rbgrlw/k..\nhttp://bv.plu.e.dslg/j/xt\nhttp://udgci.ufgi.gwbd.s/\nhttp://l.oh.ne.o.r/.vo\nhttp://l.oh.ne.o.r/w\nhttp://tqr.ekdb.nh/.vo",
"output": "2\nhttp://l.oh.ne.o.r http://tqr.ekdb.nh \nhttp://bv.plu.e.dslg http://byt.mqii.zkv "
},
{
"input": "12\nhttp://ickght.ck/mr\nhttp://a.exhel/.b\nhttp://a.exhel/\nhttp://ti.cdm/\nhttp://ti.cdm/x/wd/lm.h.\nhttp://ickght.ck/a\nhttp://ickght.ck\nhttp://c.gcnk.d/.b\nhttp://c.gcnk.d/x/wd/lm.h.\nhttp://ti.cdm/.b\nhttp://a.exhel/x/wd/lm.h.\nhttp://c.gcnk.d/",
"output": "1\nhttp://a.exhel http://c.gcnk.d http://ti.cdm "
},
{
"input": "14\nhttp://jr/kgb\nhttp://ps.p.t.jeua.x.a.q.t\nhttp://gsqqs.n/t/\nhttp://w.afwsnuc.ff.km/cohox/u.\nhttp://u.s.wbumkuqm/\nhttp://u.s.wbumkuqm/cohox/u.\nhttp://nq.dzjkjcwv.f.s/bvm/\nhttp://zoy.shgg\nhttp://gsqqs.n\nhttp://u.s.wbumkuqm/b.pd.\nhttp://w.afwsnuc.ff.km/\nhttp://w.afwsnuc.ff.km/b.pd.\nhttp://nq.dzjkjcwv.f.s/n\nhttp://nq.dzjkjcwv.f.s/ldbw",
"output": "2\nhttp://ps.p.t.jeua.x.a.q.t http://zoy.shgg \nhttp://u.s.wbumkuqm http://w.afwsnuc.ff.km "
},
{
"input": "15\nhttp://l.edzplwqsij.rw/\nhttp://m.e.mehd.acsoinzm/s\nhttp://yg.ttahn.xin.obgez/ap/\nhttp://qqbb.pqkaqcncodxmaae\nhttp://lzi.a.flkp.lnn.k/o/qfr.cp\nhttp://lzi.a.flkp.lnn.k/f\nhttp://p.ngu.gkoq/.szinwwi\nhttp://qqbb.pqkaqcncodxmaae/od\nhttp://qqbb.pqkaqcncodxmaae\nhttp://wsxvmi.qpe.fihtgdvi/e./\nhttp://p.ngu.gkoq/zfoh\nhttp://m.e.mehd.acsoinzm/xp\nhttp://c.gy.p.h.tkrxt.jnsjt/j\nhttp://wsxvmi.qpe.fihtgdvi/grkag.z\nhttp://p.ngu.gkoq/t",
"output": "0"
},
{
"input": "15\nhttp://w.hhjvdn.mmu/.ca.p\nhttp://m.p.p.lar/\nhttp://lgmjun.r.kogpr.ijn/./t\nhttp://bapchpl.mcw.a.lob/d/ym/./g.q\nhttp://uxnjfnjp.kxr.ss.e.uu/jwo./hjl/\nhttp://fd.ezw.ykbb.xhl.t/\nhttp://i.xcb.kr/.ca.p\nhttp://jofec.ry.fht.gt\nhttp://qeo.gghwe.lcr/d/ym/./g.q\nhttp://gt\nhttp://gjvifpf.d/d/ym/./g.q\nhttp://oba\nhttp://rjs.qwd/v/hi\nhttp://fgkj/\nhttp://ivun.naumc.l/.ca.p",
"output": "4\nhttp://gt http://jofec.ry.fht.gt http://oba \nhttp://fd.ezw.ykbb.xhl.t http://fgkj http://m.p.p.lar \nhttp://i.xcb.kr http://ivun.naumc.l http://w.hhjvdn.mmu \nhttp://bapchpl.mcw.a.lob http://gjvifpf.d http://qeo.gghwe.lcr "
},
{
"input": "20\nhttp://gjwr/xsoiagp/\nhttp://gdnmu/j\nhttp://yfygudx.e.aqa.ezh/j\nhttp://mpjxue.cuvipq/\nhttp://a/\nhttp://kr/..n/c.\nhttp://a/xsoiagp/\nhttp://kr/z\nhttp://kr/v.cv/rk/k\nhttp://lvhpz\nhttp://qv.v.jqzhq\nhttp://y.no/\nhttp://kr/n\nhttp://y.no/xsoiagp/\nhttp://kr/ebe/z/\nhttp://olsvbxxw.win.n/j\nhttp://p.ct/j\nhttp://mpjxue.cuvipq/xsoiagp/\nhttp://kr/j\nhttp://gjwr/",
"output": "3\nhttp://lvhpz http://qv.v.jqzhq \nhttp://a http://gjwr http://mpjxue.cuvipq http://y.no \nhttp://gdnmu http://olsvbxxw.win.n http://p.ct http://yfygudx.e.aqa.ezh "
},
{
"input": "1\nhttp://a",
"output": "0"
},
{
"input": "3\nhttp://abacaba.com/test\nhttp://abacaba.de/test\nhttp://abacaba.de/test",
"output": "1\nhttp://abacaba.com http://abacaba.de "
}
] | 1,458,228,514
| 109,714
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
PRETESTS
| 5
| 5,000
| 9,625,600
|
n=int(input())
d={}
D={}
for i in range(n):
h,*p=(input()[7:]+'/').split('/')
d[h]=d.get(h,set())|{'/'.join(p)}
for x in d:
t=tuple(sorted(d[x]))
D[t]=D.get(t,[])+[x]
def ans():
for x in D:
if len(D[x])>1:
yield 'http://'+' http://'.join(D[x])
print(sum(1 for x in D if len(D[x])>1))
print('\n'.join(ans()))
|
Title: Hostname Aliases
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are some websites that are accessible through several different addresses. For example, for a long time Codeforces was accessible with two hostnames codeforces.com and codeforces.ru.
You are given a list of page addresses being queried. For simplicity we consider all addresses to have the form http://<hostname>[/<path>], where:
- <hostname> — server name (consists of words and maybe some dots separating them), - /<path> — optional part, where <path> consists of words separated by slashes.
We consider two <hostname> to correspond to one website if for each query to the first <hostname> there will be exactly the same query to the second one and vice versa — for each query to the second <hostname> there will be the same query to the first one. Take a look at the samples for further clarifications.
Your goal is to determine the groups of server names that correspond to one website. Ignore groups consisting of the only server name.
Please note, that according to the above definition queries http://<hostname> and http://<hostname>/ are different.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of page queries. Then follow *n* lines each containing exactly one address. Each address is of the form http://<hostname>[/<path>], where:
- <hostname> consists of lowercase English letters and dots, there are no two consecutive dots, <hostname> doesn't start or finish with a dot. The length of <hostname> is positive and doesn't exceed 20. - <path> consists of lowercase English letters, dots and slashes. There are no two consecutive slashes, <path> doesn't start with a slash and its length doesn't exceed 20.
Addresses are not guaranteed to be distinct.
Output Specification:
First print *k* — the number of groups of server names that correspond to one website. You should count only groups of size greater than one.
Next *k* lines should contain the description of groups, one group per line. For each group print all server names separated by a single space. You are allowed to print both groups and names inside any group in arbitrary order.
Demo Input:
['10\nhttp://abacaba.ru/test\nhttp://abacaba.ru/\nhttp://abacaba.com\nhttp://abacaba.com/test\nhttp://abacaba.de/\nhttp://abacaba.ru/test\nhttp://abacaba.de/test\nhttp://abacaba.com/\nhttp://abacaba.com/t\nhttp://abacaba.com/test\n', '14\nhttp://c\nhttp://ccc.bbbb/aba..b\nhttp://cba.com\nhttp://a.c/aba..b/a\nhttp://abc/\nhttp://a.c/\nhttp://ccc.bbbb\nhttp://ab.ac.bc.aa/\nhttp://a.a.a/\nhttp://ccc.bbbb/\nhttp://cba.com/\nhttp://cba.com/aba..b\nhttp://a.a.a/aba..b/a\nhttp://abc/aba..b/a\n']
Demo Output:
['1\nhttp://abacaba.de http://abacaba.ru \n', '2\nhttp://cba.com http://ccc.bbbb \nhttp://a.a.a http://a.c http://abc \n']
Note:
none
|
```python
n=int(input())
d={}
D={}
for i in range(n):
h,*p=(input()[7:]+'/').split('/')
d[h]=d.get(h,set())|{'/'.join(p)}
for x in d:
t=tuple(sorted(d[x]))
D[t]=D.get(t,[])+[x]
def ans():
for x in D:
if len(D[x])>1:
yield 'http://'+' http://'.join(D[x])
print(sum(1 for x in D if len(D[x])>1))
print('\n'.join(ans()))
```
| 0
|
|
234
|
B
|
Reading
|
PROGRAMMING
| 1,000
|
[
"sortings"
] | null | null |
Vasya is going to the Olympics in the city Ntown by train. The boy wants to read the textbook to prepare for the Olympics. He counted that he needed *k* hours for this. He also found that the light in the train changes every hour. The light is measured on a scale from 0 to 100, where 0 is very dark, and 100 is very light.
Vasya has a train lighting schedule for all *n* hours of the trip — *n* numbers from 0 to 100 each (the light level in the first hour, the second hour and so on). During each of those hours he will either read the whole time, or not read at all. He wants to choose *k* hours to read a book, not necessarily consecutive, so that the minimum level of light among the selected hours were maximum. Vasya is very excited before the upcoming contest, help him choose reading hours.
|
The first input line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=1000,<=1<=≤<=*k*<=≤<=*n*) — the number of hours on the train and the number of hours to read, correspondingly. The second line contains *n* space-separated integers *a**i* (0<=≤<=*a**i*<=≤<=100), *a**i* is the light level at the *i*-th hour.
|
In the first output line print the minimum light level Vasya will read at. In the second line print *k* distinct space-separated integers *b*1,<=*b*2,<=...,<=*b**k*, — the indexes of hours Vasya will read at (1<=≤<=*b**i*<=≤<=*n*). The hours are indexed starting from 1. If there are multiple optimal solutions, print any of them. Print the numbers *b**i* in an arbitrary order.
|
[
"5 3\n20 10 30 40 10\n",
"6 5\n90 20 35 40 60 100\n"
] |
[
"20\n1 3 4 \n",
"35\n1 3 4 5 6 \n"
] |
In the first sample Vasya should read at the first hour (light 20), third hour (light 30) and at the fourth hour (light 40). The minimum light Vasya will have to read at is 20.
| 0
|
[
{
"input": "5 3\n20 10 30 40 10",
"output": "20\n1 3 4 "
},
{
"input": "6 5\n90 20 35 40 60 100",
"output": "35\n1 3 4 5 6 "
},
{
"input": "100 7\n85 66 9 91 50 46 61 12 55 65 95 1 25 97 95 4 59 59 52 34 94 30 60 11 68 36 17 84 87 68 72 87 46 99 24 66 75 77 75 2 19 3 33 19 7 20 22 3 71 29 88 63 89 47 7 52 47 55 87 77 9 81 44 13 30 43 66 74 9 42 9 72 97 61 9 94 92 29 18 7 92 68 76 43 35 71 54 49 77 50 77 68 57 24 84 73 32 85 24 37",
"output": "94\n11 14 15 21 34 73 76 "
},
{
"input": "1 1\n10",
"output": "10\n1 "
},
{
"input": "1 1\n86",
"output": "86\n1 "
},
{
"input": "100 79\n83 83 83 83 83 94 94 83 83 83 83 90 83 99 83 91 83 83 83 83 83 83 83 83 83 83 83 91 83 83 83 83 83 96 83 83 83 91 83 83 92 83 83 83 83 83 83 83 83 83 83 83 83 83 83 83 83 83 83 98 83 83 91 97 83 83 83 83 83 83 83 92 83 83 83 83 83 83 83 93 83 83 91 83 83 83 83 83 83 83 83 83 83 83 96 83 83 83 83 83",
"output": "83\n6 7 12 14 16 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "20 3\n17 76 98 17 55 17 17 99 65 17 17 17 17 52 17 17 69 88 17 17",
"output": "88\n3 8 18 "
},
{
"input": "15 1\n0 78 24 24 61 60 0 65 52 57 97 51 56 13 10",
"output": "97\n11 "
},
{
"input": "50 50\n59 40 52 0 65 49 3 58 57 22 86 37 55 72 11 3 30 30 20 64 44 45 12 48 96 96 39 14 8 53 40 37 8 58 97 16 96 48 30 89 66 19 31 50 23 80 67 16 11 7",
"output": "0\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 "
},
{
"input": "60 8\n59 12 34 86 57 65 42 24 62 18 94 92 43 29 95 33 73 3 69 18 36 18 34 97 85 65 74 25 26 70 46 31 57 73 78 89 95 77 94 71 38 23 30 97 69 97 76 43 76 31 38 50 13 16 55 85 47 5 71 4",
"output": "92\n11 12 15 24 37 39 44 46 "
},
{
"input": "70 5\n76 16 20 60 5 96 32 50 35 9 79 42 38 35 72 45 98 33 55 0 86 92 49 87 22 79 35 27 69 35 89 29 31 43 88 1 48 95 3 92 82 97 53 80 79 0 78 58 37 38 45 9 5 38 53 49 71 7 91 3 75 17 76 44 77 31 78 91 59 91",
"output": "92\n6 17 38 40 42 "
},
{
"input": "12 3\n18 64 98 27 36 27 65 43 39 41 69 47",
"output": "65\n3 7 11 "
},
{
"input": "15 13\n6 78 78 78 78 20 78 78 8 3 78 18 32 56 78",
"output": "8\n2 3 4 5 6 7 8 9 11 12 13 14 15 "
},
{
"input": "17 4\n75 52 24 74 70 24 24 53 24 48 24 0 67 47 24 24 6",
"output": "67\n1 4 5 13 "
},
{
"input": "14 2\n31 18 78 90 96 2 90 27 86 9 94 98 94 34",
"output": "96\n5 12 "
},
{
"input": "100 56\n56 64 54 22 46 0 51 27 8 10 5 26 68 37 51 53 4 64 82 23 38 89 97 20 23 31 7 95 55 27 33 23 95 6 64 69 27 54 36 4 96 61 68 26 46 10 61 53 32 19 28 62 7 32 86 84 12 88 92 51 53 23 80 7 36 46 48 29 12 98 72 99 16 0 94 22 83 23 12 37 29 13 93 16 53 21 8 37 67 33 33 67 35 72 3 97 46 30 9 57",
"output": "33\n1 2 3 5 7 13 14 15 16 18 19 21 22 23 28 29 33 35 36 38 39 41 42 43 45 47 48 52 55 56 58 59 60 61 63 65 66 67 70 71 72 75 77 80 83 85 88 89 90 91 92 93 94 96 97 100 "
},
{
"input": "90 41\n43 24 4 69 54 87 33 34 9 77 87 66 66 0 71 43 42 10 78 48 26 40 8 61 80 38 76 63 7 47 99 69 77 43 29 74 86 93 39 28 99 98 11 27 43 58 50 61 1 79 45 17 23 13 10 98 41 28 19 98 87 51 26 28 88 60 42 25 19 3 29 18 0 56 84 27 43 92 93 97 25 90 13 90 75 52 99 6 66 87",
"output": "52\n4 5 6 10 11 12 13 15 19 24 25 27 28 31 32 33 36 37 38 41 42 46 48 50 56 60 61 65 66 74 75 78 79 80 82 84 85 86 87 89 90 "
},
{
"input": "100 71\n29 56 85 57 40 89 93 81 92 38 81 41 18 9 89 21 81 6 95 94 38 11 90 38 6 81 61 43 81 12 36 35 33 10 81 49 59 37 81 61 95 34 43 20 94 88 57 81 42 81 50 24 85 81 1 90 33 8 59 87 17 52 91 54 81 98 28 11 24 51 95 31 98 29 5 81 91 52 41 81 7 9 81 81 13 81 3 81 10 0 37 47 62 50 81 81 81 94 93 38",
"output": "35\n2 3 4 5 6 7 8 9 10 11 12 15 17 19 20 21 23 24 26 27 28 29 31 32 35 36 37 38 39 40 41 43 45 46 47 48 49 50 51 53 54 56 59 60 62 63 64 65 66 70 71 73 76 77 78 79 80 83 84 86 88 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "100 55\n72 70 77 90 86 96 60 60 60 60 87 62 60 87 0 60 82 60 86 74 60 60 60 60 60 60 78 60 60 60 96 60 60 0 60 60 89 99 60 60 60 60 60 60 89 60 88 84 60 93 0 60 60 60 75 60 67 64 65 60 65 60 72 60 76 4 60 60 60 63 96 62 78 71 63 81 89 98 60 60 69 60 61 60 60 60 85 71 82 79 67 60 60 60 79 96 2 60 60 60",
"output": "60\n1 2 3 4 5 6 11 12 14 17 19 20 27 31 37 38 45 47 48 50 55 57 58 59 61 63 65 70 71 72 73 74 75 76 77 78 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 98 99 100 "
},
{
"input": "100 27\n25 87 25 25 77 78 25 73 91 25 25 70 84 25 61 75 82 25 25 25 25 65 25 25 82 63 93 25 93 75 25 25 25 89 98 25 25 72 70 25 72 25 25 25 70 25 25 98 90 25 25 25 25 25 91 25 78 71 63 69 25 25 25 63 25 25 75 94 25 25 25 25 25 97 25 78 66 87 25 89 25 25 73 85 25 91 72 25 25 80 25 70 25 96 25 25 25 25 25 25",
"output": "75\n2 5 6 9 13 16 17 25 27 29 30 34 35 48 49 55 57 67 68 74 76 78 80 84 86 90 94 "
},
{
"input": "100 99\n1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2",
"output": "1\n2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "100 50\n1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2",
"output": "2\n2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 50 52 54 56 58 60 62 64 66 68 70 72 74 76 78 80 82 84 86 88 90 92 94 96 98 100 "
},
{
"input": "100 51\n1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2",
"output": "1\n2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 50 52 54 56 58 60 62 64 66 68 70 72 74 76 78 80 82 84 86 88 90 92 94 96 98 99 100 "
},
{
"input": "100 75\n1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2",
"output": "1\n2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "100 45\n1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2",
"output": "2\n12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 50 52 54 56 58 60 62 64 66 68 70 72 74 76 78 80 82 84 86 88 90 92 94 96 98 100 "
},
{
"input": "2 2\n2 2",
"output": "2\n1 2 "
},
{
"input": "2 1\n2 1",
"output": "2\n1 "
},
{
"input": "2 1\n1 2",
"output": "2\n2 "
},
{
"input": "3 1\n1 2 0",
"output": "2\n2 "
},
{
"input": "3 2\n0 0 0",
"output": "0\n2 3 "
},
{
"input": "3 3\n0 1 0",
"output": "0\n1 2 3 "
},
{
"input": "3 2\n99 100 99",
"output": "99\n2 3 "
},
{
"input": "1 1\n0",
"output": "0\n1 "
},
{
"input": "4 1\n100 100 0 100",
"output": "100\n4 "
},
{
"input": "4 2\n0 1 0 1",
"output": "1\n2 4 "
},
{
"input": "10 3\n0 1 2 3 0 1 2 3 0 1",
"output": "2\n4 7 8 "
},
{
"input": "10 9\n0 1 0 1 100 100 1 0 1 0",
"output": "0\n2 3 4 5 6 7 8 9 10 "
},
{
"input": "7 7\n1 0 0 0 0 0 0",
"output": "0\n1 2 3 4 5 6 7 "
},
{
"input": "7 6\n0 0 0 0 0 0 1",
"output": "0\n2 3 4 5 6 7 "
},
{
"input": "7 1\n12 33 12 88 10 0 3",
"output": "88\n4 "
},
{
"input": "7 1\n0 1 1 1 1 1 1",
"output": "1\n7 "
},
{
"input": "7 6\n1 1 1 1 1 1 0",
"output": "1\n1 2 3 4 5 6 "
},
{
"input": "7 2\n1 0 1 1 1 1 1",
"output": "1\n6 7 "
},
{
"input": "8 4\n1 1 1 1 0 0 0 0",
"output": "1\n1 2 3 4 "
},
{
"input": "7 5\n1 1 1 2 0 0 0",
"output": "0\n1 2 3 4 7 "
}
] | 1,658,602,295
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 62
| 0
|
with open ('input.txt', 'r') as f:
(number_of_hours_on_train, number_of_hours_to_read) = map(int, f.readline().split())
light_levels = list(map(int, f.readline().split()))
sorted_list = sorted(light_levels)
sorted_list.reverse()
sorted_list_index = []
reading_hours = []
for light_level in sorted_list[:number_of_hours_to_read]:
reading_hours.append(light_level)
for light_level in reading_hours:
sorted_list_index.append(light_levels.index(light_level) + 1)
sorted_list_index.sort()
with open('output.txt','w') as w:
w.write(min(reading_hours))
w.write(*sorted_list_index)
|
Title: Reading
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya is going to the Olympics in the city Ntown by train. The boy wants to read the textbook to prepare for the Olympics. He counted that he needed *k* hours for this. He also found that the light in the train changes every hour. The light is measured on a scale from 0 to 100, where 0 is very dark, and 100 is very light.
Vasya has a train lighting schedule for all *n* hours of the trip — *n* numbers from 0 to 100 each (the light level in the first hour, the second hour and so on). During each of those hours he will either read the whole time, or not read at all. He wants to choose *k* hours to read a book, not necessarily consecutive, so that the minimum level of light among the selected hours were maximum. Vasya is very excited before the upcoming contest, help him choose reading hours.
Input Specification:
The first input line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=1000,<=1<=≤<=*k*<=≤<=*n*) — the number of hours on the train and the number of hours to read, correspondingly. The second line contains *n* space-separated integers *a**i* (0<=≤<=*a**i*<=≤<=100), *a**i* is the light level at the *i*-th hour.
Output Specification:
In the first output line print the minimum light level Vasya will read at. In the second line print *k* distinct space-separated integers *b*1,<=*b*2,<=...,<=*b**k*, — the indexes of hours Vasya will read at (1<=≤<=*b**i*<=≤<=*n*). The hours are indexed starting from 1. If there are multiple optimal solutions, print any of them. Print the numbers *b**i* in an arbitrary order.
Demo Input:
['5 3\n20 10 30 40 10\n', '6 5\n90 20 35 40 60 100\n']
Demo Output:
['20\n1 3 4 \n', '35\n1 3 4 5 6 \n']
Note:
In the first sample Vasya should read at the first hour (light 20), third hour (light 30) and at the fourth hour (light 40). The minimum light Vasya will have to read at is 20.
|
```python
with open ('input.txt', 'r') as f:
(number_of_hours_on_train, number_of_hours_to_read) = map(int, f.readline().split())
light_levels = list(map(int, f.readline().split()))
sorted_list = sorted(light_levels)
sorted_list.reverse()
sorted_list_index = []
reading_hours = []
for light_level in sorted_list[:number_of_hours_to_read]:
reading_hours.append(light_level)
for light_level in reading_hours:
sorted_list_index.append(light_levels.index(light_level) + 1)
sorted_list_index.sort()
with open('output.txt','w') as w:
w.write(min(reading_hours))
w.write(*sorted_list_index)
```
| -1
|
|
118
|
A
|
String Task
|
PROGRAMMING
| 1,000
|
[
"implementation",
"strings"
] | null | null |
Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it:
- deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones.
Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string.
Help Petya cope with this easy task.
|
The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.
|
Print the resulting string. It is guaranteed that this string is not empty.
|
[
"tour\n",
"Codeforces\n",
"aBAcAba\n"
] |
[
".t.r\n",
".c.d.f.r.c.s\n",
".b.c.b\n"
] |
none
| 500
|
[
{
"input": "tour",
"output": ".t.r"
},
{
"input": "Codeforces",
"output": ".c.d.f.r.c.s"
},
{
"input": "aBAcAba",
"output": ".b.c.b"
},
{
"input": "obn",
"output": ".b.n"
},
{
"input": "wpwl",
"output": ".w.p.w.l"
},
{
"input": "ggdvq",
"output": ".g.g.d.v.q"
},
{
"input": "pumesz",
"output": ".p.m.s.z"
},
{
"input": "g",
"output": ".g"
},
{
"input": "zjuotps",
"output": ".z.j.t.p.s"
},
{
"input": "jzbwuehe",
"output": ".j.z.b.w.h"
},
{
"input": "tnkgwuugu",
"output": ".t.n.k.g.w.g"
},
{
"input": "kincenvizh",
"output": ".k.n.c.n.v.z.h"
},
{
"input": "xattxjenual",
"output": ".x.t.t.x.j.n.l"
},
{
"input": "ktajqhpqsvhw",
"output": ".k.t.j.q.h.p.q.s.v.h.w"
},
{
"input": "xnhcigytnqcmy",
"output": ".x.n.h.c.g.t.n.q.c.m"
},
{
"input": "jfmtbejyilxcec",
"output": ".j.f.m.t.b.j.l.x.c.c"
},
{
"input": "D",
"output": ".d"
},
{
"input": "ab",
"output": ".b"
},
{
"input": "Ab",
"output": ".b"
},
{
"input": "aB",
"output": ".b"
},
{
"input": "AB",
"output": ".b"
},
{
"input": "ba",
"output": ".b"
},
{
"input": "bA",
"output": ".b"
},
{
"input": "Ba",
"output": ".b"
},
{
"input": "BA",
"output": ".b"
},
{
"input": "aab",
"output": ".b"
},
{
"input": "baa",
"output": ".b"
},
{
"input": "femOZeCArKCpUiHYnbBPTIOFmsHmcpObtPYcLCdjFrUMIyqYzAokKUiiKZRouZiNMoiOuGVoQzaaCAOkquRjmmKKElLNqCnhGdQM",
"output": ".f.m.z.c.r.k.c.p.h.n.b.b.p.t.f.m.s.h.m.c.p.b.t.p.c.l.c.d.j.f.r.m.q.z.k.k.k.z.r.z.n.m.g.v.q.z.c.k.q.r.j.m.m.k.k.l.l.n.q.c.n.h.g.d.q.m"
},
{
"input": "VMBPMCmMDCLFELLIISUJDWQRXYRDGKMXJXJHXVZADRZWVWJRKFRRNSAWKKDPZZLFLNSGUNIVJFBEQsMDHSBJVDTOCSCgZWWKvZZN",
"output": ".v.m.b.p.m.c.m.m.d.c.l.f.l.l.s.j.d.w.q.r.x.r.d.g.k.m.x.j.x.j.h.x.v.z.d.r.z.w.v.w.j.r.k.f.r.r.n.s.w.k.k.d.p.z.z.l.f.l.n.s.g.n.v.j.f.b.q.s.m.d.h.s.b.j.v.d.t.c.s.c.g.z.w.w.k.v.z.z.n"
},
{
"input": "MCGFQQJNUKuAEXrLXibVjClSHjSxmlkQGTKZrRaDNDomIPOmtSgjJAjNVIVLeUGUAOHNkCBwNObVCHOWvNkLFQQbFnugYVMkJruJ",
"output": ".m.c.g.f.q.q.j.n.k.x.r.l.x.b.v.j.c.l.s.h.j.s.x.m.l.k.q.g.t.k.z.r.r.d.n.d.m.p.m.t.s.g.j.j.j.n.v.v.l.g.h.n.k.c.b.w.n.b.v.c.h.w.v.n.k.l.f.q.q.b.f.n.g.v.m.k.j.r.j"
},
{
"input": "iyaiuiwioOyzUaOtAeuEYcevvUyveuyioeeueoeiaoeiavizeeoeyYYaaAOuouueaUioueauayoiuuyiuovyOyiyoyioaoyuoyea",
"output": ".w.z.t.c.v.v.v.v.z.v"
},
{
"input": "yjnckpfyLtzwjsgpcrgCfpljnjwqzgVcufnOvhxplvflxJzqxnhrwgfJmPzifgubvspffmqrwbzivatlmdiBaddiaktdsfPwsevl",
"output": ".j.n.c.k.p.f.l.t.z.w.j.s.g.p.c.r.g.c.f.p.l.j.n.j.w.q.z.g.v.c.f.n.v.h.x.p.l.v.f.l.x.j.z.q.x.n.h.r.w.g.f.j.m.p.z.f.g.b.v.s.p.f.f.m.q.r.w.b.z.v.t.l.m.d.b.d.d.k.t.d.s.f.p.w.s.v.l"
},
{
"input": "RIIIUaAIYJOiuYIUWFPOOAIuaUEZeIooyUEUEAoIyIHYOEAlVAAIiLUAUAeiUIEiUMuuOiAgEUOIAoOUYYEYFEoOIIVeOOAOIIEg",
"output": ".r.j.w.f.p.z.h.l.v.l.m.g.f.v.g"
},
{
"input": "VBKQCFBMQHDMGNSGBQVJTGQCNHHRJMNKGKDPPSQRRVQTZNKBZGSXBPBRXPMVFTXCHZMSJVBRNFNTHBHGJLMDZJSVPZZBCCZNVLMQ",
"output": ".v.b.k.q.c.f.b.m.q.h.d.m.g.n.s.g.b.q.v.j.t.g.q.c.n.h.h.r.j.m.n.k.g.k.d.p.p.s.q.r.r.v.q.t.z.n.k.b.z.g.s.x.b.p.b.r.x.p.m.v.f.t.x.c.h.z.m.s.j.v.b.r.n.f.n.t.h.b.h.g.j.l.m.d.z.j.s.v.p.z.z.b.c.c.z.n.v.l.m.q"
},
{
"input": "iioyoaayeuyoolyiyoeuouiayiiuyTueyiaoiueyioiouyuauouayyiaeoeiiigmioiououeieeeyuyyaYyioiiooaiuouyoeoeg",
"output": ".l.t.g.m.g"
},
{
"input": "ueyiuiauuyyeueykeioouiiauzoyoeyeuyiaoaiiaaoaueyaeydaoauexuueafouiyioueeaaeyoeuaueiyiuiaeeayaioeouiuy",
"output": ".k.z.d.x.f"
},
{
"input": "FSNRBXLFQHZXGVMKLQDVHWLDSLKGKFMDRQWMWSSKPKKQBNDZRSCBLRSKCKKFFKRDMZFZGCNSMXNPMZVDLKXGNXGZQCLRTTDXLMXQ",
"output": ".f.s.n.r.b.x.l.f.q.h.z.x.g.v.m.k.l.q.d.v.h.w.l.d.s.l.k.g.k.f.m.d.r.q.w.m.w.s.s.k.p.k.k.q.b.n.d.z.r.s.c.b.l.r.s.k.c.k.k.f.f.k.r.d.m.z.f.z.g.c.n.s.m.x.n.p.m.z.v.d.l.k.x.g.n.x.g.z.q.c.l.r.t.t.d.x.l.m.x.q"
},
{
"input": "EYAYAYIOIOYOOAUOEUEUOUUYIYUUMOEOIIIAOIUOAAOIYOIOEUIERCEYYAOIOIGYUIAOYUEOEUAEAYPOYEYUUAUOAOEIYIEYUEEY",
"output": ".m.r.c.g.p"
},
{
"input": "jvvzcdcxjstbbksmqjsngxkgtttdxrljjxtwptgwwqzpvqchvgrkqlzxmptzblxhhsmrkmzzmgdfskhtmmnqzzflpmqdctvrfgtx",
"output": ".j.v.v.z.c.d.c.x.j.s.t.b.b.k.s.m.q.j.s.n.g.x.k.g.t.t.t.d.x.r.l.j.j.x.t.w.p.t.g.w.w.q.z.p.v.q.c.h.v.g.r.k.q.l.z.x.m.p.t.z.b.l.x.h.h.s.m.r.k.m.z.z.m.g.d.f.s.k.h.t.m.m.n.q.z.z.f.l.p.m.q.d.c.t.v.r.f.g.t.x"
},
{
"input": "YB",
"output": ".b"
},
{
"input": "fly",
"output": ".f.l"
},
{
"input": "YyyYYYyyYxdwdawdDAWDdaddYYYY",
"output": ".x.d.w.d.w.d.d.w.d.d.d.d"
}
] | 1,697,378,659
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 42
| 124
| 0
|
x=input()
y=""
for i in range(0,len(x)):
if x[i] not in "aeiouyAEIOUY":
y+=x[i]
for j in range(0,len(y)):
if(y[j]>='A' and y[j]<='Z'):
y=y.lower()
m=""
f=0
for g in range(0,2*len(y)):
if(g%2==0):
m+="."
else:
m+=y[f]
f+=1
print(m)
|
Title: String Task
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it:
- deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones.
Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string.
Help Petya cope with this easy task.
Input Specification:
The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.
Output Specification:
Print the resulting string. It is guaranteed that this string is not empty.
Demo Input:
['tour\n', 'Codeforces\n', 'aBAcAba\n']
Demo Output:
['.t.r\n', '.c.d.f.r.c.s\n', '.b.c.b\n']
Note:
none
|
```python
x=input()
y=""
for i in range(0,len(x)):
if x[i] not in "aeiouyAEIOUY":
y+=x[i]
for j in range(0,len(y)):
if(y[j]>='A' and y[j]<='Z'):
y=y.lower()
m=""
f=0
for g in range(0,2*len(y)):
if(g%2==0):
m+="."
else:
m+=y[f]
f+=1
print(m)
```
| 3
|
|
581
|
A
|
Vasya the Hipster
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him?
|
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
|
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
|
[
"3 1\n",
"2 3\n",
"7 3\n"
] |
[
"1 1\n",
"2 0\n",
"3 2\n"
] |
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
| 500
|
[
{
"input": "3 1",
"output": "1 1"
},
{
"input": "2 3",
"output": "2 0"
},
{
"input": "7 3",
"output": "3 2"
},
{
"input": "100 100",
"output": "100 0"
},
{
"input": "4 10",
"output": "4 3"
},
{
"input": "6 10",
"output": "6 2"
},
{
"input": "6 11",
"output": "6 2"
},
{
"input": "10 40",
"output": "10 15"
},
{
"input": "11 56",
"output": "11 22"
},
{
"input": "34 30",
"output": "30 2"
},
{
"input": "33 33",
"output": "33 0"
},
{
"input": "100 45",
"output": "45 27"
},
{
"input": "100 23",
"output": "23 38"
},
{
"input": "45 12",
"output": "12 16"
},
{
"input": "1 1",
"output": "1 0"
},
{
"input": "1 100",
"output": "1 49"
},
{
"input": "100 1",
"output": "1 49"
},
{
"input": "68 59",
"output": "59 4"
},
{
"input": "45 99",
"output": "45 27"
},
{
"input": "99 100",
"output": "99 0"
},
{
"input": "100 98",
"output": "98 1"
},
{
"input": "59 12",
"output": "12 23"
},
{
"input": "86 4",
"output": "4 41"
},
{
"input": "68 21",
"output": "21 23"
},
{
"input": "100 11",
"output": "11 44"
},
{
"input": "100 10",
"output": "10 45"
},
{
"input": "15 45",
"output": "15 15"
},
{
"input": "11 32",
"output": "11 10"
},
{
"input": "34 96",
"output": "34 31"
},
{
"input": "89 89",
"output": "89 0"
}
] | 1,670,317,106
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 46
| 0
|
a, b = map(int, input().split())
c = min (a,b)
d = (((max(a,b) - min(a,b))//2))
print(c, d)
|
Title: Vasya the Hipster
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him?
Input Specification:
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
Output Specification:
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
Demo Input:
['3 1\n', '2 3\n', '7 3\n']
Demo Output:
['1 1\n', '2 0\n', '3 2\n']
Note:
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
|
```python
a, b = map(int, input().split())
c = min (a,b)
d = (((max(a,b) - min(a,b))//2))
print(c, d)
```
| 3
|
|
365
|
A
|
Good Number
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
Let's call a number *k*-good if it contains all digits not exceeding *k* (0,<=...,<=*k*). You've got a number *k* and an array *a* containing *n* numbers. Find out how many *k*-good numbers are in *a* (count each number every time it occurs in array *a*).
|
The first line contains integers *n* and *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=9). The *i*-th of the following *n* lines contains integer *a**i* without leading zeroes (1<=≤<=*a**i*<=≤<=109).
|
Print a single integer — the number of *k*-good numbers in *a*.
|
[
"10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n",
"2 1\n1\n10\n"
] |
[
"10\n",
"1\n"
] |
none
| 500
|
[
{
"input": "10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560",
"output": "10"
},
{
"input": "2 1\n1\n10",
"output": "1"
},
{
"input": "1 0\n1000000000",
"output": "1"
},
{
"input": "1 1\n1000000000",
"output": "1"
},
{
"input": "6 0\n10\n102\n120\n1032\n1212103\n1999999",
"output": "5"
},
{
"input": "1 3\n1000000000",
"output": "0"
},
{
"input": "1 9\n1000000000",
"output": "0"
},
{
"input": "1 0\n1",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 3\n1",
"output": "0"
},
{
"input": "1 9\n1",
"output": "0"
},
{
"input": "2 8\n123456780\n123",
"output": "1"
},
{
"input": "2 8\n12345678\n1230",
"output": "0"
},
{
"input": "6 1\n10\n102\n120\n1032\n1212103\n1999999",
"output": "5"
},
{
"input": "6 2\n10\n102\n120\n1032\n1212103\n1999999",
"output": "4"
},
{
"input": "6 3\n10\n102\n120\n1032\n1212103\n1999999",
"output": "2"
},
{
"input": "6 9\n10\n102\n120\n1032\n1212103\n1999999",
"output": "0"
},
{
"input": "1 2\n2220",
"output": "0"
}
] | 1,638,985,714
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 46
| 0
|
x, y = map(int, input().split())
f = 0
for i in range(x):
g = 0
a = list(map(int, input()))
for j in range(y+1):
if j in a:
g += 1
if g == y + 1:
f+= 1
print(c)
|
Title: Good Number
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let's call a number *k*-good if it contains all digits not exceeding *k* (0,<=...,<=*k*). You've got a number *k* and an array *a* containing *n* numbers. Find out how many *k*-good numbers are in *a* (count each number every time it occurs in array *a*).
Input Specification:
The first line contains integers *n* and *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=9). The *i*-th of the following *n* lines contains integer *a**i* without leading zeroes (1<=≤<=*a**i*<=≤<=109).
Output Specification:
Print a single integer — the number of *k*-good numbers in *a*.
Demo Input:
['10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n', '2 1\n1\n10\n']
Demo Output:
['10\n', '1\n']
Note:
none
|
```python
x, y = map(int, input().split())
f = 0
for i in range(x):
g = 0
a = list(map(int, input()))
for j in range(y+1):
if j in a:
g += 1
if g == y + 1:
f+= 1
print(c)
```
| -1
|
|
103
|
B
|
Cthulhu
|
PROGRAMMING
| 1,500
|
[
"dfs and similar",
"dsu",
"graphs"
] |
B. Cthulhu
|
2
|
256
|
...Once upon a time a man came to the sea. The sea was stormy and dark. The man started to call for the little mermaid to appear but alas, he only woke up Cthulhu...
Whereas on the other end of the world Pentagon is actively collecting information trying to predict the monster's behavior and preparing the secret super weapon. Due to high seismic activity and poor weather conditions the satellites haven't yet been able to make clear shots of the monster. The analysis of the first shot resulted in an undirected graph with *n* vertices and *m* edges. Now the world's best minds are about to determine whether this graph can be regarded as Cthulhu or not.
To add simplicity, let's suppose that Cthulhu looks from the space like some spherical body with tentacles attached to it. Formally, we shall regard as Cthulhu such an undirected graph that can be represented as a set of three or more rooted trees, whose roots are connected by a simple cycle.
It is guaranteed that the graph contains no multiple edges and self-loops.
|
The first line contains two integers — the number of vertices *n* and the number of edges *m* of the graph (1<=≤<=*n*<=≤<=100, 0<=≤<=*m*<=≤<=).
Each of the following *m* lines contains a pair of integers *x* and *y*, that show that an edge exists between vertices *x* and *y* (1<=≤<=*x*,<=*y*<=≤<=*n*,<=*x*<=≠<=*y*). For each pair of vertices there will be at most one edge between them, no edge connects a vertex to itself.
|
Print "NO", if the graph is not Cthulhu and "FHTAGN!" if it is.
|
[
"6 6\n6 3\n6 4\n5 1\n2 5\n1 4\n5 4\n",
"6 5\n5 6\n4 6\n3 1\n5 1\n1 2\n"
] |
[
"FHTAGN!",
"NO"
] |
Let us denote as a simple cycle a set of *v* vertices that can be numbered so that the edges will only exist between vertices number 1 and 2, 2 and 3, ..., *v* - 1 and *v*, *v* and 1.
A tree is a connected undirected graph consisting of *n* vertices and *n* - 1 edges (*n* > 0).
A rooted tree is a tree where one vertex is selected to be the root.
| 1,000
|
[
{
"input": "6 6\n6 3\n6 4\n5 1\n2 5\n1 4\n5 4",
"output": "FHTAGN!"
},
{
"input": "6 5\n5 6\n4 6\n3 1\n5 1\n1 2",
"output": "NO"
},
{
"input": "10 10\n4 10\n8 5\n2 8\n4 9\n9 3\n2 7\n10 6\n10 2\n9 8\n1 8",
"output": "FHTAGN!"
},
{
"input": "5 4\n1 5\n1 3\n1 4\n3 2",
"output": "NO"
},
{
"input": "12 12\n4 12\n4 7\n4 9\n7 2\n5 12\n2 1\n5 9\n8 6\n10 12\n2 5\n10 9\n12 3",
"output": "NO"
},
{
"input": "12 15\n3 2\n11 12\n1 9\n2 1\n1 8\n9 6\n11 5\n9 5\n9 10\n11 3\n7 11\n5 6\n11 10\n4 6\n4 2",
"output": "NO"
},
{
"input": "12 10\n1 11\n3 6\n5 7\n4 7\n6 8\n11 7\n3 12\n11 12\n7 9\n12 2",
"output": "NO"
},
{
"input": "1 0",
"output": "NO"
},
{
"input": "2 1\n1 2",
"output": "NO"
},
{
"input": "3 1\n1 3",
"output": "NO"
},
{
"input": "3 2\n1 2\n2 3",
"output": "NO"
},
{
"input": "3 3\n1 2\n2 3\n3 1",
"output": "FHTAGN!"
},
{
"input": "4 4\n1 2\n3 4\n4 1\n2 4",
"output": "FHTAGN!"
},
{
"input": "6 6\n1 2\n2 3\n3 1\n4 5\n5 6\n6 4",
"output": "NO"
},
{
"input": "2 0",
"output": "NO"
},
{
"input": "3 0",
"output": "NO"
},
{
"input": "100 0",
"output": "NO"
},
{
"input": "100 1\n11 23",
"output": "NO"
},
{
"input": "10 10\n5 7\n8 1\n10 3\n6 4\n10 6\n5 3\n5 6\n2 6\n4 3\n2 10",
"output": "NO"
},
{
"input": "20 20\n9 10\n4 19\n9 20\n12 20\n1 15\n2 12\n19 10\n19 15\n4 10\n4 8\n8 9\n20 8\n6 2\n2 15\n7 19\n20 4\n3 16\n1 20\n9 1\n20 10",
"output": "NO"
},
{
"input": "30 30\n17 6\n16 29\n16 13\n16 20\n29 26\n17 5\n27 28\n24 16\n7 18\n24 10\n1 27\n12 17\n27 30\n6 1\n3 30\n5 19\n18 13\n16 2\n30 1\n5 8\n14 16\n26 18\n7 19\n5 6\n23 14\n6 8\n23 8\n18 8\n18 3\n5 21",
"output": "NO"
},
{
"input": "100 66\n41 14\n19 13\n70 43\n79 62\n9 62\n71 40\n53 86\n80 4\n34 33\n72 68\n40 96\n84 59\n36 77\n55 50\n40 3\n79 81\n3 43\n33 47\n22 98\n33 90\n56 49\n69 28\n73 30\n65 22\n98 20\n9 52\n54 20\n32 70\n51 80\n63 12\n21 48\n35 17\n48 87\n25 43\n65 80\n42 3\n86 35\n95 98\n43 59\n51 46\n66 37\n88 34\n32 47\n24 42\n21 44\n92 59\n81 6\n100 82\n85 6\n58 25\n66 6\n14 32\n59 85\n3 98\n44 4\n85 51\n69 41\n80 70\n81 24\n75 71\n93 9\n82 55\n70 46\n66 32\n77 58\n11 46",
"output": "NO"
},
{
"input": "4 4\n1 2\n4 3\n2 3\n3 1",
"output": "FHTAGN!"
},
{
"input": "5 5\n2 3\n2 4\n5 4\n4 1\n1 2",
"output": "FHTAGN!"
},
{
"input": "10 10\n1 10\n5 9\n6 2\n8 9\n9 1\n5 4\n2 8\n1 3\n6 3\n4 1",
"output": "NO"
},
{
"input": "6 6\n1 2\n2 3\n3 1\n4 5\n5 6\n6 4",
"output": "NO"
},
{
"input": "4 3\n1 2\n2 3\n3 1",
"output": "NO"
},
{
"input": "6 5\n1 2\n2 3\n3 1\n1 4\n1 5",
"output": "NO"
}
] | 1,599,547,969
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 5
| 280
| 0
|
def get_roots(start,parent,color,edges,roots):
color[start] = 1
if roots:
return
for neighbor in edges[start]:
if color[neighbor] == 0:
get_roots(neighbor,start,color,edges,roots)
elif color[neighbor] == 1 and neighbor !=parent:
if not roots.keys():
for i in range(len(color)):
if color[i] == 1:
roots[i] = True
return
color[start] = 2
def solve():
n,m = map(int,input().split())
color = [0 for _ in range(n+1)]
edges = [[] for _ in range(n+1)]
visited = [False for _ in range(n+1)]
roots = dict()
for _ in range(m):
u,v = map(int,input().split())
edges[u].append(v)
edges[v].append(u)
get_roots(1,-1,color,edges,roots)
if not roots.keys():
print('NO')
return
for root in roots.keys():
stack = list()
stack.append(root)
while stack:
parent = stack.pop()
visited[parent] = True
for child in edges[parent]:
if not visited[child]:
if not roots.get(child):
stack.append(child)
visited[child] = True
for i in range(1,n+1):
if not visited[i]:
print('NO')
return
print('FHTAGN!')
solve()
|
Title: Cthulhu
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
...Once upon a time a man came to the sea. The sea was stormy and dark. The man started to call for the little mermaid to appear but alas, he only woke up Cthulhu...
Whereas on the other end of the world Pentagon is actively collecting information trying to predict the monster's behavior and preparing the secret super weapon. Due to high seismic activity and poor weather conditions the satellites haven't yet been able to make clear shots of the monster. The analysis of the first shot resulted in an undirected graph with *n* vertices and *m* edges. Now the world's best minds are about to determine whether this graph can be regarded as Cthulhu or not.
To add simplicity, let's suppose that Cthulhu looks from the space like some spherical body with tentacles attached to it. Formally, we shall regard as Cthulhu such an undirected graph that can be represented as a set of three or more rooted trees, whose roots are connected by a simple cycle.
It is guaranteed that the graph contains no multiple edges and self-loops.
Input Specification:
The first line contains two integers — the number of vertices *n* and the number of edges *m* of the graph (1<=≤<=*n*<=≤<=100, 0<=≤<=*m*<=≤<=).
Each of the following *m* lines contains a pair of integers *x* and *y*, that show that an edge exists between vertices *x* and *y* (1<=≤<=*x*,<=*y*<=≤<=*n*,<=*x*<=≠<=*y*). For each pair of vertices there will be at most one edge between them, no edge connects a vertex to itself.
Output Specification:
Print "NO", if the graph is not Cthulhu and "FHTAGN!" if it is.
Demo Input:
['6 6\n6 3\n6 4\n5 1\n2 5\n1 4\n5 4\n', '6 5\n5 6\n4 6\n3 1\n5 1\n1 2\n']
Demo Output:
['FHTAGN!', 'NO']
Note:
Let us denote as a simple cycle a set of *v* vertices that can be numbered so that the edges will only exist between vertices number 1 and 2, 2 and 3, ..., *v* - 1 and *v*, *v* and 1.
A tree is a connected undirected graph consisting of *n* vertices and *n* - 1 edges (*n* > 0).
A rooted tree is a tree where one vertex is selected to be the root.
|
```python
def get_roots(start,parent,color,edges,roots):
color[start] = 1
if roots:
return
for neighbor in edges[start]:
if color[neighbor] == 0:
get_roots(neighbor,start,color,edges,roots)
elif color[neighbor] == 1 and neighbor !=parent:
if not roots.keys():
for i in range(len(color)):
if color[i] == 1:
roots[i] = True
return
color[start] = 2
def solve():
n,m = map(int,input().split())
color = [0 for _ in range(n+1)]
edges = [[] for _ in range(n+1)]
visited = [False for _ in range(n+1)]
roots = dict()
for _ in range(m):
u,v = map(int,input().split())
edges[u].append(v)
edges[v].append(u)
get_roots(1,-1,color,edges,roots)
if not roots.keys():
print('NO')
return
for root in roots.keys():
stack = list()
stack.append(root)
while stack:
parent = stack.pop()
visited[parent] = True
for child in edges[parent]:
if not visited[child]:
if not roots.get(child):
stack.append(child)
visited[child] = True
for i in range(1,n+1):
if not visited[i]:
print('NO')
return
print('FHTAGN!')
solve()
```
| 0
|
13
|
A
|
Numbers
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Numbers
|
1
|
64
|
Little Petya likes numbers a lot. He found that number 123 in base 16 consists of two digits: the first is 7 and the second is 11. So the sum of digits of 123 in base 16 is equal to 18.
Now he wonders what is an average value of sum of digits of the number *A* written in all bases from 2 to *A*<=-<=1.
Note that all computations should be done in base 10. You should find the result as an irreducible fraction, written in base 10.
|
Input contains one integer number *A* (3<=≤<=*A*<=≤<=1000).
|
Output should contain required average value in format «X/Y», where X is the numerator and Y is the denominator.
|
[
"5\n",
"3\n"
] |
[
"7/3\n",
"2/1\n"
] |
In the first sample number 5 written in all bases from 2 to 4 looks so: 101, 12, 11. Sums of digits are 2, 3 and 2, respectively.
| 0
|
[
{
"input": "5",
"output": "7/3"
},
{
"input": "3",
"output": "2/1"
},
{
"input": "1000",
"output": "90132/499"
},
{
"input": "927",
"output": "155449/925"
},
{
"input": "260",
"output": "6265/129"
},
{
"input": "131",
"output": "3370/129"
},
{
"input": "386",
"output": "857/12"
},
{
"input": "277",
"output": "2864/55"
},
{
"input": "766",
"output": "53217/382"
},
{
"input": "28",
"output": "85/13"
},
{
"input": "406",
"output": "7560/101"
},
{
"input": "757",
"output": "103847/755"
},
{
"input": "6",
"output": "9/4"
},
{
"input": "239",
"output": "10885/237"
},
{
"input": "322",
"output": "2399/40"
},
{
"input": "98",
"output": "317/16"
},
{
"input": "208",
"output": "4063/103"
},
{
"input": "786",
"output": "55777/392"
},
{
"input": "879",
"output": "140290/877"
},
{
"input": "702",
"output": "89217/700"
},
{
"input": "948",
"output": "7369/43"
},
{
"input": "537",
"output": "52753/535"
},
{
"input": "984",
"output": "174589/982"
},
{
"input": "934",
"output": "157951/932"
},
{
"input": "726",
"output": "95491/724"
},
{
"input": "127",
"output": "3154/125"
},
{
"input": "504",
"output": "23086/251"
},
{
"input": "125",
"output": "3080/123"
},
{
"input": "604",
"output": "33178/301"
},
{
"input": "115",
"output": "2600/113"
},
{
"input": "27",
"output": "167/25"
},
{
"input": "687",
"output": "85854/685"
},
{
"input": "880",
"output": "69915/439"
},
{
"input": "173",
"output": "640/19"
},
{
"input": "264",
"output": "6438/131"
},
{
"input": "785",
"output": "111560/783"
},
{
"input": "399",
"output": "29399/397"
},
{
"input": "514",
"output": "6031/64"
},
{
"input": "381",
"output": "26717/379"
},
{
"input": "592",
"output": "63769/590"
},
{
"input": "417",
"output": "32002/415"
},
{
"input": "588",
"output": "62723/586"
},
{
"input": "852",
"output": "131069/850"
},
{
"input": "959",
"output": "5059/29"
},
{
"input": "841",
"output": "127737/839"
},
{
"input": "733",
"output": "97598/731"
},
{
"input": "692",
"output": "87017/690"
},
{
"input": "69",
"output": "983/67"
},
{
"input": "223",
"output": "556/13"
},
{
"input": "93",
"output": "246/13"
},
{
"input": "643",
"output": "75503/641"
},
{
"input": "119",
"output": "2833/117"
},
{
"input": "498",
"output": "1459/16"
},
{
"input": "155",
"output": "4637/153"
},
{
"input": "305",
"output": "17350/303"
},
{
"input": "454",
"output": "37893/452"
},
{
"input": "88",
"output": "1529/86"
},
{
"input": "850",
"output": "32645/212"
},
{
"input": "474",
"output": "20581/236"
},
{
"input": "309",
"output": "17731/307"
},
{
"input": "762",
"output": "105083/760"
},
{
"input": "591",
"output": "63761/589"
},
{
"input": "457",
"output": "38317/455"
},
{
"input": "141",
"output": "3832/139"
},
{
"input": "385",
"output": "27232/383"
},
{
"input": "387",
"output": "27628/385"
},
{
"input": "469",
"output": "40306/467"
},
{
"input": "624",
"output": "35285/311"
},
{
"input": "330",
"output": "487/8"
},
{
"input": "31",
"output": "222/29"
},
{
"input": "975",
"output": "171679/973"
},
{
"input": "584",
"output": "62183/582"
},
{
"input": "668",
"output": "81127/666"
},
{
"input": "331",
"output": "20297/329"
},
{
"input": "189",
"output": "6789/187"
},
{
"input": "251",
"output": "11939/249"
},
{
"input": "876",
"output": "69196/437"
},
{
"input": "615",
"output": "68987/613"
},
{
"input": "451",
"output": "37258/449"
},
{
"input": "499",
"output": "45727/497"
},
{
"input": "699",
"output": "89117/697"
},
{
"input": "619",
"output": "70019/617"
},
{
"input": "413",
"output": "10515/137"
},
{
"input": "197",
"output": "7399/195"
},
{
"input": "794",
"output": "14281/99"
},
{
"input": "659",
"output": "79403/657"
},
{
"input": "653",
"output": "77695/651"
},
{
"input": "23",
"output": "45/7"
},
{
"input": "430",
"output": "16985/214"
},
{
"input": "249",
"output": "11659/247"
},
{
"input": "837",
"output": "126869/835"
},
{
"input": "258",
"output": "12373/256"
},
{
"input": "995",
"output": "59665/331"
},
{
"input": "102",
"output": "504/25"
},
{
"input": "989",
"output": "177124/987"
},
{
"input": "376",
"output": "13008/187"
},
{
"input": "657",
"output": "15715/131"
},
{
"input": "746",
"output": "50509/372"
},
{
"input": "602",
"output": "13177/120"
}
] | 1,555,956,794
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 218
| 0
|
def f(x,b):
m=0
for n in range(10000):
m+=x%b
u=int(x/b)
# print(x%b)
x=u
if x<b:
m+=x%b
break
return m
#print(f(5,3))
m=0
x=int(input())
for n in range(2,x):
m+=f(x,n)
print("{}/{}".format(m,(x-2)))
|
Title: Numbers
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Little Petya likes numbers a lot. He found that number 123 in base 16 consists of two digits: the first is 7 and the second is 11. So the sum of digits of 123 in base 16 is equal to 18.
Now he wonders what is an average value of sum of digits of the number *A* written in all bases from 2 to *A*<=-<=1.
Note that all computations should be done in base 10. You should find the result as an irreducible fraction, written in base 10.
Input Specification:
Input contains one integer number *A* (3<=≤<=*A*<=≤<=1000).
Output Specification:
Output should contain required average value in format «X/Y», where X is the numerator and Y is the denominator.
Demo Input:
['5\n', '3\n']
Demo Output:
['7/3\n', '2/1\n']
Note:
In the first sample number 5 written in all bases from 2 to 4 looks so: 101, 12, 11. Sums of digits are 2, 3 and 2, respectively.
|
```python
def f(x,b):
m=0
for n in range(10000):
m+=x%b
u=int(x/b)
# print(x%b)
x=u
if x<b:
m+=x%b
break
return m
#print(f(5,3))
m=0
x=int(input())
for n in range(2,x):
m+=f(x,n)
print("{}/{}".format(m,(x-2)))
```
| 0
|
842
|
A
|
Kirill And The Game
|
PROGRAMMING
| 1,200
|
[
"brute force",
"two pointers"
] | null | null |
Kirill plays a new computer game. He came to the potion store where he can buy any potion. Each potion is characterized by two integers — amount of experience and cost. The efficiency of a potion is the ratio of the amount of experience to the cost. Efficiency may be a non-integer number.
For each two integer numbers *a* and *b* such that *l*<=≤<=*a*<=≤<=*r* and *x*<=≤<=*b*<=≤<=*y* there is a potion with experience *a* and cost *b* in the store (that is, there are (*r*<=-<=*l*<=+<=1)·(*y*<=-<=*x*<=+<=1) potions).
Kirill wants to buy a potion which has efficiency *k*. Will he be able to do this?
|
First string contains five integer numbers *l*, *r*, *x*, *y*, *k* (1<=≤<=*l*<=≤<=*r*<=≤<=107, 1<=≤<=*x*<=≤<=*y*<=≤<=107, 1<=≤<=*k*<=≤<=107).
|
Print "YES" without quotes if a potion with efficiency exactly *k* can be bought in the store and "NO" without quotes otherwise.
You can output each of the letters in any register.
|
[
"1 10 1 10 1\n",
"1 5 6 10 1\n"
] |
[
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "1 10 1 10 1",
"output": "YES"
},
{
"input": "1 5 6 10 1",
"output": "NO"
},
{
"input": "1 1 1 1 1",
"output": "YES"
},
{
"input": "1 1 1 1 2",
"output": "NO"
},
{
"input": "1 100000 1 100000 100000",
"output": "YES"
},
{
"input": "1 100000 1 100000 100001",
"output": "NO"
},
{
"input": "25 10000 200 10000 5",
"output": "YES"
},
{
"input": "1 100000 10 100000 50000",
"output": "NO"
},
{
"input": "91939 94921 10197 89487 1",
"output": "NO"
},
{
"input": "30518 58228 74071 77671 1",
"output": "NO"
},
{
"input": "46646 79126 78816 91164 5",
"output": "NO"
},
{
"input": "30070 83417 92074 99337 2",
"output": "NO"
},
{
"input": "13494 17544 96820 99660 6",
"output": "NO"
},
{
"input": "96918 97018 10077 86510 9",
"output": "YES"
},
{
"input": "13046 45594 14823 52475 1",
"output": "YES"
},
{
"input": "29174 40572 95377 97669 4",
"output": "NO"
},
{
"input": "79894 92433 8634 86398 4",
"output": "YES"
},
{
"input": "96022 98362 13380 94100 6",
"output": "YES"
},
{
"input": "79446 95675 93934 96272 3",
"output": "NO"
},
{
"input": "5440 46549 61481 99500 10",
"output": "NO"
},
{
"input": "21569 53580 74739 87749 3",
"output": "NO"
},
{
"input": "72289 78297 79484 98991 7",
"output": "NO"
},
{
"input": "88417 96645 92742 98450 5",
"output": "NO"
},
{
"input": "71841 96625 73295 77648 8",
"output": "NO"
},
{
"input": "87969 99230 78041 94736 4",
"output": "NO"
},
{
"input": "4 4 1 2 3",
"output": "NO"
},
{
"input": "150 150 1 2 100",
"output": "NO"
},
{
"input": "99 100 1 100 50",
"output": "YES"
},
{
"input": "7 7 3 6 2",
"output": "NO"
},
{
"input": "10 10 1 10 1",
"output": "YES"
},
{
"input": "36 36 5 7 6",
"output": "YES"
},
{
"input": "73 96 1 51 51",
"output": "NO"
},
{
"input": "3 3 1 3 2",
"output": "NO"
},
{
"input": "10000000 10000000 1 100000 10000000",
"output": "YES"
},
{
"input": "9222174 9829060 9418763 9955619 9092468",
"output": "NO"
},
{
"input": "70 70 1 2 50",
"output": "NO"
},
{
"input": "100 200 1 20 5",
"output": "YES"
},
{
"input": "1 200000 65536 65536 65537",
"output": "NO"
},
{
"input": "15 15 1 100 1",
"output": "YES"
},
{
"input": "10000000 10000000 1 10000000 100000",
"output": "YES"
},
{
"input": "10 10 2 5 4",
"output": "NO"
},
{
"input": "67 69 7 7 9",
"output": "NO"
},
{
"input": "100000 10000000 1 10000000 100000",
"output": "YES"
},
{
"input": "9 12 1 2 7",
"output": "NO"
},
{
"input": "5426234 6375745 2636512 8492816 4409404",
"output": "NO"
},
{
"input": "6134912 6134912 10000000 10000000 999869",
"output": "NO"
},
{
"input": "3 3 1 100 1",
"output": "YES"
},
{
"input": "10000000 10000000 10 10000000 100000",
"output": "YES"
},
{
"input": "4 4 1 100 2",
"output": "YES"
},
{
"input": "8 13 1 4 7",
"output": "NO"
},
{
"input": "10 10 100000 10000000 10000000",
"output": "NO"
},
{
"input": "5 6 1 4 2",
"output": "YES"
},
{
"input": "1002 1003 1 2 1000",
"output": "NO"
},
{
"input": "4 5 1 2 2",
"output": "YES"
},
{
"input": "5 6 1 5 1",
"output": "YES"
},
{
"input": "15 21 2 4 7",
"output": "YES"
},
{
"input": "4 5 3 7 1",
"output": "YES"
},
{
"input": "15 15 3 4 4",
"output": "NO"
},
{
"input": "3 6 1 2 2",
"output": "YES"
},
{
"input": "2 10 3 6 3",
"output": "YES"
},
{
"input": "1 10000000 1 10000000 100000",
"output": "YES"
},
{
"input": "8 13 1 2 7",
"output": "NO"
},
{
"input": "98112 98112 100000 100000 128850",
"output": "NO"
},
{
"input": "2 2 1 2 1",
"output": "YES"
},
{
"input": "8 8 3 4 2",
"output": "YES"
},
{
"input": "60 60 2 3 25",
"output": "NO"
},
{
"input": "16 17 2 5 5",
"output": "NO"
},
{
"input": "2 4 1 3 1",
"output": "YES"
},
{
"input": "4 5 1 2 3",
"output": "NO"
},
{
"input": "10 10 3 4 3",
"output": "NO"
},
{
"input": "10 10000000 999999 10000000 300",
"output": "NO"
},
{
"input": "100 120 9 11 10",
"output": "YES"
},
{
"input": "8 20 1 3 4",
"output": "YES"
},
{
"input": "10 14 2 3 4",
"output": "YES"
},
{
"input": "2000 2001 1 3 1000",
"output": "YES"
},
{
"input": "12 13 2 3 5",
"output": "NO"
},
{
"input": "7 7 2 3 3",
"output": "NO"
},
{
"input": "5 8 1 10000000 4",
"output": "YES"
},
{
"input": "5 5 1 1 4",
"output": "NO"
},
{
"input": "5 5 1 6 2",
"output": "NO"
},
{
"input": "200 300 4000381 4000382 4000381",
"output": "NO"
},
{
"input": "11 17 2 5 2",
"output": "NO"
},
{
"input": "9999999 10000000 1 10000000 999997",
"output": "NO"
},
{
"input": "7 8 2 3 3",
"output": "NO"
},
{
"input": "7 7 3 3 2",
"output": "NO"
},
{
"input": "15 15 2 3 7",
"output": "NO"
},
{
"input": "65408 65408 859 859 10000000",
"output": "NO"
},
{
"input": "1000000 10000000 1 100000 1",
"output": "NO"
},
{
"input": "6 12 2 3 2",
"output": "YES"
},
{
"input": "7 8 1 3 3",
"output": "NO"
},
{
"input": "4 4 1 2 2",
"output": "YES"
},
{
"input": "2 3 1 2 2",
"output": "YES"
},
{
"input": "11 14 2 3 5",
"output": "NO"
},
{
"input": "7 7 1 10 3",
"output": "NO"
},
{
"input": "49 50 1 2 27",
"output": "NO"
},
{
"input": "1 10000000 1 10000000 123456",
"output": "YES"
},
{
"input": "100000 10000000 100 10000000 100000",
"output": "YES"
},
{
"input": "17 19 2 3 8",
"output": "NO"
},
{
"input": "4 6 3 9 1",
"output": "YES"
},
{
"input": "19 20 6 7 3",
"output": "NO"
},
{
"input": "5000000 10000000 1 4999999 1",
"output": "NO"
}
] | 1,505,382,946
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 101
| 62
| 0
|
l,r,x,y,k = list(map(int, input().split()))
if k*y < l or r < k*x:
print('NO')
elif k*x < l and r < k*y:
if (r-l+1) >= k or l%k > r%k or l%k == 0:
print('YES')
else:
print('NO')
else:
print('YES')
|
Title: Kirill And The Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kirill plays a new computer game. He came to the potion store where he can buy any potion. Each potion is characterized by two integers — amount of experience and cost. The efficiency of a potion is the ratio of the amount of experience to the cost. Efficiency may be a non-integer number.
For each two integer numbers *a* and *b* such that *l*<=≤<=*a*<=≤<=*r* and *x*<=≤<=*b*<=≤<=*y* there is a potion with experience *a* and cost *b* in the store (that is, there are (*r*<=-<=*l*<=+<=1)·(*y*<=-<=*x*<=+<=1) potions).
Kirill wants to buy a potion which has efficiency *k*. Will he be able to do this?
Input Specification:
First string contains five integer numbers *l*, *r*, *x*, *y*, *k* (1<=≤<=*l*<=≤<=*r*<=≤<=107, 1<=≤<=*x*<=≤<=*y*<=≤<=107, 1<=≤<=*k*<=≤<=107).
Output Specification:
Print "YES" without quotes if a potion with efficiency exactly *k* can be bought in the store and "NO" without quotes otherwise.
You can output each of the letters in any register.
Demo Input:
['1 10 1 10 1\n', '1 5 6 10 1\n']
Demo Output:
['YES', 'NO']
Note:
none
|
```python
l,r,x,y,k = list(map(int, input().split()))
if k*y < l or r < k*x:
print('NO')
elif k*x < l and r < k*y:
if (r-l+1) >= k or l%k > r%k or l%k == 0:
print('YES')
else:
print('NO')
else:
print('YES')
```
| 3
|
|
71
|
A
|
Way Too Long Words
|
PROGRAMMING
| 800
|
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500
|
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,673,461,092
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 30
| 0
|
x = int(input())
for i in range(0,x):
a = input()
if len(a)>10:
ans = a[0]+str(len(a)-2)+a[len(a)-1]
print(ans)
else:
print(ans)
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
x = int(input())
for i in range(0,x):
a = input()
if len(a)>10:
ans = a[0]+str(len(a)-2)+a[len(a)-1]
print(ans)
else:
print(ans)
```
| -1
|
910
|
A
|
The Way to Home
|
PROGRAMMING
| 800
|
[
"dfs and similar",
"dp",
"greedy",
"implementation"
] | null | null |
A frog lives on the axis *Ox* and needs to reach home which is in the point *n*. She starts from the point 1. The frog can jump to the right at a distance not more than *d*. So, after she jumped from the point *x* she can reach the point *x*<=+<=*a*, where *a* is an integer from 1 to *d*.
For each point from 1 to *n* is known if there is a lily flower in it. The frog can jump only in points with a lilies. Guaranteed that there are lilies in the points 1 and *n*.
Determine the minimal number of jumps that the frog needs to reach home which is in the point *n* from the point 1. Consider that initially the frog is in the point 1. If the frog can not reach home, print -1.
|
The first line contains two integers *n* and *d* (2<=≤<=*n*<=≤<=100, 1<=≤<=*d*<=≤<=*n*<=-<=1) — the point, which the frog wants to reach, and the maximal length of the frog jump.
The second line contains a string *s* of length *n*, consisting of zeros and ones. If a character of the string *s* equals to zero, then in the corresponding point there is no lily flower. In the other case, in the corresponding point there is a lily flower. Guaranteed that the first and the last characters of the string *s* equal to one.
|
If the frog can not reach the home, print -1.
In the other case, print the minimal number of jumps that the frog needs to reach the home which is in the point *n* from the point 1.
|
[
"8 4\n10010101\n",
"4 2\n1001\n",
"8 4\n11100101\n",
"12 3\n101111100101\n"
] |
[
"2\n",
"-1\n",
"3\n",
"4\n"
] |
In the first example the from can reach home in two jumps: the first jump from the point 1 to the point 4 (the length of the jump is three), and the second jump from the point 4 to the point 8 (the length of the jump is four).
In the second example the frog can not reach home, because to make it she need to jump on a distance three, but the maximum length of her jump equals to two.
| 500
|
[
{
"input": "8 4\n10010101",
"output": "2"
},
{
"input": "4 2\n1001",
"output": "-1"
},
{
"input": "8 4\n11100101",
"output": "3"
},
{
"input": "12 3\n101111100101",
"output": "4"
},
{
"input": "5 4\n11011",
"output": "1"
},
{
"input": "5 4\n10001",
"output": "1"
},
{
"input": "10 7\n1101111011",
"output": "2"
},
{
"input": "10 9\n1110000101",
"output": "1"
},
{
"input": "10 9\n1100000001",
"output": "1"
},
{
"input": "20 5\n11111111110111101001",
"output": "4"
},
{
"input": "20 11\n11100000111000011011",
"output": "2"
},
{
"input": "20 19\n10100000000000000001",
"output": "1"
},
{
"input": "50 13\n10011010100010100111010000010000000000010100000101",
"output": "5"
},
{
"input": "50 8\n11010100000011001100001100010001110000101100110011",
"output": "8"
},
{
"input": "99 4\n111111111111111111111111111111111111111111111111111111111011111111111111111111111111111111111111111",
"output": "25"
},
{
"input": "99 98\n100000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "1"
},
{
"input": "100 5\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "20"
},
{
"input": "100 4\n1111111111111111111111111111111111111111111111111111111111111111111111111111110111111111111111111111",
"output": "25"
},
{
"input": "100 4\n1111111111111111111111111111111111111111111111111111111111111101111111011111111111111111111111111111",
"output": "25"
},
{
"input": "100 3\n1111110111111111111111111111111111111111101111111111111111111111111101111111111111111111111111111111",
"output": "34"
},
{
"input": "100 8\n1111111111101110111111111111111111111111111111111111111111111111111111110011111111111111011111111111",
"output": "13"
},
{
"input": "100 7\n1011111111111111111011101111111011111101111111111101111011110111111111111111111111110111111011111111",
"output": "15"
},
{
"input": "100 9\n1101111110111110101111111111111111011001110111011101011111111111010101111111100011011111111010111111",
"output": "12"
},
{
"input": "100 6\n1011111011111111111011010110011001010101111110111111000111011011111110101101110110101111110000100111",
"output": "18"
},
{
"input": "100 7\n1110001111101001110011111111111101111101101001010001101000101100000101101101011111111101101000100001",
"output": "16"
},
{
"input": "100 11\n1000010100011100011011100000010011001111011110100100001011010100011011111001101101110110010110001101",
"output": "10"
},
{
"input": "100 9\n1001001110000011100100000001000110111101101010101001000101001010011001101100110011011110110011011111",
"output": "13"
},
{
"input": "100 7\n1010100001110101111011000111000001110100100110110001110110011010100001100100001110111100110000101001",
"output": "18"
},
{
"input": "100 10\n1110110000000110000000101110100000111000001011100000100110010001110111001010101000011000000001011011",
"output": "12"
},
{
"input": "100 13\n1000000100000000100011000010010000101010011110000000001000011000110100001000010001100000011001011001",
"output": "9"
},
{
"input": "100 11\n1000000000100000010000100001000100000000010000100100000000100100001000000001011000110001000000000101",
"output": "12"
},
{
"input": "100 22\n1000100000001010000000000000000001000000100000000000000000010000000000001000000000000000000100000001",
"output": "7"
},
{
"input": "100 48\n1000000000000000011000000000000000000000000000000001100000000000000000000000000000000000000000000001",
"output": "3"
},
{
"input": "100 48\n1000000000000000000000100000000000000000000000000000000000000000000001000000000000000000100000000001",
"output": "3"
},
{
"input": "100 75\n1000000100000000000000000000000000000000000000000000000000000000000000000000000001000000000000000001",
"output": "3"
},
{
"input": "100 73\n1000000000000000000000000000000100000000000000000000000000000000000000000000000000000000000000000001",
"output": "2"
},
{
"input": "100 99\n1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "1"
},
{
"input": "100 1\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "99"
},
{
"input": "100 2\n1111111111111111111111111111111110111111111111111111111111111111111111111111111111111111111111111111",
"output": "50"
},
{
"input": "100 1\n1111111111111111011111111111111111111111111111111111111111111111111101111111111111111111111111111111",
"output": "-1"
},
{
"input": "100 3\n1111111111111111111111111101111111111111111111111011111111111111111111111111111011111111111111111111",
"output": "33"
},
{
"input": "100 1\n1101111111111111111111101111111111111111111111111111111111111011111111101111101111111111111111111111",
"output": "-1"
},
{
"input": "100 6\n1111111111111111111111101111111101011110001111111111111111110111111111111111111111111110010111111111",
"output": "17"
},
{
"input": "100 2\n1111111101111010110111011011110111101111111011111101010101011111011111111111111011111001101111101111",
"output": "-1"
},
{
"input": "100 8\n1100110101111001101001111000111100110100011110111011001011111110000110101000001110111011100111011011",
"output": "14"
},
{
"input": "100 10\n1000111110100000001001101100000010011100010101001100010011111001001101111110110111101111001010001101",
"output": "11"
},
{
"input": "100 7\n1110000011010001110101011010000011110001000000011101110111010110001000011101111010010001101111110001",
"output": "-1"
},
{
"input": "100 3\n1111010001000001011011000011001111000100101000101101000010111101111000010000011110110011001101010111",
"output": "-1"
},
{
"input": "100 9\n1101010101101100010111011000010100001010000101010011001001100010110110000000010000101000000001101101",
"output": "13"
},
{
"input": "100 14\n1010100000000000010101000010001100000000000011100010000001000001011010001110001010100000100001101101",
"output": "9"
},
{
"input": "100 13\n1000000001101001110000010000011001000000000000001010000000100001001010000000000000000100010000000001",
"output": "-1"
},
{
"input": "100 18\n1000000000000000110000000000000000010000000001000001000001000000000100000000000010000000000000000001",
"output": "-1"
},
{
"input": "100 32\n1000000000000000000000000001000000000000000000000101000000000000000000000000000000000001000000000001",
"output": "-1"
},
{
"input": "100 79\n1000000001000000000101000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "2"
},
{
"input": "100 41\n1000000000000000000000000000000000010000000000000000000000000000000000000000100000000000000000000001",
"output": "3"
},
{
"input": "100 82\n1000000000000000000100000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "2"
},
{
"input": "100 96\n1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "-1"
},
{
"input": "43 30\n1001000001111111010100100100110101011101101",
"output": "2"
},
{
"input": "7 1\n1111111",
"output": "6"
},
{
"input": "9 3\n101000001",
"output": "-1"
},
{
"input": "10 3\n1100000001",
"output": "-1"
},
{
"input": "8 2\n10000101",
"output": "-1"
},
{
"input": "2 1\n11",
"output": "1"
}
] | 1,559,555,190
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 63
| 109
| 0
|
n, d = map(int, input().split())
a = input()
INF = 9999999999999
dp = [INF] * n
dp[0] = 0
for i in range(1, n):
if a[i] == '1':
for j in range(i - d, i):
dp[i] = min(dp[i], dp[j] + 1)
if dp[n - 1] == INF:
dp[n - 1] = -1
print(dp[n - 1])
|
Title: The Way to Home
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A frog lives on the axis *Ox* and needs to reach home which is in the point *n*. She starts from the point 1. The frog can jump to the right at a distance not more than *d*. So, after she jumped from the point *x* she can reach the point *x*<=+<=*a*, where *a* is an integer from 1 to *d*.
For each point from 1 to *n* is known if there is a lily flower in it. The frog can jump only in points with a lilies. Guaranteed that there are lilies in the points 1 and *n*.
Determine the minimal number of jumps that the frog needs to reach home which is in the point *n* from the point 1. Consider that initially the frog is in the point 1. If the frog can not reach home, print -1.
Input Specification:
The first line contains two integers *n* and *d* (2<=≤<=*n*<=≤<=100, 1<=≤<=*d*<=≤<=*n*<=-<=1) — the point, which the frog wants to reach, and the maximal length of the frog jump.
The second line contains a string *s* of length *n*, consisting of zeros and ones. If a character of the string *s* equals to zero, then in the corresponding point there is no lily flower. In the other case, in the corresponding point there is a lily flower. Guaranteed that the first and the last characters of the string *s* equal to one.
Output Specification:
If the frog can not reach the home, print -1.
In the other case, print the minimal number of jumps that the frog needs to reach the home which is in the point *n* from the point 1.
Demo Input:
['8 4\n10010101\n', '4 2\n1001\n', '8 4\n11100101\n', '12 3\n101111100101\n']
Demo Output:
['2\n', '-1\n', '3\n', '4\n']
Note:
In the first example the from can reach home in two jumps: the first jump from the point 1 to the point 4 (the length of the jump is three), and the second jump from the point 4 to the point 8 (the length of the jump is four).
In the second example the frog can not reach home, because to make it she need to jump on a distance three, but the maximum length of her jump equals to two.
|
```python
n, d = map(int, input().split())
a = input()
INF = 9999999999999
dp = [INF] * n
dp[0] = 0
for i in range(1, n):
if a[i] == '1':
for j in range(i - d, i):
dp[i] = min(dp[i], dp[j] + 1)
if dp[n - 1] == INF:
dp[n - 1] = -1
print(dp[n - 1])
```
| 3
|
|
217
|
A
|
Ice Skating
|
PROGRAMMING
| 1,200
|
[
"brute force",
"dfs and similar",
"dsu",
"graphs"
] | null | null |
Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created.
We assume that Bajtek can only heap up snow drifts at integer coordinates.
|
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift.
Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct.
|
Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one.
|
[
"2\n2 1\n1 2\n",
"2\n2 1\n4 1\n"
] |
[
"1\n",
"0\n"
] |
none
| 500
|
[
{
"input": "2\n2 1\n1 2",
"output": "1"
},
{
"input": "2\n2 1\n4 1",
"output": "0"
},
{
"input": "24\n171 35\n261 20\n4 206\n501 446\n961 912\n581 748\n946 978\n463 514\n841 889\n341 466\n842 967\n54 102\n235 261\n925 889\n682 672\n623 636\n268 94\n635 710\n474 510\n697 794\n586 663\n182 184\n806 663\n468 459",
"output": "21"
},
{
"input": "17\n660 646\n440 442\n689 618\n441 415\n922 865\n950 972\n312 366\n203 229\n873 860\n219 199\n344 308\n169 176\n961 992\n153 84\n201 230\n987 938\n834 815",
"output": "16"
},
{
"input": "11\n798 845\n722 911\n374 270\n629 537\n748 856\n831 885\n486 641\n751 829\n609 492\n98 27\n654 663",
"output": "10"
},
{
"input": "1\n321 88",
"output": "0"
},
{
"input": "9\n811 859\n656 676\n76 141\n945 951\n497 455\n18 55\n335 294\n267 275\n656 689",
"output": "7"
},
{
"input": "7\n948 946\n130 130\n761 758\n941 938\n971 971\n387 385\n509 510",
"output": "6"
},
{
"input": "6\n535 699\n217 337\n508 780\n180 292\n393 112\n732 888",
"output": "5"
},
{
"input": "14\n25 23\n499 406\n193 266\n823 751\n219 227\n101 138\n978 992\n43 74\n997 932\n237 189\n634 538\n774 740\n842 767\n742 802",
"output": "13"
},
{
"input": "12\n548 506\n151 198\n370 380\n655 694\n654 690\n407 370\n518 497\n819 827\n765 751\n802 771\n741 752\n653 662",
"output": "11"
},
{
"input": "40\n685 711\n433 403\n703 710\n491 485\n616 619\n288 282\n884 871\n367 352\n500 511\n977 982\n51 31\n576 564\n508 519\n755 762\n22 20\n368 353\n232 225\n953 955\n452 436\n311 330\n967 988\n369 364\n791 803\n150 149\n651 661\n118 93\n398 387\n748 766\n852 852\n230 228\n555 545\n515 519\n667 678\n867 862\n134 146\n859 863\n96 99\n486 469\n303 296\n780 786",
"output": "38"
},
{
"input": "3\n175 201\n907 909\n388 360",
"output": "2"
},
{
"input": "7\n312 298\n86 78\n73 97\n619 594\n403 451\n538 528\n71 86",
"output": "6"
},
{
"input": "19\n802 820\n368 248\n758 794\n455 378\n876 888\n771 814\n245 177\n586 555\n844 842\n364 360\n820 856\n731 624\n982 975\n825 856\n122 121\n862 896\n42 4\n792 841\n828 820",
"output": "16"
},
{
"input": "32\n643 877\n842 614\n387 176\n99 338\n894 798\n652 728\n611 648\n622 694\n579 781\n243 46\n322 305\n198 438\n708 579\n246 325\n536 459\n874 593\n120 277\n989 907\n223 110\n35 130\n761 692\n690 661\n518 766\n226 93\n678 597\n725 617\n661 574\n775 496\n56 416\n14 189\n358 359\n898 901",
"output": "31"
},
{
"input": "32\n325 327\n20 22\n72 74\n935 933\n664 663\n726 729\n785 784\n170 171\n315 314\n577 580\n984 987\n313 317\n434 435\n962 961\n55 54\n46 44\n743 742\n434 433\n617 612\n332 332\n883 886\n940 936\n793 792\n645 644\n611 607\n418 418\n465 465\n219 218\n167 164\n56 54\n403 405\n210 210",
"output": "29"
},
{
"input": "32\n652 712\n260 241\n27 154\n188 16\n521 351\n518 356\n452 540\n790 827\n339 396\n336 551\n897 930\n828 627\n27 168\n180 113\n134 67\n794 671\n812 711\n100 241\n686 813\n138 289\n384 506\n884 932\n913 959\n470 508\n730 734\n373 478\n788 862\n392 426\n148 68\n113 49\n713 852\n924 894",
"output": "29"
},
{
"input": "14\n685 808\n542 677\n712 747\n832 852\n187 410\n399 338\n626 556\n530 635\n267 145\n215 209\n559 684\n944 949\n753 596\n601 823",
"output": "13"
},
{
"input": "5\n175 158\n16 2\n397 381\n668 686\n957 945",
"output": "4"
},
{
"input": "5\n312 284\n490 509\n730 747\n504 497\n782 793",
"output": "4"
},
{
"input": "2\n802 903\n476 348",
"output": "1"
},
{
"input": "4\n325 343\n425 442\n785 798\n275 270",
"output": "3"
},
{
"input": "28\n462 483\n411 401\n118 94\n111 127\n5 6\n70 52\n893 910\n73 63\n818 818\n182 201\n642 633\n900 886\n893 886\n684 700\n157 173\n953 953\n671 660\n224 225\n832 801\n152 157\n601 585\n115 101\n739 722\n611 606\n659 642\n461 469\n702 689\n649 653",
"output": "25"
},
{
"input": "36\n952 981\n885 900\n803 790\n107 129\n670 654\n143 132\n66 58\n813 819\n849 837\n165 198\n247 228\n15 39\n619 618\n105 138\n868 855\n965 957\n293 298\n613 599\n227 212\n745 754\n723 704\n877 858\n503 487\n678 697\n592 595\n155 135\n962 982\n93 89\n660 673\n225 212\n967 987\n690 680\n804 813\n489 518\n240 221\n111 124",
"output": "34"
},
{
"input": "30\n89 3\n167 156\n784 849\n943 937\n144 95\n24 159\n80 120\n657 683\n585 596\n43 147\n909 964\n131 84\n345 389\n333 321\n91 126\n274 325\n859 723\n866 922\n622 595\n690 752\n902 944\n127 170\n426 383\n905 925\n172 284\n793 810\n414 510\n890 884\n123 24\n267 255",
"output": "29"
},
{
"input": "5\n664 666\n951 941\n739 742\n844 842\n2 2",
"output": "4"
},
{
"input": "3\n939 867\n411 427\n757 708",
"output": "2"
},
{
"input": "36\n429 424\n885 972\n442 386\n512 511\n751 759\n4 115\n461 497\n496 408\n8 23\n542 562\n296 331\n448 492\n412 395\n109 166\n622 640\n379 355\n251 262\n564 586\n66 115\n275 291\n666 611\n629 534\n510 567\n635 666\n738 803\n420 369\n92 17\n101 144\n141 92\n258 258\n184 235\n492 456\n311 210\n394 357\n531 512\n634 636",
"output": "34"
},
{
"input": "29\n462 519\n871 825\n127 335\n156 93\n576 612\n885 830\n634 779\n340 105\n744 795\n716 474\n93 139\n563 805\n137 276\n177 101\n333 14\n391 437\n873 588\n817 518\n460 597\n572 670\n140 303\n392 441\n273 120\n862 578\n670 639\n410 161\n544 577\n193 116\n252 195",
"output": "28"
},
{
"input": "23\n952 907\n345 356\n812 807\n344 328\n242 268\n254 280\n1000 990\n80 78\n424 396\n595 608\n755 813\n383 380\n55 56\n598 633\n203 211\n508 476\n600 593\n206 192\n855 882\n517 462\n967 994\n642 657\n493 488",
"output": "22"
},
{
"input": "10\n579 816\n806 590\n830 787\n120 278\n677 800\n16 67\n188 251\n559 560\n87 67\n104 235",
"output": "8"
},
{
"input": "23\n420 424\n280 303\n515 511\n956 948\n799 803\n441 455\n362 369\n299 289\n823 813\n982 967\n876 878\n185 157\n529 551\n964 989\n655 656\n1 21\n114 112\n45 56\n935 937\n1000 997\n934 942\n360 366\n648 621",
"output": "22"
},
{
"input": "23\n102 84\n562 608\n200 127\n952 999\n465 496\n322 367\n728 690\n143 147\n855 867\n861 866\n26 59\n300 273\n255 351\n192 246\n70 111\n365 277\n32 104\n298 319\n330 354\n241 141\n56 125\n315 298\n412 461",
"output": "22"
},
{
"input": "7\n429 506\n346 307\n99 171\n853 916\n322 263\n115 157\n906 924",
"output": "6"
},
{
"input": "3\n1 1\n2 1\n2 2",
"output": "0"
},
{
"input": "4\n1 1\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "5\n1 1\n1 2\n2 2\n3 1\n3 3",
"output": "0"
},
{
"input": "6\n1 1\n1 2\n2 2\n3 1\n3 2\n3 3",
"output": "0"
},
{
"input": "20\n1 1\n2 2\n3 3\n3 9\n4 4\n5 2\n5 5\n5 7\n5 8\n6 2\n6 6\n6 9\n7 7\n8 8\n9 4\n9 7\n9 9\n10 2\n10 9\n10 10",
"output": "1"
},
{
"input": "21\n1 1\n1 9\n2 1\n2 2\n2 5\n2 6\n2 9\n3 3\n3 8\n4 1\n4 4\n5 5\n5 8\n6 6\n7 7\n8 8\n9 9\n10 4\n10 10\n11 5\n11 11",
"output": "1"
},
{
"input": "22\n1 1\n1 3\n1 4\n1 8\n1 9\n1 11\n2 2\n3 3\n4 4\n4 5\n5 5\n6 6\n6 8\n7 7\n8 3\n8 4\n8 8\n9 9\n10 10\n11 4\n11 9\n11 11",
"output": "3"
},
{
"input": "50\n1 1\n2 2\n2 9\n3 3\n4 4\n4 9\n4 16\n4 24\n5 5\n6 6\n7 7\n8 8\n8 9\n8 20\n9 9\n10 10\n11 11\n12 12\n13 13\n14 7\n14 14\n14 16\n14 25\n15 4\n15 6\n15 15\n15 22\n16 6\n16 16\n17 17\n18 18\n19 6\n19 19\n20 20\n21 21\n22 6\n22 22\n23 23\n24 6\n24 7\n24 8\n24 9\n24 24\n25 1\n25 3\n25 5\n25 7\n25 23\n25 24\n25 25",
"output": "7"
},
{
"input": "55\n1 1\n1 14\n2 2\n2 19\n3 1\n3 3\n3 8\n3 14\n3 23\n4 1\n4 4\n5 5\n5 8\n5 15\n6 2\n6 3\n6 4\n6 6\n7 7\n8 8\n8 21\n9 9\n10 1\n10 10\n11 9\n11 11\n12 12\n13 13\n14 14\n15 15\n15 24\n16 5\n16 16\n17 5\n17 10\n17 17\n17 18\n17 22\n17 27\n18 18\n19 19\n20 20\n21 20\n21 21\n22 22\n23 23\n24 14\n24 24\n25 25\n26 8\n26 11\n26 26\n27 3\n27 27\n28 28",
"output": "5"
},
{
"input": "3\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "6\n4 4\n3 4\n5 4\n4 5\n4 3\n3 1",
"output": "0"
},
{
"input": "4\n1 1\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "3\n1 1\n2 2\n1 2",
"output": "0"
},
{
"input": "8\n1 3\n1 1\n4 1\n2 2\n2 5\n5 9\n5 1\n5 4",
"output": "1"
},
{
"input": "10\n1 1\n1 2\n1 3\n1 4\n5 5\n6 6\n7 7\n8 8\n9 9\n100 100",
"output": "6"
},
{
"input": "7\n1 1\n2 2\n3 3\n4 4\n1 2\n2 3\n3 4",
"output": "0"
},
{
"input": "6\n1 1\n2 1\n2 2\n2 4\n4 3\n2 3",
"output": "0"
},
{
"input": "4\n3 1\n2 1\n2 2\n1 2",
"output": "0"
},
{
"input": "6\n1 1\n2 2\n2 1\n2 4\n4 3\n2 3",
"output": "0"
},
{
"input": "3\n1 2\n1 3\n1 4",
"output": "0"
},
{
"input": "4\n1 1\n2 2\n1 2\n2 1",
"output": "0"
},
{
"input": "4\n1 3\n2 1\n3 2\n3 1",
"output": "1"
},
{
"input": "7\n1 1\n1 2\n2 2\n3 3\n3 4\n4 4\n1 4",
"output": "0"
},
{
"input": "21\n12 12\n13 12\n12 11\n13 13\n10 10\n11 10\n11 11\n501 500\n501 501\n503 502\n500 500\n503 503\n502 501\n502 502\n700 700\n702 702\n703 702\n701 701\n702 701\n703 703\n701 700",
"output": "2"
},
{
"input": "6\n1 11\n6 8\n11 10\n1 10\n11 11\n6 9",
"output": "1"
},
{
"input": "4\n1 1\n2 2\n3 2\n3 1",
"output": "0"
},
{
"input": "3\n1 2\n3 4\n3 2",
"output": "0"
},
{
"input": "3\n1 1\n1 2\n2 2",
"output": "0"
},
{
"input": "4\n5 5\n5 4\n6 3\n6 4",
"output": "0"
},
{
"input": "3\n1 1\n2 2\n2 1",
"output": "0"
}
] | 1,484,998,623
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 76
| 218
| 4,915,200
|
def read_input():
graph = []
n = int(input())
for _ in range(n):
line = input().strip().split()
graph.append((int(line[0]), int(line[1])))
return n, graph
def calculate(graph):
parent = {}
while len(parent) != len(graph):
for i in range(len(graph)):
if graph[i] not in parent:
parent[graph[i]] = None
dfs_visit(graph[i], graph, parent)
x = 0
for i in range(len(graph)):
if parent[graph[i]] is None:
x += 1
return x
def dfs_visit(k, graph, parent):
adj_list = [graph[i] for i in range(len(graph)) if graph[i] != k and (graph[i][0] - k[0])*(graph[i][1] - k[1]) == 0]
for h in adj_list:
if h not in parent:
parent[h] = k
dfs_visit(h, graph, parent)
if __name__ == "__main__":
n, graph = read_input()
print(calculate(graph) - 1)
|
Title: Ice Skating
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created.
We assume that Bajtek can only heap up snow drifts at integer coordinates.
Input Specification:
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift.
Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct.
Output Specification:
Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one.
Demo Input:
['2\n2 1\n1 2\n', '2\n2 1\n4 1\n']
Demo Output:
['1\n', '0\n']
Note:
none
|
```python
def read_input():
graph = []
n = int(input())
for _ in range(n):
line = input().strip().split()
graph.append((int(line[0]), int(line[1])))
return n, graph
def calculate(graph):
parent = {}
while len(parent) != len(graph):
for i in range(len(graph)):
if graph[i] not in parent:
parent[graph[i]] = None
dfs_visit(graph[i], graph, parent)
x = 0
for i in range(len(graph)):
if parent[graph[i]] is None:
x += 1
return x
def dfs_visit(k, graph, parent):
adj_list = [graph[i] for i in range(len(graph)) if graph[i] != k and (graph[i][0] - k[0])*(graph[i][1] - k[1]) == 0]
for h in adj_list:
if h not in parent:
parent[h] = k
dfs_visit(h, graph, parent)
if __name__ == "__main__":
n, graph = read_input()
print(calculate(graph) - 1)
```
| 3
|
|
78
|
D
|
Archer's Shot
|
PROGRAMMING
| 2,300
|
[
"binary search",
"geometry",
"math",
"two pointers"
] |
D. Archer's Shot
|
2
|
256
|
A breakthrough among computer games, "Civilization XIII", is striking in its scale and elaborate details. Let's take a closer look at one of them.
The playing area in the game is split into congruent cells that are regular hexagons. The side of each cell is equal to 1. Each unit occupies exactly one cell of the playing field. The field can be considered infinite.
Let's take a look at the battle unit called an "Archer". Each archer has a parameter "shot range". It's a positive integer that determines the radius of the circle in which the archer can hit a target. The center of the circle coincides with the center of the cell in which the archer stays. A cell is considered to be under the archer’s fire if and only if all points of this cell, including border points are located inside the circle or on its border.
The picture below shows the borders for shot ranges equal to 3, 4 and 5. The archer is depicted as *A*.
Find the number of cells that are under fire for some archer.
|
The first and only line of input contains a single positive integer *k* — the archer's shot range (1<=≤<=*k*<=≤<=106).
|
Print the single number, the number of cells that are under fire.
Please do not use the %lld specificator to read or write 64-bit integers in C++. It is preferred to use the cout stream (also you may use the %I64d specificator).
|
[
"3\n",
"4\n",
"5\n"
] |
[
"7",
"13",
"19"
] |
none
| 2,000
|
[
{
"input": "3",
"output": "7"
},
{
"input": "4",
"output": "13"
},
{
"input": "5",
"output": "19"
},
{
"input": "9",
"output": "85"
},
{
"input": "11",
"output": "121"
},
{
"input": "51",
"output": "3037"
},
{
"input": "101",
"output": "12109"
},
{
"input": "911",
"output": "1001425"
},
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "1"
},
{
"input": "8",
"output": "61"
},
{
"input": "6",
"output": "31"
},
{
"input": "7",
"output": "43"
},
{
"input": "10",
"output": "97"
},
{
"input": "13",
"output": "175"
},
{
"input": "43",
"output": "2137"
},
{
"input": "88",
"output": "9151"
},
{
"input": "217",
"output": "56425"
},
{
"input": "301",
"output": "108847"
},
{
"input": "403",
"output": "195457"
},
{
"input": "1034",
"output": "1290385"
},
{
"input": "1249",
"output": "1883353"
},
{
"input": "2749",
"output": "9131485"
},
{
"input": "5832",
"output": "41114119"
},
{
"input": "6486",
"output": "50854039"
},
{
"input": "6726",
"output": "54687523"
},
{
"input": "8910",
"output": "95975509"
},
{
"input": "9654",
"output": "112674937"
},
{
"input": "9991",
"output": "120678955"
},
{
"input": "10000",
"output": "120896557"
},
{
"input": "10264",
"output": "127364821"
},
{
"input": "21352",
"output": "551234029"
},
{
"input": "40094",
"output": "1943730367"
},
{
"input": "47248",
"output": "2699275123"
},
{
"input": "100000",
"output": "12091764163"
},
{
"input": "225481",
"output": "61477218007"
},
{
"input": "498598",
"output": "300605820001"
},
{
"input": "777777",
"output": "731487842995"
},
{
"input": "999811",
"output": "1208740231393"
},
{
"input": "999998",
"output": "1209192430093"
},
{
"input": "999999",
"output": "1209194850235"
},
{
"input": "1000000",
"output": "1209197264797"
}
] | 1,689,436,174
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 0
|
print("_RANDOM_GUESS_1689436174.6234658")# 1689436174.6234872
|
Title: Archer's Shot
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A breakthrough among computer games, "Civilization XIII", is striking in its scale and elaborate details. Let's take a closer look at one of them.
The playing area in the game is split into congruent cells that are regular hexagons. The side of each cell is equal to 1. Each unit occupies exactly one cell of the playing field. The field can be considered infinite.
Let's take a look at the battle unit called an "Archer". Each archer has a parameter "shot range". It's a positive integer that determines the radius of the circle in which the archer can hit a target. The center of the circle coincides with the center of the cell in which the archer stays. A cell is considered to be under the archer’s fire if and only if all points of this cell, including border points are located inside the circle or on its border.
The picture below shows the borders for shot ranges equal to 3, 4 and 5. The archer is depicted as *A*.
Find the number of cells that are under fire for some archer.
Input Specification:
The first and only line of input contains a single positive integer *k* — the archer's shot range (1<=≤<=*k*<=≤<=106).
Output Specification:
Print the single number, the number of cells that are under fire.
Please do not use the %lld specificator to read or write 64-bit integers in C++. It is preferred to use the cout stream (also you may use the %I64d specificator).
Demo Input:
['3\n', '4\n', '5\n']
Demo Output:
['7', '13', '19']
Note:
none
|
```python
print("_RANDOM_GUESS_1689436174.6234658")# 1689436174.6234872
```
| 0
|
295
|
A
|
Greg and Array
|
PROGRAMMING
| 1,400
|
[
"data structures",
"implementation"
] | null | null |
Greg has an array *a*<==<=*a*1,<=*a*2,<=...,<=*a**n* and *m* operations. Each operation looks as: *l**i*, *r**i*, *d**i*, (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). To apply operation *i* to the array means to increase all array elements with numbers *l**i*,<=*l**i*<=+<=1,<=...,<=*r**i* by value *d**i*.
Greg wrote down *k* queries on a piece of paper. Each query has the following form: *x**i*, *y**i*, (1<=≤<=*x**i*<=≤<=*y**i*<=≤<=*m*). That means that one should apply operations with numbers *x**i*,<=*x**i*<=+<=1,<=...,<=*y**i* to the array.
Now Greg is wondering, what the array *a* will be after all the queries are executed. Help Greg.
|
The first line contains integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=105). The second line contains *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=105) — the initial array.
Next *m* lines contain operations, the operation number *i* is written as three integers: *l**i*, *r**i*, *d**i*, (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*), (0<=≤<=*d**i*<=≤<=105).
Next *k* lines contain the queries, the query number *i* is written as two integers: *x**i*, *y**i*, (1<=≤<=*x**i*<=≤<=*y**i*<=≤<=*m*).
The numbers in the lines are separated by single spaces.
|
On a single line print *n* integers *a*1,<=*a*2,<=...,<=*a**n* — the array after executing all the queries. Separate the printed numbers by spaces.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams of the %I64d specifier.
|
[
"3 3 3\n1 2 3\n1 2 1\n1 3 2\n2 3 4\n1 2\n1 3\n2 3\n",
"1 1 1\n1\n1 1 1\n1 1\n",
"4 3 6\n1 2 3 4\n1 2 1\n2 3 2\n3 4 4\n1 2\n1 3\n2 3\n1 2\n1 3\n2 3\n"
] |
[
"9 18 17\n",
"2\n",
"5 18 31 20\n"
] |
none
| 500
|
[
{
"input": "3 3 3\n1 2 3\n1 2 1\n1 3 2\n2 3 4\n1 2\n1 3\n2 3",
"output": "9 18 17"
},
{
"input": "1 1 1\n1\n1 1 1\n1 1",
"output": "2"
},
{
"input": "4 3 6\n1 2 3 4\n1 2 1\n2 3 2\n3 4 4\n1 2\n1 3\n2 3\n1 2\n1 3\n2 3",
"output": "5 18 31 20"
},
{
"input": "1 1 1\n0\n1 1 0\n1 1",
"output": "0"
}
] | 1,604,517,041
| 2,147,483,647
|
PyPy 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
import sys
class Operation:
def __init__(self, left, right, value):
self.left = left
self.right = right
self.value = value
def main():
data = [line.rstrip().split() for line in sys.stdin.readlines()]
data = [[int(x) for x in row] for row in data]
num_elements = data[0][0]
num_ops = data[0][1]
num_queries = data[0][2]
l = []
r = []
d = []
elements = []
operations = []
for i in range(num_elements):
elements.append(data[1][i])
for i in range(num_ops):
left = data[i + 2][0]
right = data[i + 2][1]
value = data[i + 2][2]
l.append(left)
r.append(right)
d.append(value)
# operations.append(Operation(left=left, right=right, value=value)
inc = [0] * (num_queries + 2)
for i in range(num_queries):
x = data[i + num_ops + 2][0]
y = data[i + num_ops + 2][1]
inc[x - 1] = inc[x-1] + 1
inc[y] = inc[y] - 1
c = 0
dInA = [0] * 100001
for i in range(num_ops):
c += inc[i]
newValueD = c * d[i]
dInA[l[i]-1] += newValueD
dInA[r[i]] -= newValueD
c = 0
for i in range(num_elements):
c += dInA[i]
if (i):
print(" ")
print(str(c + elements[i])
main()
|
Title: Greg and Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greg has an array *a*<==<=*a*1,<=*a*2,<=...,<=*a**n* and *m* operations. Each operation looks as: *l**i*, *r**i*, *d**i*, (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). To apply operation *i* to the array means to increase all array elements with numbers *l**i*,<=*l**i*<=+<=1,<=...,<=*r**i* by value *d**i*.
Greg wrote down *k* queries on a piece of paper. Each query has the following form: *x**i*, *y**i*, (1<=≤<=*x**i*<=≤<=*y**i*<=≤<=*m*). That means that one should apply operations with numbers *x**i*,<=*x**i*<=+<=1,<=...,<=*y**i* to the array.
Now Greg is wondering, what the array *a* will be after all the queries are executed. Help Greg.
Input Specification:
The first line contains integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=105). The second line contains *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=105) — the initial array.
Next *m* lines contain operations, the operation number *i* is written as three integers: *l**i*, *r**i*, *d**i*, (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*), (0<=≤<=*d**i*<=≤<=105).
Next *k* lines contain the queries, the query number *i* is written as two integers: *x**i*, *y**i*, (1<=≤<=*x**i*<=≤<=*y**i*<=≤<=*m*).
The numbers in the lines are separated by single spaces.
Output Specification:
On a single line print *n* integers *a*1,<=*a*2,<=...,<=*a**n* — the array after executing all the queries. Separate the printed numbers by spaces.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams of the %I64d specifier.
Demo Input:
['3 3 3\n1 2 3\n1 2 1\n1 3 2\n2 3 4\n1 2\n1 3\n2 3\n', '1 1 1\n1\n1 1 1\n1 1\n', '4 3 6\n1 2 3 4\n1 2 1\n2 3 2\n3 4 4\n1 2\n1 3\n2 3\n1 2\n1 3\n2 3\n']
Demo Output:
['9 18 17\n', '2\n', '5 18 31 20\n']
Note:
none
|
```python
import sys
class Operation:
def __init__(self, left, right, value):
self.left = left
self.right = right
self.value = value
def main():
data = [line.rstrip().split() for line in sys.stdin.readlines()]
data = [[int(x) for x in row] for row in data]
num_elements = data[0][0]
num_ops = data[0][1]
num_queries = data[0][2]
l = []
r = []
d = []
elements = []
operations = []
for i in range(num_elements):
elements.append(data[1][i])
for i in range(num_ops):
left = data[i + 2][0]
right = data[i + 2][1]
value = data[i + 2][2]
l.append(left)
r.append(right)
d.append(value)
# operations.append(Operation(left=left, right=right, value=value)
inc = [0] * (num_queries + 2)
for i in range(num_queries):
x = data[i + num_ops + 2][0]
y = data[i + num_ops + 2][1]
inc[x - 1] = inc[x-1] + 1
inc[y] = inc[y] - 1
c = 0
dInA = [0] * 100001
for i in range(num_ops):
c += inc[i]
newValueD = c * d[i]
dInA[l[i]-1] += newValueD
dInA[r[i]] -= newValueD
c = 0
for i in range(num_elements):
c += dInA[i]
if (i):
print(" ")
print(str(c + elements[i])
main()
```
| -1
|
|
349
|
B
|
Color the Fence
|
PROGRAMMING
| 1,700
|
[
"data structures",
"dp",
"greedy",
"implementation"
] | null | null |
Igor has fallen in love with Tanya. Now Igor wants to show his feelings and write a number on the fence opposite to Tanya's house. Igor thinks that the larger the number is, the more chance to win Tanya's heart he has.
Unfortunately, Igor could only get *v* liters of paint. He did the math and concluded that digit *d* requires *a**d* liters of paint. Besides, Igor heard that Tanya doesn't like zeroes. That's why Igor won't use them in his number.
Help Igor find the maximum number he can write on the fence.
|
The first line contains a positive integer *v* (0<=≤<=*v*<=≤<=106). The second line contains nine positive integers *a*1,<=*a*2,<=...,<=*a*9 (1<=≤<=*a**i*<=≤<=105).
|
Print the maximum number Igor can write on the fence. If he has too little paint for any digit (so, he cannot write anything), print -1.
|
[
"5\n5 4 3 2 1 2 3 4 5\n",
"2\n9 11 1 12 5 8 9 10 6\n",
"0\n1 1 1 1 1 1 1 1 1\n"
] |
[
"55555\n",
"33\n",
"-1\n"
] |
none
| 1,000
|
[
{
"input": "5\n5 4 3 2 1 2 3 4 5",
"output": "55555"
},
{
"input": "2\n9 11 1 12 5 8 9 10 6",
"output": "33"
},
{
"input": "0\n1 1 1 1 1 1 1 1 1",
"output": "-1"
},
{
"input": "50\n5 3 10 2 2 4 3 6 5",
"output": "5555555555555555555555555"
},
{
"input": "22\n405 343 489 474 385 23 100 94 276",
"output": "-1"
},
{
"input": "62800\n867 936 2 888 474 530 287 822 220",
"output": "3333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333..."
},
{
"input": "27\n836 637 966 929 82 678 213 465 688",
"output": "-1"
},
{
"input": "1000000\n100000 100000 100000 100000 100000 100000 100000 100000 100000",
"output": "9999999999"
},
{
"input": "898207\n99745 99746 99748 99752 99760 99776 99808 99872 100000",
"output": "987654321"
},
{
"input": "80910\n64537 83748 97081 82722 12334 3056 9491 59130 28478",
"output": "66666666666666666666666666"
},
{
"input": "120081\n11268 36403 73200 12674 83919 74218 74172 91581 68432",
"output": "4444411111"
},
{
"input": "839851\n29926 55862 57907 51153 56350 86145 1909 22622 89861",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "751233\n69761 51826 91095 73642 98995 93262 377 38818 97480",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "306978\n95955 99204 81786 41258 96065 46946 64532 36297 70808",
"output": "88888888"
},
{
"input": "366313\n18486 12701 92334 95391 61480 14118 20465 69784 13592",
"output": "9999999999922222222222222222"
},
{
"input": "320671\n95788 46450 97582 95928 47742 15508 10466 10301 38822",
"output": "8888888888888888888888888888888"
},
{
"input": "913928\n80373 47589 53204 68236 44060 97485 82241 44149 59825",
"output": "99888888888888855555"
},
{
"input": "630384\n19652 11530 20316 3161 87360 64207 74067 77894 81452",
"output": "4444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444"
},
{
"input": "95\n22076 12056 63350 12443 43123 585 52908 18372 96799",
"output": "-1"
},
{
"input": "271380\n19135 80309 23783 48534 98990 37278 85258 67602 40288",
"output": "11111111111111"
},
{
"input": "80085\n56973 29725 30219 17439 53162 6051 41388 35555 39392",
"output": "6666666666666"
},
{
"input": "201332\n20008 22829 30296 1967 32154 67760 11437 90972 79865",
"output": "444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444"
},
{
"input": "3402\n64151 98148 81468 82342 48823 93464 5989 58868 77138",
"output": "-1"
},
{
"input": "432544\n95724 98294 23292 24174 57778 95072 81898 50019 86824",
"output": "444444444444444333"
},
{
"input": "1000000\n1 1 1 1 1 1 1 1 1",
"output": "9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999..."
},
{
"input": "1000000\n2 2 2 2 2 2 2 2 2",
"output": "9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999..."
},
{
"input": "1000000\n2 3 2 2 3 2 2 3 2",
"output": "9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999..."
},
{
"input": "999999\n2 3 2 2 3 2 2 3 3",
"output": "9777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "153\n85 91 28 53 29 30 92 36 89",
"output": "86653"
},
{
"input": "26531\n64 93 48 49 86 57 93 60 96",
"output": "8864433333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333..."
},
{
"input": "17186\n50 90 76 51 91 54 71 90 73",
"output": "9666411111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111"
},
{
"input": "11213\n51 82 49 50 99 52 69 96 85",
"output": "964433333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333"
},
{
"input": "20075\n57 42 99 45 56 80 76 71 63",
"output": "954422222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222"
},
{
"input": "21069\n31 19 49 30 28 43 21 25 28",
"output": "9872222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222..."
},
{
"input": "4822\n35 36 21 13 34 36 14 16 20",
"output": "9877444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444"
}
] | 1,609,095,890
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 248
| 0
|
n = int(input())
a= list(map(int, input().split()))
mini = 9999999
c = []
for i in range(len(a)):
if mini>a[i]:
mini = a[i]
c = []
if mini==a[i]:
c.append(i)
if mini<n:
b = max(c)
d = []
remaining = n-a[b]*(n//a[b])
s = ""
for i in range(n//a[b]):
flag = True
for j in range(8, b, -1):
if a[j]-a[b]<=remaining:
d.append(j+1)
remaining-=a[j]-a[b]
flag = False
break
if flag:
d.append(b+1)
print('.'.join(str(x) for x in d))
else:
print(-1)
|
Title: Color the Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Igor has fallen in love with Tanya. Now Igor wants to show his feelings and write a number on the fence opposite to Tanya's house. Igor thinks that the larger the number is, the more chance to win Tanya's heart he has.
Unfortunately, Igor could only get *v* liters of paint. He did the math and concluded that digit *d* requires *a**d* liters of paint. Besides, Igor heard that Tanya doesn't like zeroes. That's why Igor won't use them in his number.
Help Igor find the maximum number he can write on the fence.
Input Specification:
The first line contains a positive integer *v* (0<=≤<=*v*<=≤<=106). The second line contains nine positive integers *a*1,<=*a*2,<=...,<=*a*9 (1<=≤<=*a**i*<=≤<=105).
Output Specification:
Print the maximum number Igor can write on the fence. If he has too little paint for any digit (so, he cannot write anything), print -1.
Demo Input:
['5\n5 4 3 2 1 2 3 4 5\n', '2\n9 11 1 12 5 8 9 10 6\n', '0\n1 1 1 1 1 1 1 1 1\n']
Demo Output:
['55555\n', '33\n', '-1\n']
Note:
none
|
```python
n = int(input())
a= list(map(int, input().split()))
mini = 9999999
c = []
for i in range(len(a)):
if mini>a[i]:
mini = a[i]
c = []
if mini==a[i]:
c.append(i)
if mini<n:
b = max(c)
d = []
remaining = n-a[b]*(n//a[b])
s = ""
for i in range(n//a[b]):
flag = True
for j in range(8, b, -1):
if a[j]-a[b]<=remaining:
d.append(j+1)
remaining-=a[j]-a[b]
flag = False
break
if flag:
d.append(b+1)
print('.'.join(str(x) for x in d))
else:
print(-1)
```
| 0
|
|
698
|
A
|
Vacations
|
PROGRAMMING
| 1,400
|
[
"dp"
] | null | null |
Vasya has *n* days of vacations! So he decided to improve his IT skills and do sport. Vasya knows the following information about each of this *n* days: whether that gym opened and whether a contest was carried out in the Internet on that day. For the *i*-th day there are four options:
1. on this day the gym is closed and the contest is not carried out; 1. on this day the gym is closed and the contest is carried out; 1. on this day the gym is open and the contest is not carried out; 1. on this day the gym is open and the contest is carried out.
On each of days Vasya can either have a rest or write the contest (if it is carried out on this day), or do sport (if the gym is open on this day).
Find the minimum number of days on which Vasya will have a rest (it means, he will not do sport and write the contest at the same time). The only limitation that Vasya has — he does not want to do the same activity on two consecutive days: it means, he will not do sport on two consecutive days, and write the contest on two consecutive days.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of days of Vasya's vacations.
The second line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=3) separated by space, where:
- *a**i* equals 0, if on the *i*-th day of vacations the gym is closed and the contest is not carried out; - *a**i* equals 1, if on the *i*-th day of vacations the gym is closed, but the contest is carried out; - *a**i* equals 2, if on the *i*-th day of vacations the gym is open and the contest is not carried out; - *a**i* equals 3, if on the *i*-th day of vacations the gym is open and the contest is carried out.
|
Print the minimum possible number of days on which Vasya will have a rest. Remember that Vasya refuses:
- to do sport on any two consecutive days, - to write the contest on any two consecutive days.
|
[
"4\n1 3 2 0\n",
"7\n1 3 3 2 1 2 3\n",
"2\n2 2\n"
] |
[
"2\n",
"0\n",
"1\n"
] |
In the first test Vasya can write the contest on the day number 1 and do sport on the day number 3. Thus, he will have a rest for only 2 days.
In the second test Vasya should write contests on days number 1, 3, 5 and 7, in other days do sport. Thus, he will not have a rest for a single day.
In the third test Vasya can do sport either on a day number 1 or number 2. He can not do sport in two days, because it will be contrary to the his limitation. Thus, he will have a rest for only one day.
| 500
|
[
{
"input": "4\n1 3 2 0",
"output": "2"
},
{
"input": "7\n1 3 3 2 1 2 3",
"output": "0"
},
{
"input": "2\n2 2",
"output": "1"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "10\n0 0 1 1 0 0 0 0 1 0",
"output": "8"
},
{
"input": "100\n3 2 3 3 3 2 3 1 3 2 2 3 2 3 3 3 3 3 3 1 2 2 3 1 3 3 2 2 2 3 1 0 3 3 3 2 3 3 1 1 3 1 3 3 3 1 3 1 3 0 1 3 2 3 2 1 1 3 2 3 3 3 2 3 1 3 3 3 3 2 2 2 1 3 1 3 3 3 3 1 3 2 3 3 0 3 3 3 3 3 1 0 2 1 3 3 0 2 3 3",
"output": "16"
},
{
"input": "10\n2 3 0 1 3 1 2 2 1 0",
"output": "3"
},
{
"input": "45\n3 3 2 3 2 3 3 3 0 3 3 3 3 3 3 3 1 3 2 3 2 3 2 2 2 3 2 3 3 3 3 3 1 2 3 3 2 2 2 3 3 3 3 1 3",
"output": "6"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "1\n3",
"output": "0"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n1 3",
"output": "0"
},
{
"input": "2\n0 1",
"output": "1"
},
{
"input": "2\n0 0",
"output": "2"
},
{
"input": "2\n3 3",
"output": "0"
},
{
"input": "3\n3 3 3",
"output": "0"
},
{
"input": "2\n3 2",
"output": "0"
},
{
"input": "2\n0 2",
"output": "1"
},
{
"input": "10\n2 2 3 3 3 3 2 1 3 2",
"output": "2"
},
{
"input": "15\n0 1 0 0 0 2 0 1 0 0 0 2 0 0 0",
"output": "11"
},
{
"input": "15\n1 3 2 2 2 3 3 3 3 2 3 2 2 1 1",
"output": "4"
},
{
"input": "15\n3 1 3 2 3 2 2 2 3 3 3 3 2 3 2",
"output": "3"
},
{
"input": "20\n0 2 0 1 0 0 0 1 2 0 1 1 1 0 1 1 0 1 1 0",
"output": "12"
},
{
"input": "20\n2 3 2 3 3 3 3 2 0 3 1 1 2 3 0 3 2 3 0 3",
"output": "5"
},
{
"input": "20\n3 3 3 3 2 3 3 2 1 3 3 2 2 2 3 2 2 2 2 2",
"output": "4"
},
{
"input": "25\n0 0 1 0 0 1 0 0 1 0 0 1 0 2 0 0 2 0 0 1 0 2 0 1 1",
"output": "16"
},
{
"input": "25\n1 3 3 2 2 3 3 3 3 3 1 2 2 3 2 0 2 1 0 1 3 2 2 3 3",
"output": "5"
},
{
"input": "25\n2 3 1 3 3 2 1 3 3 3 1 3 3 1 3 2 3 3 1 3 3 3 2 3 3",
"output": "3"
},
{
"input": "30\n0 0 1 0 1 0 1 1 0 0 0 0 0 0 1 0 0 1 1 0 0 2 0 0 1 1 2 0 0 0",
"output": "22"
},
{
"input": "30\n1 1 3 2 2 0 3 2 3 3 1 2 0 1 1 2 3 3 2 3 1 3 2 3 0 2 0 3 3 2",
"output": "9"
},
{
"input": "30\n1 2 3 2 2 3 3 3 3 3 3 3 3 3 3 1 2 2 3 2 3 3 3 2 1 3 3 3 1 3",
"output": "2"
},
{
"input": "35\n0 1 1 0 0 2 0 0 1 0 0 0 1 0 1 0 1 0 0 0 1 2 1 0 2 2 1 0 1 0 1 1 1 0 0",
"output": "21"
},
{
"input": "35\n2 2 0 3 2 2 0 3 3 1 1 3 3 1 2 2 0 2 2 2 2 3 1 0 2 1 3 2 2 3 2 3 3 1 2",
"output": "11"
},
{
"input": "35\n1 2 2 3 3 3 3 3 2 2 3 3 2 3 3 2 3 2 3 3 2 2 2 3 3 2 3 3 3 1 3 3 2 2 2",
"output": "7"
},
{
"input": "40\n2 0 1 1 0 0 0 0 2 0 1 1 1 0 0 1 0 0 0 0 0 2 0 0 0 2 1 1 1 3 0 0 0 0 0 0 0 1 1 0",
"output": "28"
},
{
"input": "40\n2 2 3 2 0 2 3 2 1 2 3 0 2 3 2 1 1 3 1 1 0 2 3 1 3 3 1 1 3 3 2 2 1 3 3 3 2 3 3 1",
"output": "10"
},
{
"input": "40\n1 3 2 3 3 2 3 3 2 2 3 1 2 1 2 2 3 1 2 2 1 2 2 2 1 2 2 3 2 3 2 3 2 3 3 3 1 3 2 3",
"output": "8"
},
{
"input": "45\n2 1 0 0 0 2 1 0 1 0 0 2 2 1 1 0 0 2 0 0 0 0 0 0 1 0 0 2 0 0 1 1 0 0 1 0 0 1 1 2 0 0 2 0 2",
"output": "29"
},
{
"input": "45\n3 3 2 3 3 3 2 2 3 2 3 1 3 2 3 2 2 1 1 3 2 3 2 1 3 1 2 3 2 2 0 3 3 2 3 2 3 2 3 2 0 3 1 1 3",
"output": "8"
},
{
"input": "50\n3 0 0 0 2 0 0 0 0 0 0 0 2 1 0 2 0 1 0 1 3 0 2 1 1 0 0 1 1 0 0 1 2 1 1 2 1 1 0 0 0 0 0 0 0 1 2 2 0 0",
"output": "32"
},
{
"input": "50\n3 3 3 3 1 0 3 3 0 2 3 1 1 1 3 2 3 3 3 3 3 1 0 1 2 2 3 3 2 3 0 0 0 2 1 0 1 2 2 2 2 0 2 2 2 1 2 3 3 2",
"output": "16"
},
{
"input": "50\n3 2 3 1 2 1 2 3 3 2 3 3 2 1 3 3 3 3 3 3 2 3 2 3 2 2 3 3 3 2 3 3 3 3 2 3 1 2 3 3 2 3 3 1 2 2 1 1 3 3",
"output": "7"
},
{
"input": "55\n0 0 1 1 0 1 0 0 1 0 1 0 0 0 2 0 0 1 0 0 0 1 0 0 0 0 3 1 0 0 0 1 0 0 0 0 2 0 0 0 2 0 2 1 0 0 0 0 0 0 0 0 2 0 0",
"output": "40"
},
{
"input": "55\n3 0 3 3 3 2 0 2 3 0 3 2 3 3 0 3 3 1 3 3 1 2 3 2 0 3 3 2 1 2 3 2 3 0 3 2 2 1 2 3 2 2 1 3 2 2 3 1 3 2 2 3 3 2 2",
"output": "13"
},
{
"input": "55\n3 3 1 3 2 3 2 3 2 2 3 3 3 3 3 1 1 3 3 2 3 2 3 2 0 1 3 3 3 3 2 3 2 3 1 1 2 2 2 3 3 3 3 3 2 2 2 3 2 3 3 3 3 1 3",
"output": "7"
},
{
"input": "60\n0 1 0 0 0 0 0 0 0 2 1 1 3 0 0 0 0 0 1 0 1 1 0 0 0 3 0 1 0 1 0 2 0 0 0 0 0 1 0 0 0 0 1 1 0 1 0 0 0 0 0 1 0 0 1 0 1 0 0 0",
"output": "44"
},
{
"input": "60\n3 2 1 3 2 2 3 3 3 1 1 3 2 2 3 3 1 3 2 2 3 3 2 2 2 2 0 2 2 3 2 3 0 3 3 3 2 3 3 0 1 3 2 1 3 1 1 2 1 3 1 1 2 2 1 3 3 3 2 2",
"output": "15"
},
{
"input": "60\n3 2 2 3 2 3 2 3 3 2 3 2 3 3 2 3 3 3 3 3 3 2 3 3 1 2 3 3 3 2 1 3 3 1 3 1 3 0 3 3 3 2 3 2 3 2 3 3 1 1 2 3 3 3 3 2 1 3 2 3",
"output": "8"
},
{
"input": "65\n1 0 2 1 1 0 1 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 0 1 2 0 2 1 0 2 1 0 1 0 1 1 0 1 1 1 2 1 0 1 0 0 0 0 1 2 2 1 0 0 1 2 1 2 0 2 0 0 0 1 1",
"output": "35"
},
{
"input": "65\n2 2 2 3 0 2 1 2 3 3 1 3 1 2 1 3 2 3 2 2 2 1 2 0 3 1 3 1 1 3 1 3 3 3 3 3 1 3 0 3 1 3 1 2 2 3 2 0 3 1 3 2 1 2 2 2 3 3 2 3 3 3 2 2 3",
"output": "13"
},
{
"input": "65\n3 2 3 3 3 2 3 2 3 3 3 3 3 3 3 3 3 2 3 2 3 2 2 3 3 3 3 3 2 2 2 3 3 2 3 3 2 3 3 3 3 2 3 3 3 2 2 3 3 3 3 3 3 2 2 3 3 2 3 3 1 3 3 3 3",
"output": "6"
},
{
"input": "70\n1 0 0 0 1 0 1 0 0 0 1 1 0 1 0 0 1 1 1 0 1 1 0 0 1 1 1 3 1 1 0 1 2 0 2 1 0 0 0 1 1 1 1 1 0 0 1 0 0 0 1 1 1 3 0 0 1 0 0 0 1 0 0 0 0 0 1 0 1 1",
"output": "43"
},
{
"input": "70\n2 3 3 3 1 3 3 1 2 1 1 2 2 3 0 2 3 3 1 3 3 2 2 3 3 3 2 2 2 2 1 3 3 0 2 1 1 3 2 3 3 2 2 3 1 3 1 2 3 2 3 3 2 2 2 3 1 1 2 1 3 3 2 2 3 3 3 1 1 1",
"output": "16"
},
{
"input": "70\n3 3 2 2 1 2 1 2 2 2 2 2 3 3 2 3 3 3 3 2 2 2 2 3 3 3 1 3 3 3 2 3 3 3 3 2 3 3 1 3 1 3 2 3 3 2 3 3 3 2 3 2 3 3 1 2 3 3 2 2 2 3 2 3 3 3 3 3 3 1",
"output": "10"
},
{
"input": "75\n1 0 0 1 1 0 0 1 0 1 2 0 0 2 1 1 0 0 0 0 0 0 2 1 1 0 0 0 0 1 0 1 0 1 1 1 0 1 0 0 1 0 0 0 0 0 0 1 1 0 0 1 2 1 0 0 0 0 0 0 0 1 0 0 0 1 0 0 0 1 1 1 0 1 0",
"output": "51"
},
{
"input": "75\n1 3 3 3 1 1 3 2 3 3 1 3 3 3 2 1 3 2 2 3 1 1 1 1 1 1 2 3 3 3 3 3 3 2 3 3 3 3 3 2 3 3 2 2 2 1 2 3 3 2 2 3 0 1 1 3 3 0 0 1 1 3 2 3 3 3 3 1 2 2 3 3 3 3 1",
"output": "16"
},
{
"input": "75\n3 3 3 3 2 2 3 2 2 3 2 2 1 2 3 3 2 2 3 3 1 2 2 2 1 3 3 3 1 2 2 3 3 3 2 3 2 2 2 3 3 1 3 2 2 3 3 3 0 3 2 1 3 3 2 3 3 3 3 1 2 3 3 3 2 2 3 3 3 3 2 2 3 3 1",
"output": "11"
},
{
"input": "80\n0 0 0 0 2 0 1 1 1 1 1 0 0 0 0 2 0 0 1 0 0 0 0 1 1 0 2 2 1 1 0 1 0 1 0 1 1 1 0 1 2 1 1 0 0 0 1 1 0 1 1 0 1 0 0 1 0 0 1 0 0 0 0 0 0 0 2 2 0 1 1 0 0 0 0 0 0 0 0 1",
"output": "56"
},
{
"input": "80\n2 2 3 3 2 1 0 1 0 3 2 2 3 2 1 3 1 3 3 2 3 3 3 2 3 3 3 2 1 3 3 1 3 3 3 3 3 3 2 2 2 1 3 2 1 3 2 1 1 0 1 1 2 1 3 0 1 2 3 2 2 3 2 3 1 3 3 2 1 1 0 3 3 3 3 1 2 1 2 0",
"output": "17"
},
{
"input": "80\n2 3 3 2 2 2 3 3 2 3 3 3 3 3 2 3 2 3 2 3 3 3 3 3 3 3 3 3 2 3 1 3 2 3 3 0 3 1 2 3 3 1 2 3 2 3 3 2 3 3 3 3 3 2 2 3 0 3 3 3 3 3 2 2 3 2 3 3 3 3 3 2 3 2 3 3 3 3 2 3",
"output": "9"
},
{
"input": "85\n0 1 1 0 0 0 0 0 0 1 0 0 0 1 0 0 0 0 2 0 1 0 0 2 0 1 1 0 0 0 0 2 2 0 0 0 1 0 0 0 1 2 0 1 0 0 0 2 1 1 2 0 3 1 0 2 2 1 0 0 1 1 0 0 0 0 1 0 2 1 1 2 1 0 0 1 2 1 2 0 0 1 0 1 0",
"output": "54"
},
{
"input": "85\n2 3 1 3 2 3 1 3 3 2 1 2 1 2 2 3 2 2 3 2 0 3 3 2 1 2 2 2 3 3 2 3 3 3 2 1 1 3 1 3 2 2 2 3 3 2 3 2 3 1 1 3 2 3 1 3 3 2 3 3 2 2 3 0 1 1 2 2 2 2 1 2 3 1 3 3 1 3 2 2 3 2 3 3 3",
"output": "19"
},
{
"input": "85\n1 2 1 2 3 2 3 3 3 3 3 3 3 2 1 3 2 3 3 3 3 2 3 3 3 1 3 3 3 3 2 3 3 3 3 3 3 2 2 1 3 3 3 3 2 2 3 1 1 2 3 3 3 2 3 3 3 3 3 2 3 3 3 2 2 3 3 1 1 1 3 3 3 3 1 3 3 3 1 3 3 1 3 2 3",
"output": "9"
},
{
"input": "90\n2 0 1 0 0 0 0 0 0 1 1 2 0 0 0 0 0 0 0 2 2 0 2 0 0 2 1 0 2 0 1 0 1 0 0 1 2 2 0 0 1 0 0 1 0 1 0 2 0 1 1 1 0 1 1 0 1 0 2 0 1 0 1 0 0 0 1 0 0 1 2 0 0 0 1 0 0 2 2 0 0 0 0 0 1 3 1 1 0 1",
"output": "57"
},
{
"input": "90\n2 3 3 3 2 3 2 1 3 0 3 2 3 3 2 1 3 3 2 3 2 3 3 2 1 3 1 3 3 1 2 2 3 3 2 1 2 3 2 3 0 3 3 2 2 3 1 0 3 3 1 3 3 3 3 2 1 2 2 1 3 2 1 3 3 1 2 0 2 2 3 2 2 3 3 3 1 3 2 1 2 3 3 2 3 2 3 3 2 1",
"output": "17"
},
{
"input": "90\n2 3 2 3 2 2 3 3 2 3 2 1 2 3 3 3 2 3 2 3 3 2 3 3 3 1 3 3 1 3 2 3 2 2 1 3 3 3 3 3 3 3 3 3 3 2 3 2 3 2 1 3 3 3 3 2 2 3 3 3 3 3 3 3 3 3 3 3 3 2 2 3 3 3 3 1 3 2 3 3 3 2 2 3 2 3 2 1 3 2",
"output": "9"
},
{
"input": "95\n0 0 3 0 2 0 1 0 0 2 0 0 0 0 0 0 0 1 0 0 0 2 0 0 0 0 0 1 0 0 2 1 0 0 1 0 0 0 1 0 0 0 0 1 0 1 0 0 1 0 1 2 0 1 2 2 0 0 1 0 2 0 0 0 1 0 2 1 2 1 0 1 0 0 0 1 0 0 1 1 2 1 1 1 1 2 0 0 0 0 0 1 1 0 1",
"output": "61"
},
{
"input": "95\n2 3 3 2 1 1 3 3 3 2 3 3 3 2 3 2 3 3 3 2 3 2 2 3 3 2 1 2 3 3 3 1 3 0 3 3 1 3 3 1 0 1 3 3 3 0 2 1 3 3 3 3 0 1 3 2 3 3 2 1 3 1 2 1 1 2 3 0 3 3 2 1 3 2 1 3 3 3 2 2 3 2 3 3 3 2 1 3 3 3 2 3 3 1 2",
"output": "15"
},
{
"input": "95\n2 3 3 2 3 2 2 1 3 1 2 1 2 3 1 2 3 3 1 3 3 3 1 2 3 2 2 2 2 3 3 3 2 2 3 3 3 3 3 1 2 2 3 3 3 3 2 3 2 2 2 3 3 2 3 3 3 3 3 3 3 0 3 2 0 3 3 1 3 3 3 2 3 2 3 2 3 3 3 3 2 2 1 1 3 3 3 3 3 1 3 3 3 3 2",
"output": "14"
},
{
"input": "100\n1 0 2 0 0 0 0 2 0 0 0 1 0 1 0 0 1 0 1 2 0 1 1 0 0 1 0 1 1 0 0 0 2 0 1 0 0 2 0 0 0 0 0 1 1 1 0 0 1 0 2 0 0 0 0 1 0 1 0 1 0 1 0 1 2 2 0 0 2 0 1 0 1 0 1 0 0 0 1 0 0 2 1 1 1 0 0 1 0 0 0 2 0 0 2 1 1 0 0 2",
"output": "63"
},
{
"input": "100\n3 2 1 3 2 3 2 3 2 2 3 1 3 3 3 3 3 2 2 3 2 2 3 2 3 3 3 2 3 1 2 1 3 3 3 3 1 3 3 3 3 3 2 3 2 1 3 3 1 2 2 3 1 3 3 1 2 2 1 3 1 3 2 2 3 3 1 3 2 3 1 2 1 2 3 3 2 2 1 2 3 3 3 3 3 1 3 3 3 3 2 1 3 0 3 3 3 2 3 3",
"output": "15"
},
{
"input": "100\n1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2",
"output": "0"
},
{
"input": "100\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "0"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "50"
},
{
"input": "100\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "50"
},
{
"input": "99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "49"
},
{
"input": "100\n2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1",
"output": "0"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "100"
},
{
"input": "2\n0 3",
"output": "1"
},
{
"input": "2\n1 0",
"output": "1"
},
{
"input": "2\n1 2",
"output": "0"
},
{
"input": "2\n2 0",
"output": "1"
},
{
"input": "2\n2 1",
"output": "0"
},
{
"input": "2\n2 3",
"output": "0"
},
{
"input": "2\n3 0",
"output": "1"
},
{
"input": "2\n3 1",
"output": "0"
},
{
"input": "100\n3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0",
"output": "50"
}
] | 1,607,440,739
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 5
| 124
| 0
|
n=int(input())
l=list(map(int,input().split()))
dp=[0 for _ in range(n+1)]
for i in range(1,n+1):
if l[i-1]==0:
dp[i]=0
elif l[i-1]==1:
if dp[i-1]!=1:
dp[i]=1
else:
dp[i]=0
elif l[i-1]==2:
if dp[i-1]!=2:
dp[i]=2
else:
dp[i]=0
else:
if dp[i-1]==1:
dp[i]=2
elif dp[i-1]==2:
dp[i]=1
else:
j=i-1
while(l[j]==3):
j+=1
if l[j]==2 and (j-(i-1))%2==0:
dp[i]=2
else:
dp[i]=1
#print(dp)
c=0
for i in range(len(dp)):
if dp[i]==0:
c+=1
print(c-1)
|
Title: Vacations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has *n* days of vacations! So he decided to improve his IT skills and do sport. Vasya knows the following information about each of this *n* days: whether that gym opened and whether a contest was carried out in the Internet on that day. For the *i*-th day there are four options:
1. on this day the gym is closed and the contest is not carried out; 1. on this day the gym is closed and the contest is carried out; 1. on this day the gym is open and the contest is not carried out; 1. on this day the gym is open and the contest is carried out.
On each of days Vasya can either have a rest or write the contest (if it is carried out on this day), or do sport (if the gym is open on this day).
Find the minimum number of days on which Vasya will have a rest (it means, he will not do sport and write the contest at the same time). The only limitation that Vasya has — he does not want to do the same activity on two consecutive days: it means, he will not do sport on two consecutive days, and write the contest on two consecutive days.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of days of Vasya's vacations.
The second line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=3) separated by space, where:
- *a**i* equals 0, if on the *i*-th day of vacations the gym is closed and the contest is not carried out; - *a**i* equals 1, if on the *i*-th day of vacations the gym is closed, but the contest is carried out; - *a**i* equals 2, if on the *i*-th day of vacations the gym is open and the contest is not carried out; - *a**i* equals 3, if on the *i*-th day of vacations the gym is open and the contest is carried out.
Output Specification:
Print the minimum possible number of days on which Vasya will have a rest. Remember that Vasya refuses:
- to do sport on any two consecutive days, - to write the contest on any two consecutive days.
Demo Input:
['4\n1 3 2 0\n', '7\n1 3 3 2 1 2 3\n', '2\n2 2\n']
Demo Output:
['2\n', '0\n', '1\n']
Note:
In the first test Vasya can write the contest on the day number 1 and do sport on the day number 3. Thus, he will have a rest for only 2 days.
In the second test Vasya should write contests on days number 1, 3, 5 and 7, in other days do sport. Thus, he will not have a rest for a single day.
In the third test Vasya can do sport either on a day number 1 or number 2. He can not do sport in two days, because it will be contrary to the his limitation. Thus, he will have a rest for only one day.
|
```python
n=int(input())
l=list(map(int,input().split()))
dp=[0 for _ in range(n+1)]
for i in range(1,n+1):
if l[i-1]==0:
dp[i]=0
elif l[i-1]==1:
if dp[i-1]!=1:
dp[i]=1
else:
dp[i]=0
elif l[i-1]==2:
if dp[i-1]!=2:
dp[i]=2
else:
dp[i]=0
else:
if dp[i-1]==1:
dp[i]=2
elif dp[i-1]==2:
dp[i]=1
else:
j=i-1
while(l[j]==3):
j+=1
if l[j]==2 and (j-(i-1))%2==0:
dp[i]=2
else:
dp[i]=1
#print(dp)
c=0
for i in range(len(dp)):
if dp[i]==0:
c+=1
print(c-1)
```
| 0
|
|
899
|
B
|
Months and Years
|
PROGRAMMING
| 1,200
|
[
"implementation"
] | null | null |
Everybody in Russia uses Gregorian calendar. In this calendar there are 31 days in January, 28 or 29 days in February (depending on whether the year is leap or not), 31 days in March, 30 days in April, 31 days in May, 30 in June, 31 in July, 31 in August, 30 in September, 31 in October, 30 in November, 31 in December.
A year is leap in one of two cases: either its number is divisible by 4, but not divisible by 100, or is divisible by 400. For example, the following years are leap: 2000, 2004, but years 1900 and 2018 are not leap.
In this problem you are given *n* (1<=≤<=*n*<=≤<=24) integers *a*1,<=*a*2,<=...,<=*a**n*, and you have to check if these integers could be durations in days of *n* consecutive months, according to Gregorian calendar. Note that these months could belong to several consecutive years. In other words, check if there is a month in some year, such that its duration is *a*1 days, duration of the next month is *a*2 days, and so on.
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=24) — the number of integers.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (28<=≤<=*a**i*<=≤<=31) — the numbers you are to check.
|
If there are several consecutive months that fit the sequence, print "YES" (without quotes). Otherwise, print "NO" (without quotes).
You can print each letter in arbitrary case (small or large).
|
[
"4\n31 31 30 31\n",
"2\n30 30\n",
"5\n29 31 30 31 30\n",
"3\n31 28 30\n",
"3\n31 31 28\n"
] |
[
"Yes\n\n",
"No\n\n",
"Yes\n\n",
"No\n\n",
"Yes\n\n"
] |
In the first example the integers can denote months July, August, September and October.
In the second example the answer is no, because there are no two consecutive months each having 30 days.
In the third example the months are: February (leap year) — March — April – May — June.
In the fourth example the number of days in the second month is 28, so this is February. March follows February and has 31 days, but not 30, so the answer is NO.
In the fifth example the months are: December — January — February (non-leap year).
| 1,000
|
[
{
"input": "4\n31 31 30 31",
"output": "Yes"
},
{
"input": "2\n30 30",
"output": "No"
},
{
"input": "5\n29 31 30 31 30",
"output": "Yes"
},
{
"input": "3\n31 28 30",
"output": "No"
},
{
"input": "3\n31 31 28",
"output": "Yes"
},
{
"input": "24\n29 28 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "4\n31 29 31 30",
"output": "Yes"
},
{
"input": "24\n31 28 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "8\n31 29 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "1\n29",
"output": "Yes"
},
{
"input": "8\n31 29 31 30 31 31 31 31",
"output": "No"
},
{
"input": "1\n31",
"output": "Yes"
},
{
"input": "11\n30 31 30 31 31 30 31 30 31 31 28",
"output": "Yes"
},
{
"input": "21\n30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31",
"output": "Yes"
},
{
"input": "4\n31 28 28 30",
"output": "No"
},
{
"input": "2\n30 31",
"output": "Yes"
},
{
"input": "7\n28 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "4\n28 31 30 31",
"output": "Yes"
},
{
"input": "17\n28 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "9\n31 31 29 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "4\n31 28 31 30",
"output": "Yes"
},
{
"input": "21\n30 31 30 31 31 28 31 30 31 30 31 29 30 31 30 31 31 28 31 30 31",
"output": "No"
},
{
"input": "2\n31 31",
"output": "Yes"
},
{
"input": "17\n31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "4\n30 31 30 31",
"output": "Yes"
},
{
"input": "12\n31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "12\n31 29 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "11\n30 31 30 31 31 30 31 30 31 29 28",
"output": "No"
},
{
"input": "22\n31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "14\n31 30 31 31 28 31 30 31 30 31 31 30 31 30",
"output": "Yes"
},
{
"input": "12\n31 30 31 31 28 31 30 31 30 31 31 30",
"output": "Yes"
},
{
"input": "4\n31 29 29 30",
"output": "No"
},
{
"input": "7\n28 28 30 31 30 31 31",
"output": "No"
},
{
"input": "9\n29 31 29 31 30 31 30 31 31",
"output": "No"
},
{
"input": "17\n31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "2\n31 29",
"output": "Yes"
},
{
"input": "12\n31 28 31 30 31 30 31 31 30 31 28 31",
"output": "No"
},
{
"input": "2\n29 31",
"output": "Yes"
},
{
"input": "12\n31 29 31 30 31 30 31 30 30 31 30 31",
"output": "No"
},
{
"input": "12\n31 28 31 30 31 29 31 31 30 31 30 31",
"output": "No"
},
{
"input": "22\n31 30 31 30 31 31 30 31 30 31 31 28 31 30 28 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "14\n31 30 31 31 28 31 30 31 30 31 31 30 29 30",
"output": "No"
},
{
"input": "19\n31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31",
"output": "Yes"
},
{
"input": "20\n31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "1\n28",
"output": "Yes"
},
{
"input": "1\n29",
"output": "Yes"
},
{
"input": "17\n31 30 31 30 31 31 29 31 30 31 31 31 31 30 31 30 31",
"output": "No"
},
{
"input": "1\n30",
"output": "Yes"
},
{
"input": "1\n31",
"output": "Yes"
},
{
"input": "24\n31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "24\n28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "12\n31 30 31 31 28 28 30 31 30 31 31 30",
"output": "No"
},
{
"input": "24\n29 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "24\n28 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "24\n31 29 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "13\n28 31 30 31 30 31 31 30 31 30 31 31 28",
"output": "Yes"
},
{
"input": "15\n31 31 28 31 30 31 30 31 31 30 31 30 31 31 29",
"output": "Yes"
},
{
"input": "23\n31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31 29 31",
"output": "Yes"
},
{
"input": "24\n31 30 31 30 31 31 30 31 30 31 31 30 31 30 31 30 31 31 30 31 30 31 31 30",
"output": "No"
},
{
"input": "23\n29 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "15\n31 31 29 31 30 31 30 31 31 30 31 30 31 31 28",
"output": "Yes"
},
{
"input": "12\n31 30 31 30 31 30 31 31 30 31 30 31",
"output": "No"
}
] | 1,514,950,235
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 7
| 61
| 5,529,600
|
not_leap = '312831303130313130313031'*3
leap = '312931303130313130313031'*3
n = int(input())
y = ''.join(input().split())
print('YES') if y in not_leap or y in leap else print ('NO')
|
Title: Months and Years
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Everybody in Russia uses Gregorian calendar. In this calendar there are 31 days in January, 28 or 29 days in February (depending on whether the year is leap or not), 31 days in March, 30 days in April, 31 days in May, 30 in June, 31 in July, 31 in August, 30 in September, 31 in October, 30 in November, 31 in December.
A year is leap in one of two cases: either its number is divisible by 4, but not divisible by 100, or is divisible by 400. For example, the following years are leap: 2000, 2004, but years 1900 and 2018 are not leap.
In this problem you are given *n* (1<=≤<=*n*<=≤<=24) integers *a*1,<=*a*2,<=...,<=*a**n*, and you have to check if these integers could be durations in days of *n* consecutive months, according to Gregorian calendar. Note that these months could belong to several consecutive years. In other words, check if there is a month in some year, such that its duration is *a*1 days, duration of the next month is *a*2 days, and so on.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=24) — the number of integers.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (28<=≤<=*a**i*<=≤<=31) — the numbers you are to check.
Output Specification:
If there are several consecutive months that fit the sequence, print "YES" (without quotes). Otherwise, print "NO" (without quotes).
You can print each letter in arbitrary case (small or large).
Demo Input:
['4\n31 31 30 31\n', '2\n30 30\n', '5\n29 31 30 31 30\n', '3\n31 28 30\n', '3\n31 31 28\n']
Demo Output:
['Yes\n\n', 'No\n\n', 'Yes\n\n', 'No\n\n', 'Yes\n\n']
Note:
In the first example the integers can denote months July, August, September and October.
In the second example the answer is no, because there are no two consecutive months each having 30 days.
In the third example the months are: February (leap year) — March — April – May — June.
In the fourth example the number of days in the second month is 28, so this is February. March follows February and has 31 days, but not 30, so the answer is NO.
In the fifth example the months are: December — January — February (non-leap year).
|
```python
not_leap = '312831303130313130313031'*3
leap = '312931303130313130313031'*3
n = int(input())
y = ''.join(input().split())
print('YES') if y in not_leap or y in leap else print ('NO')
```
| 0
|
|
181
|
B
|
Number of Triplets
|
PROGRAMMING
| 1,300
|
[
"binary search",
"brute force"
] | null | null |
You are given *n* points on a plane. All points are different.
Find the number of different groups of three points (*A*,<=*B*,<=*C*) such that point *B* is the middle of segment *AC*.
The groups of three points are considered unordered, that is, if point *B* is the middle of segment *AC*, then groups (*A*,<=*B*,<=*C*) and (*C*,<=*B*,<=*A*) are considered the same.
|
The first line contains a single integer *n* (3<=≤<=*n*<=≤<=3000) — the number of points.
Next *n* lines contain the points. The *i*-th line contains coordinates of the *i*-th point: two space-separated integers *x**i*,<=*y**i* (<=-<=1000<=≤<=*x**i*,<=*y**i*<=≤<=1000).
It is guaranteed that all given points are different.
|
Print the single number — the answer to the problem.
|
[
"3\n1 1\n2 2\n3 3\n",
"3\n0 0\n-1 0\n0 1\n"
] |
[
"1\n",
"0\n"
] |
none
| 1,000
|
[
{
"input": "3\n1 1\n2 2\n3 3",
"output": "1"
},
{
"input": "3\n0 0\n-1 0\n0 1",
"output": "0"
},
{
"input": "4\n0 0\n1 0\n2 0\n3 0",
"output": "2"
},
{
"input": "5\n0 -1\n0 -2\n0 -3\n0 -4\n0 -5",
"output": "4"
},
{
"input": "7\n1 1\n-1 -1\n1 0\n0 1\n-1 0\n0 -1\n0 0",
"output": "3"
},
{
"input": "9\n1 1\n1 0\n0 1\n0 0\n-1 0\n-1 1\n-1 -1\n1 -1\n0 -1",
"output": "8"
},
{
"input": "10\n2 1\n-1 0\n-2 -1\n-1 1\n0 2\n2 -2\n0 0\n-2 -2\n0 -2\n-2 1",
"output": "4"
},
{
"input": "10\n-2 1\n2 -2\n-1 -2\n0 0\n2 -1\n0 -2\n2 2\n0 2\n-1 -1\n1 -2",
"output": "4"
},
{
"input": "10\n0 1\n-1 -1\n1 1\n-1 0\n1 -1\n-2 -1\n-2 2\n-2 0\n0 -2\n0 -1",
"output": "5"
},
{
"input": "10\n2 1\n-1 1\n0 0\n-3 1\n-2 -3\n-1 -2\n-1 -1\n1 2\n3 -2\n0 -2",
"output": "1"
},
{
"input": "20\n-3 -3\n0 4\n-3 1\n1 1\n-1 2\n-4 4\n3 -1\n-3 0\n0 2\n4 0\n2 3\n2 4\n4 -3\n-4 3\n-1 1\n1 3\n-2 4\n1 -2\n1 -1\n3 0",
"output": "10"
},
{
"input": "20\n-3 -3\n0 4\n-3 1\n1 1\n-1 2\n-4 4\n3 -1\n-3 0\n0 2\n4 0\n2 3\n2 4\n4 -3\n-4 3\n-1 1\n1 3\n-2 4\n1 -2\n1 -1\n3 0",
"output": "10"
},
{
"input": "20\n-1 18\n-2 5\n-5 4\n2 -33\n9 -18\n0 0\n11 -22\n2 0\n-1 2\n-4 41\n1 6\n1 -2\n6 -12\n0 1\n-3 6\n3 -6\n3 -8\n-1 4\n2 -5\n1 0",
"output": "21"
},
{
"input": "40\n-8 24\n2 -1\n1 -18\n72 -70\n5 -4\n-308 436\n-19 40\n36 -35\n-178 265\n-1 2\n-7 30\n-1 0\n3 -2\n200 -285\n17 -16\n-35 74\n0 -4\n-86 106\n-1 4\n-7 6\n0 1\n-5 4\n-2 3\n6 -5\n-4 5\n181 -262\n76 -118\n0 0\n-7 18\n-58 104\n-5 6\n-6 12\n-3 4\n1 0\n11 -10\n-86 130\n-3 6\n153 -236\n-183 270\n-33 64",
"output": "57"
},
{
"input": "3\n3 3\n1 2\n1 1",
"output": "0"
},
{
"input": "3\n0 0\n0 -1\n0 1",
"output": "1"
}
] | 1,698,875,015
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 6
| 2,000
| 102,400
|
def milieu(l):
milieu = 0
for i in range(len(l)):
for j in range(i + 1, len(l)):
mx = (l[i][0] + l[j][0]) / 2
my = (l[i][1] + l[j][1]) / 2
if (mx, my) in l:
milieu += 1
print(milieu)
s =int(input())
l =[]
for i in range (s) :
x,y = list(map(int,input().split()))
l.append((x,y))
milieu(l)
|
Title: Number of Triplets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given *n* points on a plane. All points are different.
Find the number of different groups of three points (*A*,<=*B*,<=*C*) such that point *B* is the middle of segment *AC*.
The groups of three points are considered unordered, that is, if point *B* is the middle of segment *AC*, then groups (*A*,<=*B*,<=*C*) and (*C*,<=*B*,<=*A*) are considered the same.
Input Specification:
The first line contains a single integer *n* (3<=≤<=*n*<=≤<=3000) — the number of points.
Next *n* lines contain the points. The *i*-th line contains coordinates of the *i*-th point: two space-separated integers *x**i*,<=*y**i* (<=-<=1000<=≤<=*x**i*,<=*y**i*<=≤<=1000).
It is guaranteed that all given points are different.
Output Specification:
Print the single number — the answer to the problem.
Demo Input:
['3\n1 1\n2 2\n3 3\n', '3\n0 0\n-1 0\n0 1\n']
Demo Output:
['1\n', '0\n']
Note:
none
|
```python
def milieu(l):
milieu = 0
for i in range(len(l)):
for j in range(i + 1, len(l)):
mx = (l[i][0] + l[j][0]) / 2
my = (l[i][1] + l[j][1]) / 2
if (mx, my) in l:
milieu += 1
print(milieu)
s =int(input())
l =[]
for i in range (s) :
x,y = list(map(int,input().split()))
l.append((x,y))
milieu(l)
```
| 0
|
|
61
|
A
|
Ultra-Fast Mathematician
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Ultra-Fast Mathematician
|
2
|
256
|
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
|
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
|
Write one line — the corresponding answer. Do not omit the leading 0s.
|
[
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] |
[
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] |
none
| 500
|
[
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,589,904,224
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 102
| 109
| 0
|
n, m, ans = list(input()), list(input()), ''
for i in range(len(n)):
if int(n[i]) ^ int(m[i]):
ans += '1'
else:
ans += '0'
print(ans)
|
Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none
|
```python
n, m, ans = list(input()), list(input()), ''
for i in range(len(n)):
if int(n[i]) ^ int(m[i]):
ans += '1'
else:
ans += '0'
print(ans)
```
| 3.97275
|
41
|
A
|
Translation
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Translation
|
2
|
256
|
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
|
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
|
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
|
[
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,668,415,118
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 92
| 0
|
str=input()
txt = str[::-1]
if str == txt:
print("yes")
else:
print("no")
|
Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
str=input()
txt = str[::-1]
if str == txt:
print("yes")
else:
print("no")
```
| 0
|
698
|
A
|
Vacations
|
PROGRAMMING
| 1,400
|
[
"dp"
] | null | null |
Vasya has *n* days of vacations! So he decided to improve his IT skills and do sport. Vasya knows the following information about each of this *n* days: whether that gym opened and whether a contest was carried out in the Internet on that day. For the *i*-th day there are four options:
1. on this day the gym is closed and the contest is not carried out; 1. on this day the gym is closed and the contest is carried out; 1. on this day the gym is open and the contest is not carried out; 1. on this day the gym is open and the contest is carried out.
On each of days Vasya can either have a rest or write the contest (if it is carried out on this day), or do sport (if the gym is open on this day).
Find the minimum number of days on which Vasya will have a rest (it means, he will not do sport and write the contest at the same time). The only limitation that Vasya has — he does not want to do the same activity on two consecutive days: it means, he will not do sport on two consecutive days, and write the contest on two consecutive days.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of days of Vasya's vacations.
The second line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=3) separated by space, where:
- *a**i* equals 0, if on the *i*-th day of vacations the gym is closed and the contest is not carried out; - *a**i* equals 1, if on the *i*-th day of vacations the gym is closed, but the contest is carried out; - *a**i* equals 2, if on the *i*-th day of vacations the gym is open and the contest is not carried out; - *a**i* equals 3, if on the *i*-th day of vacations the gym is open and the contest is carried out.
|
Print the minimum possible number of days on which Vasya will have a rest. Remember that Vasya refuses:
- to do sport on any two consecutive days, - to write the contest on any two consecutive days.
|
[
"4\n1 3 2 0\n",
"7\n1 3 3 2 1 2 3\n",
"2\n2 2\n"
] |
[
"2\n",
"0\n",
"1\n"
] |
In the first test Vasya can write the contest on the day number 1 and do sport on the day number 3. Thus, he will have a rest for only 2 days.
In the second test Vasya should write contests on days number 1, 3, 5 and 7, in other days do sport. Thus, he will not have a rest for a single day.
In the third test Vasya can do sport either on a day number 1 or number 2. He can not do sport in two days, because it will be contrary to the his limitation. Thus, he will have a rest for only one day.
| 500
|
[
{
"input": "4\n1 3 2 0",
"output": "2"
},
{
"input": "7\n1 3 3 2 1 2 3",
"output": "0"
},
{
"input": "2\n2 2",
"output": "1"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "10\n0 0 1 1 0 0 0 0 1 0",
"output": "8"
},
{
"input": "100\n3 2 3 3 3 2 3 1 3 2 2 3 2 3 3 3 3 3 3 1 2 2 3 1 3 3 2 2 2 3 1 0 3 3 3 2 3 3 1 1 3 1 3 3 3 1 3 1 3 0 1 3 2 3 2 1 1 3 2 3 3 3 2 3 1 3 3 3 3 2 2 2 1 3 1 3 3 3 3 1 3 2 3 3 0 3 3 3 3 3 1 0 2 1 3 3 0 2 3 3",
"output": "16"
},
{
"input": "10\n2 3 0 1 3 1 2 2 1 0",
"output": "3"
},
{
"input": "45\n3 3 2 3 2 3 3 3 0 3 3 3 3 3 3 3 1 3 2 3 2 3 2 2 2 3 2 3 3 3 3 3 1 2 3 3 2 2 2 3 3 3 3 1 3",
"output": "6"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "1\n3",
"output": "0"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n1 3",
"output": "0"
},
{
"input": "2\n0 1",
"output": "1"
},
{
"input": "2\n0 0",
"output": "2"
},
{
"input": "2\n3 3",
"output": "0"
},
{
"input": "3\n3 3 3",
"output": "0"
},
{
"input": "2\n3 2",
"output": "0"
},
{
"input": "2\n0 2",
"output": "1"
},
{
"input": "10\n2 2 3 3 3 3 2 1 3 2",
"output": "2"
},
{
"input": "15\n0 1 0 0 0 2 0 1 0 0 0 2 0 0 0",
"output": "11"
},
{
"input": "15\n1 3 2 2 2 3 3 3 3 2 3 2 2 1 1",
"output": "4"
},
{
"input": "15\n3 1 3 2 3 2 2 2 3 3 3 3 2 3 2",
"output": "3"
},
{
"input": "20\n0 2 0 1 0 0 0 1 2 0 1 1 1 0 1 1 0 1 1 0",
"output": "12"
},
{
"input": "20\n2 3 2 3 3 3 3 2 0 3 1 1 2 3 0 3 2 3 0 3",
"output": "5"
},
{
"input": "20\n3 3 3 3 2 3 3 2 1 3 3 2 2 2 3 2 2 2 2 2",
"output": "4"
},
{
"input": "25\n0 0 1 0 0 1 0 0 1 0 0 1 0 2 0 0 2 0 0 1 0 2 0 1 1",
"output": "16"
},
{
"input": "25\n1 3 3 2 2 3 3 3 3 3 1 2 2 3 2 0 2 1 0 1 3 2 2 3 3",
"output": "5"
},
{
"input": "25\n2 3 1 3 3 2 1 3 3 3 1 3 3 1 3 2 3 3 1 3 3 3 2 3 3",
"output": "3"
},
{
"input": "30\n0 0 1 0 1 0 1 1 0 0 0 0 0 0 1 0 0 1 1 0 0 2 0 0 1 1 2 0 0 0",
"output": "22"
},
{
"input": "30\n1 1 3 2 2 0 3 2 3 3 1 2 0 1 1 2 3 3 2 3 1 3 2 3 0 2 0 3 3 2",
"output": "9"
},
{
"input": "30\n1 2 3 2 2 3 3 3 3 3 3 3 3 3 3 1 2 2 3 2 3 3 3 2 1 3 3 3 1 3",
"output": "2"
},
{
"input": "35\n0 1 1 0 0 2 0 0 1 0 0 0 1 0 1 0 1 0 0 0 1 2 1 0 2 2 1 0 1 0 1 1 1 0 0",
"output": "21"
},
{
"input": "35\n2 2 0 3 2 2 0 3 3 1 1 3 3 1 2 2 0 2 2 2 2 3 1 0 2 1 3 2 2 3 2 3 3 1 2",
"output": "11"
},
{
"input": "35\n1 2 2 3 3 3 3 3 2 2 3 3 2 3 3 2 3 2 3 3 2 2 2 3 3 2 3 3 3 1 3 3 2 2 2",
"output": "7"
},
{
"input": "40\n2 0 1 1 0 0 0 0 2 0 1 1 1 0 0 1 0 0 0 0 0 2 0 0 0 2 1 1 1 3 0 0 0 0 0 0 0 1 1 0",
"output": "28"
},
{
"input": "40\n2 2 3 2 0 2 3 2 1 2 3 0 2 3 2 1 1 3 1 1 0 2 3 1 3 3 1 1 3 3 2 2 1 3 3 3 2 3 3 1",
"output": "10"
},
{
"input": "40\n1 3 2 3 3 2 3 3 2 2 3 1 2 1 2 2 3 1 2 2 1 2 2 2 1 2 2 3 2 3 2 3 2 3 3 3 1 3 2 3",
"output": "8"
},
{
"input": "45\n2 1 0 0 0 2 1 0 1 0 0 2 2 1 1 0 0 2 0 0 0 0 0 0 1 0 0 2 0 0 1 1 0 0 1 0 0 1 1 2 0 0 2 0 2",
"output": "29"
},
{
"input": "45\n3 3 2 3 3 3 2 2 3 2 3 1 3 2 3 2 2 1 1 3 2 3 2 1 3 1 2 3 2 2 0 3 3 2 3 2 3 2 3 2 0 3 1 1 3",
"output": "8"
},
{
"input": "50\n3 0 0 0 2 0 0 0 0 0 0 0 2 1 0 2 0 1 0 1 3 0 2 1 1 0 0 1 1 0 0 1 2 1 1 2 1 1 0 0 0 0 0 0 0 1 2 2 0 0",
"output": "32"
},
{
"input": "50\n3 3 3 3 1 0 3 3 0 2 3 1 1 1 3 2 3 3 3 3 3 1 0 1 2 2 3 3 2 3 0 0 0 2 1 0 1 2 2 2 2 0 2 2 2 1 2 3 3 2",
"output": "16"
},
{
"input": "50\n3 2 3 1 2 1 2 3 3 2 3 3 2 1 3 3 3 3 3 3 2 3 2 3 2 2 3 3 3 2 3 3 3 3 2 3 1 2 3 3 2 3 3 1 2 2 1 1 3 3",
"output": "7"
},
{
"input": "55\n0 0 1 1 0 1 0 0 1 0 1 0 0 0 2 0 0 1 0 0 0 1 0 0 0 0 3 1 0 0 0 1 0 0 0 0 2 0 0 0 2 0 2 1 0 0 0 0 0 0 0 0 2 0 0",
"output": "40"
},
{
"input": "55\n3 0 3 3 3 2 0 2 3 0 3 2 3 3 0 3 3 1 3 3 1 2 3 2 0 3 3 2 1 2 3 2 3 0 3 2 2 1 2 3 2 2 1 3 2 2 3 1 3 2 2 3 3 2 2",
"output": "13"
},
{
"input": "55\n3 3 1 3 2 3 2 3 2 2 3 3 3 3 3 1 1 3 3 2 3 2 3 2 0 1 3 3 3 3 2 3 2 3 1 1 2 2 2 3 3 3 3 3 2 2 2 3 2 3 3 3 3 1 3",
"output": "7"
},
{
"input": "60\n0 1 0 0 0 0 0 0 0 2 1 1 3 0 0 0 0 0 1 0 1 1 0 0 0 3 0 1 0 1 0 2 0 0 0 0 0 1 0 0 0 0 1 1 0 1 0 0 0 0 0 1 0 0 1 0 1 0 0 0",
"output": "44"
},
{
"input": "60\n3 2 1 3 2 2 3 3 3 1 1 3 2 2 3 3 1 3 2 2 3 3 2 2 2 2 0 2 2 3 2 3 0 3 3 3 2 3 3 0 1 3 2 1 3 1 1 2 1 3 1 1 2 2 1 3 3 3 2 2",
"output": "15"
},
{
"input": "60\n3 2 2 3 2 3 2 3 3 2 3 2 3 3 2 3 3 3 3 3 3 2 3 3 1 2 3 3 3 2 1 3 3 1 3 1 3 0 3 3 3 2 3 2 3 2 3 3 1 1 2 3 3 3 3 2 1 3 2 3",
"output": "8"
},
{
"input": "65\n1 0 2 1 1 0 1 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 0 1 2 0 2 1 0 2 1 0 1 0 1 1 0 1 1 1 2 1 0 1 0 0 0 0 1 2 2 1 0 0 1 2 1 2 0 2 0 0 0 1 1",
"output": "35"
},
{
"input": "65\n2 2 2 3 0 2 1 2 3 3 1 3 1 2 1 3 2 3 2 2 2 1 2 0 3 1 3 1 1 3 1 3 3 3 3 3 1 3 0 3 1 3 1 2 2 3 2 0 3 1 3 2 1 2 2 2 3 3 2 3 3 3 2 2 3",
"output": "13"
},
{
"input": "65\n3 2 3 3 3 2 3 2 3 3 3 3 3 3 3 3 3 2 3 2 3 2 2 3 3 3 3 3 2 2 2 3 3 2 3 3 2 3 3 3 3 2 3 3 3 2 2 3 3 3 3 3 3 2 2 3 3 2 3 3 1 3 3 3 3",
"output": "6"
},
{
"input": "70\n1 0 0 0 1 0 1 0 0 0 1 1 0 1 0 0 1 1 1 0 1 1 0 0 1 1 1 3 1 1 0 1 2 0 2 1 0 0 0 1 1 1 1 1 0 0 1 0 0 0 1 1 1 3 0 0 1 0 0 0 1 0 0 0 0 0 1 0 1 1",
"output": "43"
},
{
"input": "70\n2 3 3 3 1 3 3 1 2 1 1 2 2 3 0 2 3 3 1 3 3 2 2 3 3 3 2 2 2 2 1 3 3 0 2 1 1 3 2 3 3 2 2 3 1 3 1 2 3 2 3 3 2 2 2 3 1 1 2 1 3 3 2 2 3 3 3 1 1 1",
"output": "16"
},
{
"input": "70\n3 3 2 2 1 2 1 2 2 2 2 2 3 3 2 3 3 3 3 2 2 2 2 3 3 3 1 3 3 3 2 3 3 3 3 2 3 3 1 3 1 3 2 3 3 2 3 3 3 2 3 2 3 3 1 2 3 3 2 2 2 3 2 3 3 3 3 3 3 1",
"output": "10"
},
{
"input": "75\n1 0 0 1 1 0 0 1 0 1 2 0 0 2 1 1 0 0 0 0 0 0 2 1 1 0 0 0 0 1 0 1 0 1 1 1 0 1 0 0 1 0 0 0 0 0 0 1 1 0 0 1 2 1 0 0 0 0 0 0 0 1 0 0 0 1 0 0 0 1 1 1 0 1 0",
"output": "51"
},
{
"input": "75\n1 3 3 3 1 1 3 2 3 3 1 3 3 3 2 1 3 2 2 3 1 1 1 1 1 1 2 3 3 3 3 3 3 2 3 3 3 3 3 2 3 3 2 2 2 1 2 3 3 2 2 3 0 1 1 3 3 0 0 1 1 3 2 3 3 3 3 1 2 2 3 3 3 3 1",
"output": "16"
},
{
"input": "75\n3 3 3 3 2 2 3 2 2 3 2 2 1 2 3 3 2 2 3 3 1 2 2 2 1 3 3 3 1 2 2 3 3 3 2 3 2 2 2 3 3 1 3 2 2 3 3 3 0 3 2 1 3 3 2 3 3 3 3 1 2 3 3 3 2 2 3 3 3 3 2 2 3 3 1",
"output": "11"
},
{
"input": "80\n0 0 0 0 2 0 1 1 1 1 1 0 0 0 0 2 0 0 1 0 0 0 0 1 1 0 2 2 1 1 0 1 0 1 0 1 1 1 0 1 2 1 1 0 0 0 1 1 0 1 1 0 1 0 0 1 0 0 1 0 0 0 0 0 0 0 2 2 0 1 1 0 0 0 0 0 0 0 0 1",
"output": "56"
},
{
"input": "80\n2 2 3 3 2 1 0 1 0 3 2 2 3 2 1 3 1 3 3 2 3 3 3 2 3 3 3 2 1 3 3 1 3 3 3 3 3 3 2 2 2 1 3 2 1 3 2 1 1 0 1 1 2 1 3 0 1 2 3 2 2 3 2 3 1 3 3 2 1 1 0 3 3 3 3 1 2 1 2 0",
"output": "17"
},
{
"input": "80\n2 3 3 2 2 2 3 3 2 3 3 3 3 3 2 3 2 3 2 3 3 3 3 3 3 3 3 3 2 3 1 3 2 3 3 0 3 1 2 3 3 1 2 3 2 3 3 2 3 3 3 3 3 2 2 3 0 3 3 3 3 3 2 2 3 2 3 3 3 3 3 2 3 2 3 3 3 3 2 3",
"output": "9"
},
{
"input": "85\n0 1 1 0 0 0 0 0 0 1 0 0 0 1 0 0 0 0 2 0 1 0 0 2 0 1 1 0 0 0 0 2 2 0 0 0 1 0 0 0 1 2 0 1 0 0 0 2 1 1 2 0 3 1 0 2 2 1 0 0 1 1 0 0 0 0 1 0 2 1 1 2 1 0 0 1 2 1 2 0 0 1 0 1 0",
"output": "54"
},
{
"input": "85\n2 3 1 3 2 3 1 3 3 2 1 2 1 2 2 3 2 2 3 2 0 3 3 2 1 2 2 2 3 3 2 3 3 3 2 1 1 3 1 3 2 2 2 3 3 2 3 2 3 1 1 3 2 3 1 3 3 2 3 3 2 2 3 0 1 1 2 2 2 2 1 2 3 1 3 3 1 3 2 2 3 2 3 3 3",
"output": "19"
},
{
"input": "85\n1 2 1 2 3 2 3 3 3 3 3 3 3 2 1 3 2 3 3 3 3 2 3 3 3 1 3 3 3 3 2 3 3 3 3 3 3 2 2 1 3 3 3 3 2 2 3 1 1 2 3 3 3 2 3 3 3 3 3 2 3 3 3 2 2 3 3 1 1 1 3 3 3 3 1 3 3 3 1 3 3 1 3 2 3",
"output": "9"
},
{
"input": "90\n2 0 1 0 0 0 0 0 0 1 1 2 0 0 0 0 0 0 0 2 2 0 2 0 0 2 1 0 2 0 1 0 1 0 0 1 2 2 0 0 1 0 0 1 0 1 0 2 0 1 1 1 0 1 1 0 1 0 2 0 1 0 1 0 0 0 1 0 0 1 2 0 0 0 1 0 0 2 2 0 0 0 0 0 1 3 1 1 0 1",
"output": "57"
},
{
"input": "90\n2 3 3 3 2 3 2 1 3 0 3 2 3 3 2 1 3 3 2 3 2 3 3 2 1 3 1 3 3 1 2 2 3 3 2 1 2 3 2 3 0 3 3 2 2 3 1 0 3 3 1 3 3 3 3 2 1 2 2 1 3 2 1 3 3 1 2 0 2 2 3 2 2 3 3 3 1 3 2 1 2 3 3 2 3 2 3 3 2 1",
"output": "17"
},
{
"input": "90\n2 3 2 3 2 2 3 3 2 3 2 1 2 3 3 3 2 3 2 3 3 2 3 3 3 1 3 3 1 3 2 3 2 2 1 3 3 3 3 3 3 3 3 3 3 2 3 2 3 2 1 3 3 3 3 2 2 3 3 3 3 3 3 3 3 3 3 3 3 2 2 3 3 3 3 1 3 2 3 3 3 2 2 3 2 3 2 1 3 2",
"output": "9"
},
{
"input": "95\n0 0 3 0 2 0 1 0 0 2 0 0 0 0 0 0 0 1 0 0 0 2 0 0 0 0 0 1 0 0 2 1 0 0 1 0 0 0 1 0 0 0 0 1 0 1 0 0 1 0 1 2 0 1 2 2 0 0 1 0 2 0 0 0 1 0 2 1 2 1 0 1 0 0 0 1 0 0 1 1 2 1 1 1 1 2 0 0 0 0 0 1 1 0 1",
"output": "61"
},
{
"input": "95\n2 3 3 2 1 1 3 3 3 2 3 3 3 2 3 2 3 3 3 2 3 2 2 3 3 2 1 2 3 3 3 1 3 0 3 3 1 3 3 1 0 1 3 3 3 0 2 1 3 3 3 3 0 1 3 2 3 3 2 1 3 1 2 1 1 2 3 0 3 3 2 1 3 2 1 3 3 3 2 2 3 2 3 3 3 2 1 3 3 3 2 3 3 1 2",
"output": "15"
},
{
"input": "95\n2 3 3 2 3 2 2 1 3 1 2 1 2 3 1 2 3 3 1 3 3 3 1 2 3 2 2 2 2 3 3 3 2 2 3 3 3 3 3 1 2 2 3 3 3 3 2 3 2 2 2 3 3 2 3 3 3 3 3 3 3 0 3 2 0 3 3 1 3 3 3 2 3 2 3 2 3 3 3 3 2 2 1 1 3 3 3 3 3 1 3 3 3 3 2",
"output": "14"
},
{
"input": "100\n1 0 2 0 0 0 0 2 0 0 0 1 0 1 0 0 1 0 1 2 0 1 1 0 0 1 0 1 1 0 0 0 2 0 1 0 0 2 0 0 0 0 0 1 1 1 0 0 1 0 2 0 0 0 0 1 0 1 0 1 0 1 0 1 2 2 0 0 2 0 1 0 1 0 1 0 0 0 1 0 0 2 1 1 1 0 0 1 0 0 0 2 0 0 2 1 1 0 0 2",
"output": "63"
},
{
"input": "100\n3 2 1 3 2 3 2 3 2 2 3 1 3 3 3 3 3 2 2 3 2 2 3 2 3 3 3 2 3 1 2 1 3 3 3 3 1 3 3 3 3 3 2 3 2 1 3 3 1 2 2 3 1 3 3 1 2 2 1 3 1 3 2 2 3 3 1 3 2 3 1 2 1 2 3 3 2 2 1 2 3 3 3 3 3 1 3 3 3 3 2 1 3 0 3 3 3 2 3 3",
"output": "15"
},
{
"input": "100\n1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2",
"output": "0"
},
{
"input": "100\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "0"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "50"
},
{
"input": "100\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "50"
},
{
"input": "99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "49"
},
{
"input": "100\n2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1",
"output": "0"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "100"
},
{
"input": "2\n0 3",
"output": "1"
},
{
"input": "2\n1 0",
"output": "1"
},
{
"input": "2\n1 2",
"output": "0"
},
{
"input": "2\n2 0",
"output": "1"
},
{
"input": "2\n2 1",
"output": "0"
},
{
"input": "2\n2 3",
"output": "0"
},
{
"input": "2\n3 0",
"output": "1"
},
{
"input": "2\n3 1",
"output": "0"
},
{
"input": "100\n3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0",
"output": "50"
}
] | 1,598,876,263
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 88
| 140
| 20,172,800
|
n = int(input())
a = [int(i) for i in input().split()]
dp = [[0]*(n+1), [0]*(n+1), [0]*(n+1)]
INF = 1e9
for i in range(1, n + 1):
dp[0][i] = min(dp[0][i - 1], dp[1][i - 1], dp[2][i - 1]) + 1
if a[i - 1] == 0:
dp[1][i] = INF
dp[2][i] = INF
elif a[i - 1] == 1:
dp[1][i] = min(dp[0][i - 1], dp[2][i - 1])
dp[2][i] = INF
elif a[i - 1] == 2:
dp[1][i] = INF
dp[2][i] = min(dp[0][i - 1], dp[1][i - 1])
elif a[i - 1] == 3:
dp[1][i] = min(dp[0][i - 1], dp[2][i - 1])
dp[2][i] = min(dp[0][i - 1], dp[1][i - 1])
print(min(dp[0][n], dp[1][n], dp[2][n]))
|
Title: Vacations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has *n* days of vacations! So he decided to improve his IT skills and do sport. Vasya knows the following information about each of this *n* days: whether that gym opened and whether a contest was carried out in the Internet on that day. For the *i*-th day there are four options:
1. on this day the gym is closed and the contest is not carried out; 1. on this day the gym is closed and the contest is carried out; 1. on this day the gym is open and the contest is not carried out; 1. on this day the gym is open and the contest is carried out.
On each of days Vasya can either have a rest or write the contest (if it is carried out on this day), or do sport (if the gym is open on this day).
Find the minimum number of days on which Vasya will have a rest (it means, he will not do sport and write the contest at the same time). The only limitation that Vasya has — he does not want to do the same activity on two consecutive days: it means, he will not do sport on two consecutive days, and write the contest on two consecutive days.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of days of Vasya's vacations.
The second line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=3) separated by space, where:
- *a**i* equals 0, if on the *i*-th day of vacations the gym is closed and the contest is not carried out; - *a**i* equals 1, if on the *i*-th day of vacations the gym is closed, but the contest is carried out; - *a**i* equals 2, if on the *i*-th day of vacations the gym is open and the contest is not carried out; - *a**i* equals 3, if on the *i*-th day of vacations the gym is open and the contest is carried out.
Output Specification:
Print the minimum possible number of days on which Vasya will have a rest. Remember that Vasya refuses:
- to do sport on any two consecutive days, - to write the contest on any two consecutive days.
Demo Input:
['4\n1 3 2 0\n', '7\n1 3 3 2 1 2 3\n', '2\n2 2\n']
Demo Output:
['2\n', '0\n', '1\n']
Note:
In the first test Vasya can write the contest on the day number 1 and do sport on the day number 3. Thus, he will have a rest for only 2 days.
In the second test Vasya should write contests on days number 1, 3, 5 and 7, in other days do sport. Thus, he will not have a rest for a single day.
In the third test Vasya can do sport either on a day number 1 or number 2. He can not do sport in two days, because it will be contrary to the his limitation. Thus, he will have a rest for only one day.
|
```python
n = int(input())
a = [int(i) for i in input().split()]
dp = [[0]*(n+1), [0]*(n+1), [0]*(n+1)]
INF = 1e9
for i in range(1, n + 1):
dp[0][i] = min(dp[0][i - 1], dp[1][i - 1], dp[2][i - 1]) + 1
if a[i - 1] == 0:
dp[1][i] = INF
dp[2][i] = INF
elif a[i - 1] == 1:
dp[1][i] = min(dp[0][i - 1], dp[2][i - 1])
dp[2][i] = INF
elif a[i - 1] == 2:
dp[1][i] = INF
dp[2][i] = min(dp[0][i - 1], dp[1][i - 1])
elif a[i - 1] == 3:
dp[1][i] = min(dp[0][i - 1], dp[2][i - 1])
dp[2][i] = min(dp[0][i - 1], dp[1][i - 1])
print(min(dp[0][n], dp[1][n], dp[2][n]))
```
| 3
|
|
686
|
A
|
Free Ice Cream
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer.
At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue).
If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress.
Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
|
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109).
Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
|
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
|
[
"5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n",
"5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n"
] |
[
"22 1\n",
"3 2\n"
] |
Consider the first sample.
1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
| 500
|
[
{
"input": "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20",
"output": "22 1"
},
{
"input": "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98",
"output": "3 2"
},
{
"input": "6 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000",
"output": "7000000000 0"
},
{
"input": "5 12\n- 12\n+ 7\n- 6\n- 1\n+ 46",
"output": "46 0"
},
{
"input": "11 1000\n- 100\n+ 100\n+ 100\n+ 100\n+ 100\n- 100\n- 100\n- 100\n- 100\n- 100\n- 100",
"output": "700 0"
},
{
"input": "1 0\n- 526403222",
"output": "0 1"
},
{
"input": "1 897986543\n- 371188251",
"output": "526798292 0"
},
{
"input": "1 0\n+ 1",
"output": "1 0"
},
{
"input": "1 0\n- 1",
"output": "0 1"
},
{
"input": "1 10\n+ 10",
"output": "20 0"
},
{
"input": "1 3\n- 5",
"output": "3 1"
},
{
"input": "1 0\n- 5",
"output": "0 1"
},
{
"input": "1 0\n+ 5",
"output": "5 0"
}
] | 1,622,637,910
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 34
| 202
| 1,843,200
|
import sys
import math
import collections
import heapq
input=sys.stdin.readline
n,x=(int(i) for i in input().split())
c=0
for i in range(n):
a,b=(i for i in input().split())
if(a=='+'):
x+=int(b)
else:
if(x>=int(b)):
x-=int(b)
else:
c+=1
print(x,c)
|
Title: Free Ice Cream
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer.
At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue).
If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress.
Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
Input Specification:
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109).
Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
Output Specification:
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
Demo Input:
['5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n', '5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n']
Demo Output:
['22 1\n', '3 2\n']
Note:
Consider the first sample.
1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
|
```python
import sys
import math
import collections
import heapq
input=sys.stdin.readline
n,x=(int(i) for i in input().split())
c=0
for i in range(n):
a,b=(i for i in input().split())
if(a=='+'):
x+=int(b)
else:
if(x>=int(b)):
x-=int(b)
else:
c+=1
print(x,c)
```
| 3
|
|
43
|
A
|
Football
|
PROGRAMMING
| 1,000
|
[
"strings"
] |
A. Football
|
2
|
256
|
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
|
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
|
[
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] |
[
"ABC\n",
"A\n"
] |
none
| 500
|
[
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,521,907,990
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 34
| 218
| 21,708,800
|
n = int(input());
d = list( input() for i in range(n));
print(max( set(d) , key=d.count ))
|
Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none
|
```python
n = int(input());
d = list( input() for i in range(n));
print(max( set(d) , key=d.count ))
```
| 3.905064
|
677
|
A
|
Vanya and Fence
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
|
The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
|
Print a single integer — the minimum possible valid width of the road.
|
[
"3 7\n4 5 14\n",
"6 1\n1 1 1 1 1 1\n",
"6 5\n7 6 8 9 10 5\n"
] |
[
"4\n",
"6\n",
"11\n"
] |
In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4.
In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
| 500
|
[
{
"input": "3 7\n4 5 14",
"output": "4"
},
{
"input": "6 1\n1 1 1 1 1 1",
"output": "6"
},
{
"input": "6 5\n7 6 8 9 10 5",
"output": "11"
},
{
"input": "10 420\n214 614 297 675 82 740 174 23 255 15",
"output": "13"
},
{
"input": "10 561\n657 23 1096 487 785 66 481 554 1000 821",
"output": "15"
},
{
"input": "100 342\n478 143 359 336 162 333 385 515 117 496 310 538 469 539 258 676 466 677 1 296 150 560 26 213 627 221 255 126 617 174 279 178 24 435 70 145 619 46 669 566 300 67 576 251 58 176 441 564 569 194 24 669 73 262 457 259 619 78 400 579 222 626 269 47 80 315 160 194 455 186 315 424 197 246 683 220 68 682 83 233 290 664 273 598 362 305 674 614 321 575 362 120 14 534 62 436 294 351 485 396",
"output": "144"
},
{
"input": "100 290\n244 49 276 77 449 261 468 458 201 424 9 131 300 88 432 394 104 77 13 289 435 259 111 453 168 394 156 412 351 576 178 530 81 271 228 564 125 328 42 372 205 61 180 471 33 360 567 331 222 318 241 117 529 169 188 484 202 202 299 268 246 343 44 364 333 494 59 236 84 485 50 8 428 8 571 227 205 310 210 9 324 472 368 490 114 84 296 305 411 351 569 393 283 120 510 171 232 151 134 366",
"output": "145"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 1\n2",
"output": "2"
},
{
"input": "46 71\n30 26 56 138 123 77 60 122 73 45 79 10 130 3 14 1 38 46 128 50 82 16 32 68 28 98 62 106 2 49 131 11 114 39 139 70 40 50 45 137 33 30 35 136 135 19",
"output": "63"
},
{
"input": "20 723\n212 602 293 591 754 91 1135 640 80 495 845 928 1399 498 926 1431 1226 869 814 1386",
"output": "31"
},
{
"input": "48 864\n843 1020 751 1694 18 1429 1395 1174 272 1158 1628 1233 1710 441 765 561 778 748 1501 1200 563 1263 1398 1687 1518 1640 1591 839 500 466 1603 1587 1201 1209 432 868 1159 639 649 628 9 91 1036 147 896 1557 941 518",
"output": "75"
},
{
"input": "26 708\n549 241 821 734 945 1161 566 1268 216 30 1142 730 529 1014 255 168 796 1148 89 113 1328 286 743 871 1259 1397",
"output": "41"
},
{
"input": "75 940\n1620 1745 1599 441 64 1466 1496 1239 1716 1475 778 106 1136 1212 1261 444 781 257 1071 747 626 232 609 1544 682 1326 469 1361 1460 1450 1207 1319 922 625 1737 1057 1698 592 692 80 1016 541 1254 201 682 1007 847 206 1066 809 259 109 240 1611 219 1455 1326 1377 1827 786 42 1002 1382 1592 543 1866 1198 334 1524 1760 340 1566 955 257 1118",
"output": "116"
}
] | 1,699,236,406
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 46
| 0
|
# Ваня с друзьями идёт по запрещенной территории возле забора высотой h. Чтобы охранник их не заметил, высота каждого
# из друзей не должна превышать h. При этом каждый из них может пригнуться, тогда его точно не будет видно охраннику.
# Высота i-го из друзей равняется ai.
#
# Будем считать, что ширина человека, идущего в полный рост, равна 1, а согнутого — 2. Друзья хотят идти по дороге в
# один ряд, чтобы иметь возможность разговаривать друг с другом. Какой минимальной ширины должна быть (дорога, чтобы)
# все они поместились на ней в один ряд и охранник никого не увидел?
#
# Входные данные
# В первой строке входных данных записаны два целых числа n и h (1≤n≤1000, 1≤h≤1000) — количество друзей и высота
# забора соответственно.
#
# Во второй строке записаны n целых чисел ai (1≤ai≤2h), i-е из которых равняется высоте i-го друга.
#
# Выходные данные
# Выведите единственное целое число — минимальную подходящую ширину дороги.
n, h = map(int, input().split())
a = list(map(int, input().split()))
width_road = 0
for i in range(n):
if a[i] > h:
width_road += 2
else:
width_road += 1
print(width_road)
|
Title: Vanya and Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
Input Specification:
The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
Output Specification:
Print a single integer — the minimum possible valid width of the road.
Demo Input:
['3 7\n4 5 14\n', '6 1\n1 1 1 1 1 1\n', '6 5\n7 6 8 9 10 5\n']
Demo Output:
['4\n', '6\n', '11\n']
Note:
In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4.
In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
|
```python
# Ваня с друзьями идёт по запрещенной территории возле забора высотой h. Чтобы охранник их не заметил, высота каждого
# из друзей не должна превышать h. При этом каждый из них может пригнуться, тогда его точно не будет видно охраннику.
# Высота i-го из друзей равняется ai.
#
# Будем считать, что ширина человека, идущего в полный рост, равна 1, а согнутого — 2. Друзья хотят идти по дороге в
# один ряд, чтобы иметь возможность разговаривать друг с другом. Какой минимальной ширины должна быть (дорога, чтобы)
# все они поместились на ней в один ряд и охранник никого не увидел?
#
# Входные данные
# В первой строке входных данных записаны два целых числа n и h (1≤n≤1000, 1≤h≤1000) — количество друзей и высота
# забора соответственно.
#
# Во второй строке записаны n целых чисел ai (1≤ai≤2h), i-е из которых равняется высоте i-го друга.
#
# Выходные данные
# Выведите единственное целое число — минимальную подходящую ширину дороги.
n, h = map(int, input().split())
a = list(map(int, input().split()))
width_road = 0
for i in range(n):
if a[i] > h:
width_road += 2
else:
width_road += 1
print(width_road)
```
| 3
|
|
706
|
B
|
Interesting drink
|
PROGRAMMING
| 1,100
|
[
"binary search",
"dp",
"implementation"
] | null | null |
Vasiliy likes to rest after a hard work, so you may often meet him in some bar nearby. As all programmers do, he loves the famous drink "Beecola", which can be bought in *n* different shops in the city. It's known that the price of one bottle in the shop *i* is equal to *x**i* coins.
Vasiliy plans to buy his favorite drink for *q* consecutive days. He knows, that on the *i*-th day he will be able to spent *m**i* coins. Now, for each of the days he want to know in how many different shops he can buy a bottle of "Beecola".
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of shops in the city that sell Vasiliy's favourite drink.
The second line contains *n* integers *x**i* (1<=≤<=*x**i*<=≤<=100<=000) — prices of the bottles of the drink in the *i*-th shop.
The third line contains a single integer *q* (1<=≤<=*q*<=≤<=100<=000) — the number of days Vasiliy plans to buy the drink.
Then follow *q* lines each containing one integer *m**i* (1<=≤<=*m**i*<=≤<=109) — the number of coins Vasiliy can spent on the *i*-th day.
|
Print *q* integers. The *i*-th of them should be equal to the number of shops where Vasiliy will be able to buy a bottle of the drink on the *i*-th day.
|
[
"5\n3 10 8 6 11\n4\n1\n10\n3\n11\n"
] |
[
"0\n4\n1\n5\n"
] |
On the first day, Vasiliy won't be able to buy a drink in any of the shops.
On the second day, Vasiliy can buy a drink in the shops 1, 2, 3 and 4.
On the third day, Vasiliy can buy a drink only in the shop number 1.
Finally, on the last day Vasiliy can buy a drink in any shop.
| 1,000
|
[
{
"input": "5\n3 10 8 6 11\n4\n1\n10\n3\n11",
"output": "0\n4\n1\n5"
},
{
"input": "5\n868 987 714 168 123\n10\n424\n192\n795\n873\n117\n914\n735\n158\n631\n471",
"output": "2\n2\n3\n4\n0\n4\n3\n1\n2\n2"
},
{
"input": "3\n435 482 309\n7\n245\n241\n909\n745\n980\n29\n521",
"output": "0\n0\n3\n3\n3\n0\n3"
},
{
"input": "1\n653\n9\n903\n980\n80\n770\n965\n874\n381\n657\n969",
"output": "1\n1\n0\n1\n1\n1\n0\n1\n1"
},
{
"input": "12\n35345 58181 32223 84621 35905 73863 99537 30666 67771 39229 36847 29038\n23\n55052824\n82504840\n35160556\n78141700\n73401989\n86305919\n39430705\n31939373\n23501765\n4406029\n61436920\n14295390\n34275309\n28028753\n85724689\n70158847\n2396455\n66994588\n84024224\n30175981\n65622319\n76517111\n76605341",
"output": "12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12"
},
{
"input": "4\n698 193 1584 76192\n4\n553640\n310518\n274280\n429192",
"output": "4\n4\n4\n4"
},
{
"input": "1\n1\n1\n1000000000",
"output": "1"
},
{
"input": "1\n1\n1\n100005",
"output": "1"
},
{
"input": "3\n1 2 3\n1\n100005",
"output": "3"
},
{
"input": "2\n1 2\n3\n100004\n100005\n100006",
"output": "2\n2\n2"
},
{
"input": "3\n1 1 1\n1\n1",
"output": "3"
},
{
"input": "1\n1\n1\n1",
"output": "1"
},
{
"input": "3\n1 2 3\n1\n100000",
"output": "3"
},
{
"input": "5\n1 1 1 1 10\n2\n1\n10",
"output": "4\n5"
},
{
"input": "5\n3 10 8 6 11\n1\n10000000",
"output": "5"
}
] | 1,689,147,984
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 10
| 2,000
| 12,390,400
|
n = int(input())
shops = list(map(int, input().split()))
q = int(input())
for i in range(q):
money = int(input())
count = 0
for price in shops:
if money >= price:
count += 1
print(count)
# Wed Jul 12 2023 10:13:49 GMT+0300 (Moscow Standard Time)
|
Title: Interesting drink
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasiliy likes to rest after a hard work, so you may often meet him in some bar nearby. As all programmers do, he loves the famous drink "Beecola", which can be bought in *n* different shops in the city. It's known that the price of one bottle in the shop *i* is equal to *x**i* coins.
Vasiliy plans to buy his favorite drink for *q* consecutive days. He knows, that on the *i*-th day he will be able to spent *m**i* coins. Now, for each of the days he want to know in how many different shops he can buy a bottle of "Beecola".
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of shops in the city that sell Vasiliy's favourite drink.
The second line contains *n* integers *x**i* (1<=≤<=*x**i*<=≤<=100<=000) — prices of the bottles of the drink in the *i*-th shop.
The third line contains a single integer *q* (1<=≤<=*q*<=≤<=100<=000) — the number of days Vasiliy plans to buy the drink.
Then follow *q* lines each containing one integer *m**i* (1<=≤<=*m**i*<=≤<=109) — the number of coins Vasiliy can spent on the *i*-th day.
Output Specification:
Print *q* integers. The *i*-th of them should be equal to the number of shops where Vasiliy will be able to buy a bottle of the drink on the *i*-th day.
Demo Input:
['5\n3 10 8 6 11\n4\n1\n10\n3\n11\n']
Demo Output:
['0\n4\n1\n5\n']
Note:
On the first day, Vasiliy won't be able to buy a drink in any of the shops.
On the second day, Vasiliy can buy a drink in the shops 1, 2, 3 and 4.
On the third day, Vasiliy can buy a drink only in the shop number 1.
Finally, on the last day Vasiliy can buy a drink in any shop.
|
```python
n = int(input())
shops = list(map(int, input().split()))
q = int(input())
for i in range(q):
money = int(input())
count = 0
for price in shops:
if money >= price:
count += 1
print(count)
# Wed Jul 12 2023 10:13:49 GMT+0300 (Moscow Standard Time)
```
| 0
|
|
842
|
C
|
Ilya And The Tree
|
PROGRAMMING
| 2,000
|
[
"dfs and similar",
"graphs",
"math",
"number theory",
"trees"
] | null | null |
Ilya is very fond of graphs, especially trees. During his last trip to the forest Ilya found a very interesting tree rooted at vertex 1. There is an integer number written on each vertex of the tree; the number written on vertex *i* is equal to *a**i*.
Ilya believes that the beauty of the vertex *x* is the greatest common divisor of all numbers written on the vertices on the path from the root to *x*, including this vertex itself. In addition, Ilya can change the number in one arbitrary vertex to 0 or leave all vertices unchanged. Now for each vertex Ilya wants to know the maximum possible beauty it can have.
For each vertex the answer must be considered independently.
The beauty of the root equals to number written on it.
|
First line contains one integer number *n* — the number of vertices in tree (1<=≤<=*n*<=≤<=2·105).
Next line contains *n* integer numbers *a**i* (1<=≤<=*i*<=≤<=*n*, 1<=≤<=*a**i*<=≤<=2·105).
Each of next *n*<=-<=1 lines contains two integer numbers *x* and *y* (1<=≤<=*x*,<=*y*<=≤<=*n*, *x*<=≠<=*y*), which means that there is an edge (*x*,<=*y*) in the tree.
|
Output *n* numbers separated by spaces, where *i*-th number equals to maximum possible beauty of vertex *i*.
|
[
"2\n6 2\n1 2\n",
"3\n6 2 3\n1 2\n1 3\n",
"1\n10\n"
] |
[
"6 6 \n",
"6 6 6 \n",
"10 \n"
] |
none
| 1,500
|
[
{
"input": "2\n6 2\n1 2",
"output": "6 6 "
},
{
"input": "3\n6 2 3\n1 2\n1 3",
"output": "6 6 6 "
},
{
"input": "1\n10",
"output": "10 "
},
{
"input": "10\n2 3 4 5 6 7 8 9 10 11\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n4 8\n8 9\n9 10",
"output": "2 3 2 1 1 1 1 1 1 1 "
},
{
"input": "4\n6 2 3 2\n1 2\n2 3\n3 4",
"output": "6 6 3 2 "
}
] | 1,504,032,187
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 93
| 1,228,800
|
n = int(input())
A = list(map(int,input().split()))
from collections import defaultdict
d = defaultdict(list)
for i in range(n-1):
a,b = map(int,input().split())
a,b = a-1,b-1
d[a].append(b)
d[b].append(a)
parent = [None]*n
parent[0] = 0
stack = [0]
while stack:
v = stack.pop()
for u in d[v]:
if parent[u] is None:
parent[u] = v
stack.append(u)
stack = d[0]
L = [None]*n
L[0] = (A[0],0)
# unchanged : one 0ed
from fractions import gcd
while stack:
v = stack.pop()
a = A[v]
x,y = L[parent[v]]
L[v] = (gcd(x,a), max(x, gcd(y,a)))
for u in d[v]:
if L[u] is None:
stack.append(u)
print(' '.join(map(str,map(max,L))))
|
Title: Ilya And The Tree
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ilya is very fond of graphs, especially trees. During his last trip to the forest Ilya found a very interesting tree rooted at vertex 1. There is an integer number written on each vertex of the tree; the number written on vertex *i* is equal to *a**i*.
Ilya believes that the beauty of the vertex *x* is the greatest common divisor of all numbers written on the vertices on the path from the root to *x*, including this vertex itself. In addition, Ilya can change the number in one arbitrary vertex to 0 or leave all vertices unchanged. Now for each vertex Ilya wants to know the maximum possible beauty it can have.
For each vertex the answer must be considered independently.
The beauty of the root equals to number written on it.
Input Specification:
First line contains one integer number *n* — the number of vertices in tree (1<=≤<=*n*<=≤<=2·105).
Next line contains *n* integer numbers *a**i* (1<=≤<=*i*<=≤<=*n*, 1<=≤<=*a**i*<=≤<=2·105).
Each of next *n*<=-<=1 lines contains two integer numbers *x* and *y* (1<=≤<=*x*,<=*y*<=≤<=*n*, *x*<=≠<=*y*), which means that there is an edge (*x*,<=*y*) in the tree.
Output Specification:
Output *n* numbers separated by spaces, where *i*-th number equals to maximum possible beauty of vertex *i*.
Demo Input:
['2\n6 2\n1 2\n', '3\n6 2 3\n1 2\n1 3\n', '1\n10\n']
Demo Output:
['6 6 \n', '6 6 6 \n', '10 \n']
Note:
none
|
```python
n = int(input())
A = list(map(int,input().split()))
from collections import defaultdict
d = defaultdict(list)
for i in range(n-1):
a,b = map(int,input().split())
a,b = a-1,b-1
d[a].append(b)
d[b].append(a)
parent = [None]*n
parent[0] = 0
stack = [0]
while stack:
v = stack.pop()
for u in d[v]:
if parent[u] is None:
parent[u] = v
stack.append(u)
stack = d[0]
L = [None]*n
L[0] = (A[0],0)
# unchanged : one 0ed
from fractions import gcd
while stack:
v = stack.pop()
a = A[v]
x,y = L[parent[v]]
L[v] = (gcd(x,a), max(x, gcd(y,a)))
for u in d[v]:
if L[u] is None:
stack.append(u)
print(' '.join(map(str,map(max,L))))
```
| 0
|
|
380
|
C
|
Sereja and Brackets
|
PROGRAMMING
| 2,000
|
[
"data structures",
"schedules"
] | null | null |
Sereja has a bracket sequence *s*1,<=*s*2,<=...,<=*s**n*, or, in other words, a string *s* of length *n*, consisting of characters "(" and ")".
Sereja needs to answer *m* queries, each of them is described by two integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). The answer to the *i*-th query is the length of the maximum correct bracket subsequence of sequence *s**l**i*,<=*s**l**i*<=+<=1,<=...,<=*s**r**i*. Help Sereja answer all queries.
You can find the definitions for a subsequence and a correct bracket sequence in the notes.
|
The first line contains a sequence of characters *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*n*<=≤<=106) without any spaces. Each character is either a "(" or a ")". The second line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains a pair of integers. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*) — the description of the *i*-th query.
|
Print the answer to each question on a single line. Print the answers in the order they go in the input.
|
[
"())(())(())(\n7\n1 1\n2 3\n1 2\n1 12\n8 12\n5 11\n2 10\n"
] |
[
"0\n0\n2\n10\n4\n6\n6\n"
] |
A subsequence of length |*x*| of string *s* = *s*<sub class="lower-index">1</sub>*s*<sub class="lower-index">2</sub>... *s*<sub class="lower-index">|*s*|</sub> (where |*s*| is the length of string *s*) is string *x* = *s*<sub class="lower-index">*k*<sub class="lower-index">1</sub></sub>*s*<sub class="lower-index">*k*<sub class="lower-index">2</sub></sub>... *s*<sub class="lower-index">*k*<sub class="lower-index">|*x*|</sub></sub> (1 ≤ *k*<sub class="lower-index">1</sub> < *k*<sub class="lower-index">2</sub> < ... < *k*<sub class="lower-index">|*x*|</sub> ≤ |*s*|).
A correct bracket sequence is a bracket sequence that can be transformed into a correct aryphmetic expression by inserting characters "1" and "+" between the characters of the string. For example, bracket sequences "()()", "(())" are correct (the resulting expressions "(1)+(1)", "((1+1)+1)"), and ")(" and "(" are not.
For the third query required sequence will be «()».
For the fourth query required sequence will be «()(())(())».
| 1,500
|
[
{
"input": "())(())(())(\n7\n1 1\n2 3\n1 2\n1 12\n8 12\n5 11\n2 10",
"output": "0\n0\n2\n10\n4\n6\n6"
},
{
"input": "(((((()((((((((((()((()(((((\n1\n8 15",
"output": "0"
},
{
"input": "((()((())(((((((((()(()(()(((((((((((((((()(()((((((((((((((()(((((((((((((((((((()(((\n39\n28 56\n39 46\n57 63\n29 48\n51 75\n14 72\n5 70\n51 73\n10 64\n31 56\n50 54\n15 78\n78 82\n1 11\n1 70\n1 19\n10 22\n13 36\n3 10\n34 40\n51 76\n64 71\n36 75\n24 71\n1 63\n5 14\n46 67\n32 56\n39 43\n43 56\n61 82\n2 78\n1 21\n10 72\n49 79\n12 14\n53 79\n15 31\n7 47",
"output": "4\n4\n2\n4\n2\n12\n16\n2\n12\n4\n0\n12\n0\n6\n18\n6\n2\n6\n6\n0\n2\n0\n6\n8\n18\n4\n2\n4\n2\n2\n2\n18\n8\n12\n2\n0\n2\n6\n12"
},
{
"input": "))(()))))())())))))())((()()))))()))))))))))))\n9\n26 42\n21 22\n6 22\n7 26\n43 46\n25 27\n32 39\n22 40\n2 45",
"output": "4\n0\n6\n8\n0\n2\n2\n10\n20"
},
{
"input": "(()((((()(())((((((((()((((((()((((\n71\n15 29\n17 18\n5 26\n7 10\n16 31\n26 35\n2 30\n16 24\n2 24\n7 12\n15 18\n12 13\n25 30\n1 30\n12 13\n16 20\n6 35\n20 28\n18 23\n9 31\n12 35\n14 17\n8 16\n3 10\n12 33\n7 19\n2 33\n7 17\n21 27\n10 30\n29 32\n9 28\n18 32\n28 31\n31 33\n4 26\n15 27\n10 17\n8 14\n11 28\n8 23\n17 33\n4 14\n3 6\n6 34\n19 23\n4 21\n16 27\n14 27\n6 19\n31 32\n29 32\n9 17\n1 21\n2 31\n18 29\n16 26\n15 18\n4 5\n13 20\n9 28\n18 30\n1 32\n2 9\n16 24\n1 20\n4 15\n16 23\n19 34\n5 22\n5 23",
"output": "2\n0\n8\n2\n4\n2\n10\n2\n10\n4\n0\n0\n0\n10\n0\n0\n10\n2\n2\n8\n4\n0\n6\n2\n4\n6\n12\n6\n2\n6\n2\n6\n4\n2\n0\n8\n2\n4\n6\n4\n8\n4\n6\n0\n10\n2\n6\n2\n2\n6\n0\n2\n4\n8\n12\n2\n2\n0\n0\n0\n6\n2\n12\n4\n2\n8\n6\n2\n4\n6\n8"
},
{
"input": "(((())((((()()((((((()((()(((((((((((()((\n6\n20 37\n28 32\n12 18\n7 25\n21 33\n4 5",
"output": "4\n0\n2\n6\n4\n2"
},
{
"input": "(((()((((()()()(()))((((()(((()))()((((()))()((())\n24\n37 41\n13 38\n31 34\n14 16\n29 29\n12 46\n1 26\n15 34\n8 47\n11 23\n6 32\n2 22\n9 27\n17 40\n6 15\n4 49\n12 33\n3 48\n22 47\n19 48\n10 27\n23 25\n4 44\n27 48",
"output": "2\n16\n0\n2\n0\n26\n16\n12\n30\n8\n18\n14\n14\n12\n6\n34\n16\n32\n18\n18\n12\n0\n30\n16"
},
{
"input": ")()((((((((((((((((()(((()()(()((((((()(((((((()()))((((())(((((((((()(((((((((\n51\n29 53\n31 69\n54 59\n3 52\n26 46\n14 62\n6 54\n39 56\n17 27\n46 74\n60 72\n18 26\n38 46\n4 27\n22 52\n44 49\n42 77\n2 20\n39 57\n61 70\n33 54\n10 30\n67 70\n46 66\n17 77\n5 52\n33 77\n26 32\n1 72\n40 78\n38 68\n19 47\n30 53\n19 29\n52 71\n1 11\n22 53\n17 42\n2 51\n4 12\n24 76\n22 34\n21 69\n11 69\n36 52\n17 31\n57 58\n54 62\n23 71\n5 46\n51 53",
"output": "12\n14\n4\n18\n6\n22\n18\n8\n4\n12\n2\n4\n2\n4\n16\n2\n14\n2\n8\n2\n10\n6\n2\n10\n24\n18\n16\n4\n26\n14\n14\n10\n12\n6\n6\n2\n16\n10\n18\n0\n22\n6\n20\n22\n10\n8\n2\n4\n22\n10\n0"
},
{
"input": "(\n1\n1 1",
"output": "0"
},
{
"input": ")\n1\n1 1",
"output": "0"
},
{
"input": "()\n1\n1 2",
"output": "2"
},
{
"input": ")(\n1\n1 2",
"output": "0"
}
] | 1,665,738,723
| 2,147,483,647
|
PyPy 3-64
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
// Problem Source http://codeforces.com/contest/380/problem/C
#include <iostream>
#include <string>
#include <algorithm>
#include <vector>
#include <cstdio>
using namespace std;
struct Node {
int open; // spare bracket
int close; // spare bracket
int optimal; // good bracket
};
string inp;
vector<Node> tree;
Node createNode(int open, int close, int optimal) {
Node tmp;
tmp.open = open;
tmp.close = close;
tmp.optimal = optimal;
return tmp;
}
Node mergeNode(const Node& nodeL, const Node& nodeR) {
int tmp = min(nodeL.open, nodeR.close);
return createNode(
nodeL.open + nodeR.open - tmp,
nodeL.close + nodeR.close - tmp,
nodeL.optimal + nodeR.optimal + tmp
);
}
void build(int l, int r, int id) {
// cout << "l: " << l << " r: " << r << " id: " << id << endl;
if (l > r) return;
if (l == r) {
if (inp[r] == '(') {
tree[id] = createNode(1, 0, 0);
} else {
tree[id] = createNode(0, 1, 0);
}
return;
}
int mid = (l + r) / 2;
build(l, mid, 2 * id + 1);
build(mid + 1, r, 2 * id + 2);
tree[id] = mergeNode(tree[2 * id + 1], tree[2 * id + 2]);
}
Node getNode(int st, int en, int l, int r, int id) {
if (l > r) return createNode(0, 0, 0);
if (st > r || en < l) return createNode(0, 0, 0);
if (st <= l && r <= en) {
return tree[id];
}
int mid = (l + r) / 2;
return mergeNode(
getNode(st, en, l, mid, 2 * id + 1),
getNode(st, en, mid + 1, r, 2 * id + 2)
);
}
int main() {
ios_base::sync_with_stdio(0);cin.tie(0);cout.tie(0);
// freopen("inputC.txt", "r", stdin);
cin >> inp;
// inp = "())(())(())(";
// cout << inp << endl;
tree.resize(4 * inp.size());
build(0, inp.size() - 1, 0);
// cout << "OK";
int t, st, en;
// int tmp = getNode(0, 5, 0, inp.size() - 1, 0).optimal * 2;
// cout << tmp;
cin >> t;
while (t--) {
cin >> st >> en;
cout << st << ' ' << en << endl;
cout << getNode(st-1, en-1, 0, inp.size() - 1, 0).optimal * 2;
}
return 0;
}
|
Title: Sereja and Brackets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja has a bracket sequence *s*1,<=*s*2,<=...,<=*s**n*, or, in other words, a string *s* of length *n*, consisting of characters "(" and ")".
Sereja needs to answer *m* queries, each of them is described by two integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). The answer to the *i*-th query is the length of the maximum correct bracket subsequence of sequence *s**l**i*,<=*s**l**i*<=+<=1,<=...,<=*s**r**i*. Help Sereja answer all queries.
You can find the definitions for a subsequence and a correct bracket sequence in the notes.
Input Specification:
The first line contains a sequence of characters *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*n*<=≤<=106) without any spaces. Each character is either a "(" or a ")". The second line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains a pair of integers. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*) — the description of the *i*-th query.
Output Specification:
Print the answer to each question on a single line. Print the answers in the order they go in the input.
Demo Input:
['())(())(())(\n7\n1 1\n2 3\n1 2\n1 12\n8 12\n5 11\n2 10\n']
Demo Output:
['0\n0\n2\n10\n4\n6\n6\n']
Note:
A subsequence of length |*x*| of string *s* = *s*<sub class="lower-index">1</sub>*s*<sub class="lower-index">2</sub>... *s*<sub class="lower-index">|*s*|</sub> (where |*s*| is the length of string *s*) is string *x* = *s*<sub class="lower-index">*k*<sub class="lower-index">1</sub></sub>*s*<sub class="lower-index">*k*<sub class="lower-index">2</sub></sub>... *s*<sub class="lower-index">*k*<sub class="lower-index">|*x*|</sub></sub> (1 ≤ *k*<sub class="lower-index">1</sub> < *k*<sub class="lower-index">2</sub> < ... < *k*<sub class="lower-index">|*x*|</sub> ≤ |*s*|).
A correct bracket sequence is a bracket sequence that can be transformed into a correct aryphmetic expression by inserting characters "1" and "+" between the characters of the string. For example, bracket sequences "()()", "(())" are correct (the resulting expressions "(1)+(1)", "((1+1)+1)"), and ")(" and "(" are not.
For the third query required sequence will be «()».
For the fourth query required sequence will be «()(())(())».
|
```python
// Problem Source http://codeforces.com/contest/380/problem/C
#include <iostream>
#include <string>
#include <algorithm>
#include <vector>
#include <cstdio>
using namespace std;
struct Node {
int open; // spare bracket
int close; // spare bracket
int optimal; // good bracket
};
string inp;
vector<Node> tree;
Node createNode(int open, int close, int optimal) {
Node tmp;
tmp.open = open;
tmp.close = close;
tmp.optimal = optimal;
return tmp;
}
Node mergeNode(const Node& nodeL, const Node& nodeR) {
int tmp = min(nodeL.open, nodeR.close);
return createNode(
nodeL.open + nodeR.open - tmp,
nodeL.close + nodeR.close - tmp,
nodeL.optimal + nodeR.optimal + tmp
);
}
void build(int l, int r, int id) {
// cout << "l: " << l << " r: " << r << " id: " << id << endl;
if (l > r) return;
if (l == r) {
if (inp[r] == '(') {
tree[id] = createNode(1, 0, 0);
} else {
tree[id] = createNode(0, 1, 0);
}
return;
}
int mid = (l + r) / 2;
build(l, mid, 2 * id + 1);
build(mid + 1, r, 2 * id + 2);
tree[id] = mergeNode(tree[2 * id + 1], tree[2 * id + 2]);
}
Node getNode(int st, int en, int l, int r, int id) {
if (l > r) return createNode(0, 0, 0);
if (st > r || en < l) return createNode(0, 0, 0);
if (st <= l && r <= en) {
return tree[id];
}
int mid = (l + r) / 2;
return mergeNode(
getNode(st, en, l, mid, 2 * id + 1),
getNode(st, en, mid + 1, r, 2 * id + 2)
);
}
int main() {
ios_base::sync_with_stdio(0);cin.tie(0);cout.tie(0);
// freopen("inputC.txt", "r", stdin);
cin >> inp;
// inp = "())(())(())(";
// cout << inp << endl;
tree.resize(4 * inp.size());
build(0, inp.size() - 1, 0);
// cout << "OK";
int t, st, en;
// int tmp = getNode(0, 5, 0, inp.size() - 1, 0).optimal * 2;
// cout << tmp;
cin >> t;
while (t--) {
cin >> st >> en;
cout << st << ' ' << en << endl;
cout << getNode(st-1, en-1, 0, inp.size() - 1, 0).optimal * 2;
}
return 0;
}
```
| -1
|
|
771
|
B
|
Bear and Different Names
|
PROGRAMMING
| 1,500
|
[
"constructive algorithms",
"greedy"
] | null | null |
In the army, it isn't easy to form a group of soldiers that will be effective on the battlefield. The communication is crucial and thus no two soldiers should share a name (what would happen if they got an order that Bob is a scouter, if there are two Bobs?).
A group of soldiers is effective if and only if their names are different. For example, a group (John, Bob, Limak) would be effective, while groups (Gary, Bob, Gary) and (Alice, Alice) wouldn't.
You are a spy in the enemy's camp. You noticed *n* soldiers standing in a row, numbered 1 through *n*. The general wants to choose a group of *k* consecutive soldiers. For every *k* consecutive soldiers, the general wrote down whether they would be an effective group or not.
You managed to steal the general's notes, with *n*<=-<=*k*<=+<=1 strings *s*1,<=*s*2,<=...,<=*s**n*<=-<=*k*<=+<=1, each either "YES" or "NO".
- The string *s*1 describes a group of soldiers 1 through *k* ("YES" if the group is effective, and "NO" otherwise). - The string *s*2 describes a group of soldiers 2 through *k*<=+<=1. - And so on, till the string *s**n*<=-<=*k*<=+<=1 that describes a group of soldiers *n*<=-<=*k*<=+<=1 through *n*.
Your task is to find possible names of *n* soldiers. Names should match the stolen notes. Each name should be a string that consists of between 1 and 10 English letters, inclusive. The first letter should be uppercase, and all other letters should be lowercase. Names don't have to be existing names — it's allowed to print "Xyzzzdj" or "T" for example.
Find and print any solution. It can be proved that there always exists at least one solution.
|
The first line of the input contains two integers *n* and *k* (2<=≤<=*k*<=≤<=*n*<=≤<=50) — the number of soldiers and the size of a group respectively.
The second line contains *n*<=-<=*k*<=+<=1 strings *s*1,<=*s*2,<=...,<=*s**n*<=-<=*k*<=+<=1. The string *s**i* is "YES" if the group of soldiers *i* through *i*<=+<=*k*<=-<=1 is effective, and "NO" otherwise.
|
Find any solution satisfying all given conditions. In one line print *n* space-separated strings, denoting possible names of soldiers in the order. The first letter of each name should be uppercase, while the other letters should be lowercase. Each name should contain English letters only and has length from 1 to 10.
If there are multiple valid solutions, print any of them.
|
[
"8 3\nNO NO YES YES YES NO\n",
"9 8\nYES NO\n",
"3 2\nNO NO\n"
] |
[
"Adam Bob Bob Cpqepqwer Limak Adam Bob Adam",
"R Q Ccccccccc Ccocc Ccc So Strong Samples Ccc",
"Na Na Na"
] |
In the first sample, there are 8 soldiers. For every 3 consecutive ones we know whether they would be an effective group. Let's analyze the provided sample output:
- First three soldiers (i.e. Adam, Bob, Bob) wouldn't be an effective group because there are two Bobs. Indeed, the string *s*<sub class="lower-index">1</sub> is "NO". - Soldiers 2 through 4 (Bob, Bob, Cpqepqwer) wouldn't be effective either, and the string *s*<sub class="lower-index">2</sub> is "NO". - Soldiers 3 through 5 (Bob, Cpqepqwer, Limak) would be effective, and the string *s*<sub class="lower-index">3</sub> is "YES". - ..., - Soldiers 6 through 8 (Adam, Bob, Adam) wouldn't be effective, and the string *s*<sub class="lower-index">6</sub> is "NO".
| 500
|
[
{
"input": "8 3\nNO NO YES YES YES NO",
"output": "Ab Ac Ab Ac Af Ag Ah Ag "
},
{
"input": "9 8\nYES NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Ac "
},
{
"input": "3 2\nNO NO",
"output": "Ab Ab Ab "
},
{
"input": "2 2\nYES",
"output": "Ab Ac "
},
{
"input": "2 2\nNO",
"output": "Ab Ab "
},
{
"input": "7 2\nYES NO YES YES NO YES",
"output": "Ab Ac Ac Ae Af Af Ah "
},
{
"input": "18 7\nYES YES YES YES YES YES YES NO NO NO NO NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ai Aj Ak Al Am "
},
{
"input": "50 3\nNO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO YES NO",
"output": "Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Bx Ac "
},
{
"input": "19 15\nNO YES YES YES NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ab Aq Ar As Af "
},
{
"input": "3 2\nNO NO",
"output": "Ab Ab Ab "
},
{
"input": "3 2\nNO YES",
"output": "Ab Ab Ad "
},
{
"input": "3 2\nYES NO",
"output": "Ab Ac Ac "
},
{
"input": "3 2\nYES YES",
"output": "Ab Ac Ad "
},
{
"input": "26 17\nNO YES YES YES NO YES NO YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ab As At Au Af Aw Ah Ay Az Ba "
},
{
"input": "12 2\nYES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am "
},
{
"input": "16 2\nNO NO NO NO NO NO NO NO NO NO NO NO NO NO NO",
"output": "Ab Ab Ab Ab Ab Ab Ab Ab Ab Ab Ab Ab Ab Ab Ab Ab "
},
{
"input": "42 20\nYES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq "
},
{
"input": "37 14\nNO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al "
},
{
"input": "29 10\nYES NO YES NO YES NO YES YES YES YES YES NO NO NO NO NO YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Ac Am Ae Ao Ag Aq Ar As At Au Am Ae Ao Ag Aq Ba Bb Bc Bd "
},
{
"input": "37 3\nYES NO YES NO YES NO YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES NO NO YES NO NO YES YES YES YES NO",
"output": "Ab Ac Ad Ac Af Ac Ah Ac Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Ba Bb Be Bb Be Bh Bi Bj Bk Bj "
},
{
"input": "44 11\nNO NO YES NO YES NO YES YES YES YES YES YES YES YES YES YES YES YES YES NO YES YES YES YES YES NO NO YES NO NO YES YES YES NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Ab Ac An Ae Ap Ag Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Au Bf Bg Bh Bi Bj Ba Bb Bm Bd Au Bp Bq Br Bi "
},
{
"input": "50 49\nNO YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Ab By "
},
{
"input": "50 49\nYES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx By "
},
{
"input": "50 49\nNO NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Ab Ac "
},
{
"input": "50 49\nYES NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx Ac "
},
{
"input": "46 42\nNO YES YES YES NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Ab Br Bs Bt Af "
},
{
"input": "45 26\nYES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt "
},
{
"input": "45 26\nNO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au "
},
{
"input": "50 3\nNO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES",
"output": "Ab Ac Ab Ae Ab Ag Ab Ai Ab Ak Ab Am Ab Ao Ab Aq Ab As Ab Au Ab Aw Ab Ay Ab Ba Ab Bc Ab Be Ab Bg Ab Bi Ab Bk Ab Bm Ab Bo Ab Bq Ab Bs Ab Bu Ab Bw Ab By "
},
{
"input": "50 2\nNO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO",
"output": "Ab Ab Ad Ad Af Af Ah Ah Aj Aj Al Al An An Ap Ap Ar Ar At At Av Av Ax Ax Az Az Bb Bb Bd Bd Bf Bf Bh Bh Bj Bj Bl Bl Bn Bn Bp Bp Br Br Bt Bt Bv Bv Bx Bx "
},
{
"input": "50 3\nNO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES YES YES YES YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES",
"output": "Ab Ac Ab Ae Ab Ag Ab Ai Ab Ak Ab Am Ab Ao Ab Aq Ab As Ab Au Ab Aw Ab Ay Ab Ba Ab Bc Bd Be Bf Bg Bf Bi Bf Bk Bf Bm Bf Bo Bf Bq Bf Bs Bf Bu Bf Bw Bf By "
},
{
"input": "49 2\nNO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO NO NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES",
"output": "Ab Ab Ad Ad Af Af Ah Ah Aj Aj Al Al An An Ap Ap Ar Ar At At Av Av Ax Ax Ax Ax Bb Bb Bd Bd Bf Bf Bh Bh Bj Bj Bl Bl Bn Bn Bp Bp Br Br Bt Bt Bv Bv Bx "
},
{
"input": "35 22\nNO NO NO NO NO NO NO NO NO NO NO NO NO NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao "
},
{
"input": "46 41\nYES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu "
},
{
"input": "12 4\nYES YES NO NO NO NO NO YES YES",
"output": "Ab Ac Ad Ae Af Ad Ae Af Ad Ae Al Am "
},
{
"input": "50 2\nYES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx By "
},
{
"input": "50 4\nYES YES YES YES YES NO YES YES YES YES NO NO YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES NO YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Ag Ak Al Am An Al Am Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bc Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx By "
},
{
"input": "34 5\nYES YES YES YES YES NO YES YES YES YES NO NO YES YES YES NO NO YES NO YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ag Al Am An Ao Al Am Ar As At Am Ar Aw At Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi "
},
{
"input": "50 43\nYES NO YES NO YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Ac Bt Ae Bv Bw Bx By "
},
{
"input": "38 30\nNO NO YES NO YES NO NO NO NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Ab Ac Bg Ae Bi Ag Ah Ai Aj "
},
{
"input": "50 50\nNO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx Ab "
},
{
"input": "50 50\nYES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx By "
},
{
"input": "5 3\nYES NO YES",
"output": "Ab Ac Ad Ac Af "
},
{
"input": "30 2\nYES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be "
},
{
"input": "50 50\nYES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx By "
},
{
"input": "27 27\nYES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb "
},
{
"input": "28 2\nYES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc "
},
{
"input": "50 2\nYES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx By "
},
{
"input": "8 3\nYES NO YES NO YES NO",
"output": "Ab Ac Ad Ac Af Ac Ah Ac "
},
{
"input": "42 30\nNO YES YES NO NO YES NO YES NO YES NO NO YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Ab Bf Bg Ae Af Bj Ah Bl Aj Bn Al Am Bq "
},
{
"input": "50 49\nYES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx By "
},
{
"input": "50 3\nYES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx By "
},
{
"input": "7 5\nYES NO YES",
"output": "Ab Ac Ad Ae Af Ac Ah "
},
{
"input": "8 4\nNO YES NO YES NO",
"output": "Ab Ac Ad Ab Af Ad Ah Af "
},
{
"input": "50 50\nNO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx Ab "
},
{
"input": "50 48\nYES NO YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Ac By "
},
{
"input": "29 14\nYES NO YES NO NO YES YES NO NO YES YES NO NO YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ac Aq Ae Af At Au Ai Aj Ax Ay Am An Bb Bc Bd "
},
{
"input": "10 3\nNO YES NO YES NO YES NO YES",
"output": "Ab Ac Ab Ae Ab Ag Ab Ai Ab Ak "
},
{
"input": "10 5\nYES NO YES NO YES NO",
"output": "Ab Ac Ad Ae Af Ac Ah Ae Aj Ac "
}
] | 1,643,738,127
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 16
| 62
| 0
|
n,k=map(int,input().split())
a=input().split()
ans=[]
for i in range(n):
if i<26:
ans.append(chr(i+65))
else:
ans.append('Anubhab'+chr(i+65))
for i in range(n-k+1):
if a[i]=='NO':
ans[i+k-1]=ans[i]
print(*ans)
|
Title: Bear and Different Names
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the army, it isn't easy to form a group of soldiers that will be effective on the battlefield. The communication is crucial and thus no two soldiers should share a name (what would happen if they got an order that Bob is a scouter, if there are two Bobs?).
A group of soldiers is effective if and only if their names are different. For example, a group (John, Bob, Limak) would be effective, while groups (Gary, Bob, Gary) and (Alice, Alice) wouldn't.
You are a spy in the enemy's camp. You noticed *n* soldiers standing in a row, numbered 1 through *n*. The general wants to choose a group of *k* consecutive soldiers. For every *k* consecutive soldiers, the general wrote down whether they would be an effective group or not.
You managed to steal the general's notes, with *n*<=-<=*k*<=+<=1 strings *s*1,<=*s*2,<=...,<=*s**n*<=-<=*k*<=+<=1, each either "YES" or "NO".
- The string *s*1 describes a group of soldiers 1 through *k* ("YES" if the group is effective, and "NO" otherwise). - The string *s*2 describes a group of soldiers 2 through *k*<=+<=1. - And so on, till the string *s**n*<=-<=*k*<=+<=1 that describes a group of soldiers *n*<=-<=*k*<=+<=1 through *n*.
Your task is to find possible names of *n* soldiers. Names should match the stolen notes. Each name should be a string that consists of between 1 and 10 English letters, inclusive. The first letter should be uppercase, and all other letters should be lowercase. Names don't have to be existing names — it's allowed to print "Xyzzzdj" or "T" for example.
Find and print any solution. It can be proved that there always exists at least one solution.
Input Specification:
The first line of the input contains two integers *n* and *k* (2<=≤<=*k*<=≤<=*n*<=≤<=50) — the number of soldiers and the size of a group respectively.
The second line contains *n*<=-<=*k*<=+<=1 strings *s*1,<=*s*2,<=...,<=*s**n*<=-<=*k*<=+<=1. The string *s**i* is "YES" if the group of soldiers *i* through *i*<=+<=*k*<=-<=1 is effective, and "NO" otherwise.
Output Specification:
Find any solution satisfying all given conditions. In one line print *n* space-separated strings, denoting possible names of soldiers in the order. The first letter of each name should be uppercase, while the other letters should be lowercase. Each name should contain English letters only and has length from 1 to 10.
If there are multiple valid solutions, print any of them.
Demo Input:
['8 3\nNO NO YES YES YES NO\n', '9 8\nYES NO\n', '3 2\nNO NO\n']
Demo Output:
['Adam Bob Bob Cpqepqwer Limak Adam Bob Adam', 'R Q Ccccccccc Ccocc Ccc So Strong Samples Ccc', 'Na Na Na']
Note:
In the first sample, there are 8 soldiers. For every 3 consecutive ones we know whether they would be an effective group. Let's analyze the provided sample output:
- First three soldiers (i.e. Adam, Bob, Bob) wouldn't be an effective group because there are two Bobs. Indeed, the string *s*<sub class="lower-index">1</sub> is "NO". - Soldiers 2 through 4 (Bob, Bob, Cpqepqwer) wouldn't be effective either, and the string *s*<sub class="lower-index">2</sub> is "NO". - Soldiers 3 through 5 (Bob, Cpqepqwer, Limak) would be effective, and the string *s*<sub class="lower-index">3</sub> is "YES". - ..., - Soldiers 6 through 8 (Adam, Bob, Adam) wouldn't be effective, and the string *s*<sub class="lower-index">6</sub> is "NO".
|
```python
n,k=map(int,input().split())
a=input().split()
ans=[]
for i in range(n):
if i<26:
ans.append(chr(i+65))
else:
ans.append('Anubhab'+chr(i+65))
for i in range(n-k+1):
if a[i]=='NO':
ans[i+k-1]=ans[i]
print(*ans)
```
| 0
|
|
572
|
A
|
Arrays
|
PROGRAMMING
| 900
|
[
"sortings"
] | null | null |
You are given two arrays *A* and *B* consisting of integers, sorted in non-decreasing order. Check whether it is possible to choose *k* numbers in array *A* and choose *m* numbers in array *B* so that any number chosen in the first array is strictly less than any number chosen in the second array.
|
The first line contains two integers *n**A*,<=*n**B* (1<=≤<=*n**A*,<=*n**B*<=≤<=105), separated by a space — the sizes of arrays *A* and *B*, correspondingly.
The second line contains two integers *k* and *m* (1<=≤<=*k*<=≤<=*n**A*,<=1<=≤<=*m*<=≤<=*n**B*), separated by a space.
The third line contains *n**A* numbers *a*1,<=*a*2,<=... *a**n**A* (<=-<=109<=≤<=*a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n**A*<=≤<=109), separated by spaces — elements of array *A*.
The fourth line contains *n**B* integers *b*1,<=*b*2,<=... *b**n**B* (<=-<=109<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**n**B*<=≤<=109), separated by spaces — elements of array *B*.
|
Print "YES" (without the quotes), if you can choose *k* numbers in array *A* and *m* numbers in array *B* so that any number chosen in array *A* was strictly less than any number chosen in array *B*. Otherwise, print "NO" (without the quotes).
|
[
"3 3\n2 1\n1 2 3\n3 4 5\n",
"3 3\n3 3\n1 2 3\n3 4 5\n",
"5 2\n3 1\n1 1 1 1 1\n2 2\n"
] |
[
"YES\n",
"NO\n",
"YES\n"
] |
In the first sample test you can, for example, choose numbers 1 and 2 from array *A* and number 3 from array *B* (1 < 3 and 2 < 3).
In the second sample test the only way to choose *k* elements in the first array and *m* elements in the second one is to choose all numbers in both arrays, but then not all the numbers chosen in *A* will be less than all the numbers chosen in *B*: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7280148ed5eab0a7d418d4f92b32061243a8ca58.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
| 500
|
[
{
"input": "3 3\n2 1\n1 2 3\n3 4 5",
"output": "YES"
},
{
"input": "3 3\n3 3\n1 2 3\n3 4 5",
"output": "NO"
},
{
"input": "5 2\n3 1\n1 1 1 1 1\n2 2",
"output": "YES"
},
{
"input": "3 5\n1 1\n5 5 5\n5 5 5 5 5",
"output": "NO"
},
{
"input": "1 1\n1 1\n1\n1",
"output": "NO"
},
{
"input": "3 3\n1 1\n1 2 3\n1 2 3",
"output": "YES"
},
{
"input": "3 3\n1 2\n1 2 3\n1 2 3",
"output": "YES"
},
{
"input": "3 3\n2 2\n1 2 3\n1 2 3",
"output": "NO"
},
{
"input": "10 15\n10 1\n1 1 5 17 22 29 32 36 39 48\n9 10 20 23 26 26 32 32 33 39 43 45 47 49 49",
"output": "YES"
},
{
"input": "10 15\n1 15\n91 91 91 92 92 94 94 95 98 100\n92 92 93 93 93 94 95 96 97 98 98 99 99 100 100",
"output": "YES"
},
{
"input": "15 10\n12 5\n9 25 25 32 32 38 40 41 46 46 48 51 64 64 73\n5 14 30 35 50 52 67 79 89 99",
"output": "YES"
},
{
"input": "15 10\n4 10\n22 32 35 45 45 50 51 55 79 80 83 88 90 92 93\n46 48 52 55 60 60 68 75 80 81",
"output": "YES"
},
{
"input": "20 30\n2 8\n6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 10 10 10 10 10\n1 1 2 2 2 2 2 2 2 3 3 4 5 5 5 5 6 6 6 6 6 6 7 7 7 8 8 9 10 10",
"output": "NO"
},
{
"input": "20 30\n19 29\n1 1 2 2 2 3 4 4 7 7 7 8 8 8 8 8 9 9 9 9\n6 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "NO"
},
{
"input": "1 1\n1 1\n-1000000000\n30",
"output": "YES"
},
{
"input": "3 3\n1 3\n1 3 3\n3 3 3",
"output": "YES"
},
{
"input": "3 3\n1 1\n3 3 3\n2 2 2",
"output": "NO"
},
{
"input": "5 5\n3 3\n1 5 6 7 8\n1 2 5 6 7",
"output": "NO"
},
{
"input": "3 4\n2 2\n5 6 7\n1 2 3 4",
"output": "NO"
},
{
"input": "3 3\n3 3\n1 2 3\n4 5 6",
"output": "YES"
},
{
"input": "5 5\n4 5\n2 2 3 4 5\n5 6 7 8 9",
"output": "YES"
}
] | 1,441,671,055
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 52
| 77
| 7,782,400
|
def main():
a, b = map(int, input().split())
k, m = map(int, input().split())
print(("NO", "YES")[k <= a and m <= b and int(input().split()[k - 1]) < int(input().split()[-m])])
if __name__ == '__main__':
main()
|
Title: Arrays
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two arrays *A* and *B* consisting of integers, sorted in non-decreasing order. Check whether it is possible to choose *k* numbers in array *A* and choose *m* numbers in array *B* so that any number chosen in the first array is strictly less than any number chosen in the second array.
Input Specification:
The first line contains two integers *n**A*,<=*n**B* (1<=≤<=*n**A*,<=*n**B*<=≤<=105), separated by a space — the sizes of arrays *A* and *B*, correspondingly.
The second line contains two integers *k* and *m* (1<=≤<=*k*<=≤<=*n**A*,<=1<=≤<=*m*<=≤<=*n**B*), separated by a space.
The third line contains *n**A* numbers *a*1,<=*a*2,<=... *a**n**A* (<=-<=109<=≤<=*a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n**A*<=≤<=109), separated by spaces — elements of array *A*.
The fourth line contains *n**B* integers *b*1,<=*b*2,<=... *b**n**B* (<=-<=109<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**n**B*<=≤<=109), separated by spaces — elements of array *B*.
Output Specification:
Print "YES" (without the quotes), if you can choose *k* numbers in array *A* and *m* numbers in array *B* so that any number chosen in array *A* was strictly less than any number chosen in array *B*. Otherwise, print "NO" (without the quotes).
Demo Input:
['3 3\n2 1\n1 2 3\n3 4 5\n', '3 3\n3 3\n1 2 3\n3 4 5\n', '5 2\n3 1\n1 1 1 1 1\n2 2\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
In the first sample test you can, for example, choose numbers 1 and 2 from array *A* and number 3 from array *B* (1 < 3 and 2 < 3).
In the second sample test the only way to choose *k* elements in the first array and *m* elements in the second one is to choose all numbers in both arrays, but then not all the numbers chosen in *A* will be less than all the numbers chosen in *B*: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7280148ed5eab0a7d418d4f92b32061243a8ca58.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
|
```python
def main():
a, b = map(int, input().split())
k, m = map(int, input().split())
print(("NO", "YES")[k <= a and m <= b and int(input().split()[k - 1]) < int(input().split()[-m])])
if __name__ == '__main__':
main()
```
| 3
|
|
802
|
G
|
Fake News (easy)
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
|
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
|
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
|
[
"abcheaibcdi\n",
"hiedi\n"
] |
[
"YES",
"NO"
] |
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
| 0
|
[
{
"input": "abcheaibcdi",
"output": "YES"
},
{
"input": "hiedi",
"output": "NO"
},
{
"input": "ihied",
"output": "NO"
},
{
"input": "diehi",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "iheid",
"output": "NO"
},
{
"input": "eihdi",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "edhii",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "eufyajkssayhjhqcwxmctecaeepjwmfoscqprpcxsqfwnlgzsmmuwuoruantipholrauvxydfvftwfzhnckxswussvlidcojiciflpvkcxkkcmmvtfvxrkwcpeelwsuzqgamamdtdgzscmikvojfvqehblmjczkvtdeymgertgkwfwfukafqlfdhtedcctixhyetdypswgagrpyto",
"output": "YES"
},
{
"input": "arfbvxgdvqzuloojjrwoyqqbxamxybaqltfimofulusfebodjkwwrgwcppkwiodtpjaraglyplgerrpqjkpoggjmfxhwtqrijpijrcyxnoodvwpyjfpvqaoazllbrpzananbrvvybboedidtuvqquklkpeflfaltukjhzjgiofombhbmqbihgtapswykfvlgdoapjqntvqsaohmbvnphvyyhvhavslamczuqifxnwknkaenqmlvetrqogqxmlptgrmqvxzdxdmwobjesmgxckpmawtioavwdngyiwkzypfnxcovwzdohshwlavwsthdssiadhiwmhpvgkrbezm",
"output": "YES"
},
{
"input": "zcectngbqnejjjtsfrluummmqabzqbyccshjqbrjthzhlbmzjfxugvjouwhumsgrnopiyakfadjnbsesamhynsbfbfunupwbxvohfmpwlcpxhovwpfpciclatgmiufwdvtsqrsdcymvkldpnhfeisrzhyhhlkwdzthgprvkpyldeysvbmcibqkpudyrraqdlxpjecvwcvuiklcrsbgvqasmxmtxqzmawcjtozioqlfflinnxpeexbzloaeqjvglbdeufultpjqexvjjjkzemtzuzmxvawilcqdrcjzpqyhtwfphuonzwkotthsaxrmwtnlmcdylxqcfffyndqeouztluqwlhnkkvzwcfiscikv",
"output": "YES"
},
{
"input": "plqaykgovxkvsiahdbglktdlhcqwelxxmtlyymrsyubxdskvyjkrowvcbpdofpjqspsrgpakdczletxujzlsegepzleipiyycpinzxgwjsgslnxsotouddgfcybozfpjhhocpybfjbaywsehbcfrayvancbrumdfngqytnhihyxnlvilrqyhnxeckprqafofelospffhtwguzjbbjlzbqrtiielbvzutzgpqxosiaqznndgobcluuqlhmffiowkjdlkokehtjdyjvmxsiyxureflmdomerfekxdvtitvwzmdsdzplkpbtafxqfpudnhfqpoiwvjnylanunmagoweobdvfjgepbsymfutrjarlxclhgavpytiiqwvojrptofuvlohzeguxdsrihsbucelhhuedltnnjgzxwyblbqvnoliiydfinzlogbvucwykryzcyibnniggbkdkdcdgcsbvvnavtyhtkanrblpvomvjs",
"output": "YES"
},
{
"input": "fbldqzggeunkpwcfirxanmntbfrudijltoertsdvcvcmbwodbibsrxendzebvxwydpasaqnisrijctsuatihxxygbeovhxjdptdcppkvfytdpjspvrannxavmkmisqtygntxkdlousdypyfkrpzapysfpdbyprufwzhunlsfugojddkmxzinatiwfxdqmgyrnjnxvrclhxyuwxtshoqdjptmeecvgmrlvuwqtmnfnfeeiwcavwnqmyustawbjodzwsqmnjxhpqmgpysierlwbbdzcwprpsexyvreewcmlbvaiytjlxdqdaqftefdlmtmmjcwvfejshymhnouoshdzqcwzxpzupkbcievodzqkqvyjuuxxwepxjalvkzufnveji",
"output": "YES"
},
{
"input": "htsyljgoelbbuipivuzrhmfpkgderqpoprlxdpasxhpmxvaztccldtmujjzjmcpdvsdghzpretlsyyiljhjznseaacruriufswuvizwwuvdioazophhyytvbiogttnnouauxllbdn",
"output": "YES"
},
{
"input": "ikmxzqdzxqlvgeojsnhqzciujslwjyzzexnregabdqztpplosdakimjxmuqccbnwvzbajoiqgdobccwnrwmixohrbdarhoeeelzbpigiybtesybwefpcfx",
"output": "YES"
},
{
"input": "bpvbpjvbdfiodsmahxpcubjxdykesubnypalhypantshkjffmxjmelblqnjdmtaltneuyudyevkgedkqrdmrfeemgpghwrifcwincfixokfgurhqbcfzeajrgkgpwqwsepudxulywowwxzdxkumsicsvnzfxspmjpaixgejeaoyoibegosqoyoydmphfpbutrrewyjecowjckvpcceoamtfbitdneuwqfvnagswlskmsmkhmxyfsrpqwhxzocyffiumcy",
"output": "YES"
},
{
"input": "vllsexwrazvlfvhvrtqeohvzzresjdiuhomfpgqcxpqdevplecuaepixhlijatxzegciizpvyvxuembiplwklahlqibykfideysjygagjbgqkbhdhkatddcwlxboinfuomnpc",
"output": "YES"
},
{
"input": "pnjdwpxmvfoqkjtbhquqcuredrkwqzzfjmdvpnbqtypzdovemhhclkvigjvtprrpzbrbcbatkucaqteuciuozytsptvsskkeplaxdaqmjkmef",
"output": "NO"
},
{
"input": "jpwfhvlxvsdhtuozvlmnfiotrgapgjxtcsgcjnodcztupysvvvmjpzqkpommadppdrykuqkcpzojcwvlogvkddedwbggkrhuvtsvdiokehlkdlnukcufjvqxnikcdawvexxwffxtriqbdmkahxdtygodzohwtdmmuvmatdkvweqvaehaxiefpevkvqpyxsrhtmgjsdfcwzqobibeduooldrmglbinrepmunizheqzvgqvpdskhxfidxfnbisyizhepwyrcykcmjxnkyfjgrqlkixcvysa",
"output": "YES"
},
{
"input": "aftcrvuumeqbfvaqlltscnuhkpcifrrhnutjinxdhhdbzvizlrapzjdatuaynoplgjketupgaejciosofuhcgcjdcucarfvtsofgubtphijciswsvidnvpztlaarydkeqxzwdhfbmullkimerukusbrdnnujviydldrwhdfllsjtziwfeaiqotbiprespmxjulnyunkdtcghrzvhtcychkwatqqmladxpvmvlkzscthylbzkpgwlzfjqwarqvdeyngekqvrhrftpxnkfcibbowvnqdkulcdydspcubwlgoyinpnzgidbgunparnueddzwtzdiavbprbbg",
"output": "YES"
},
{
"input": "oagjghsidigeh",
"output": "NO"
},
{
"input": "chdhzpfzabupskiusjoefrwmjmqkbmdgboicnszkhdrlegeqjsldurmbshijadlwsycselhlnudndpdhcnhruhhvsgbthpruiqfirxkhpqhzhqdfpyozolbionodypfcqfeqbkcgmqkizgeyyelzeoothexcoaahedgrvoemqcwccbvoeqawqeuusyjxmgjkpfwcdttfmwunzuwvsihliexlzygqcgpbdiawfvqukikhbjerjkyhpcknlndaystrgsinghlmekbvhntcpypmchcwoglsmwwdulqneuabuuuvtyrnjxfcgoothalwkzzfxakneusezgnnepkpipzromqubraiggqndliz",
"output": "YES"
},
{
"input": "lgirxqkrkgjcutpqitmffvbujcljkqardlalyigxorscczuzikoylcxenryhskoavymexysvmhbsvhtycjlmzhijpuvcjshyfeycvvcfyzytzoyvxajpqdjtfiatnvxnyeqtfcagfftafllhhjhplbdsrfpctkqpinpdfrtlzyjllfbeffputywcckupyslkbbzpgcnxgbmhtqeqqehpdaokkjtatrhyiuusjhwgiiiikxpzdueasemosmmccoakafgvxduwiuflovhhfhffgnnjhoperhhjtvocpqytjxkmrknnknqeglffhfuplopmktykxuvcmbwpoeisrlyyhdpxfvzseucofyhziuiikihpqheqdyzwigeaqzhxzvporgisxgvhyicqyejovqloibhbunsvsunpvmdckkbuokitdzleilfwutcvuuytpupizinfjrzhxudsmjcjyfcpfgthujjowdwtgbvi",
"output": "YES"
},
{
"input": "uuehrvufgerqbzyzksmqnewacotuimawhlbycdbsmhshrsbqwybbkwjwsrkwptvlbbwjiivqugzrxxwgidrcrhrwsmwgeoleptfamzefgaeyxouxocrpvomjrazmxrnffdwrrmblgdiabdncvfougtmjgvvazasnygdrigbsrieoonirlivfyodvulouslxosswgpdexuldmkdbpdlgutiotvxjyecbrsvbmqxrlcpcipjjncduyqtohlzybvlemmfdeubihwlwqglkgjvnwrbgydcpwklmjeewqklmqdbajqgrpnynaxfvxjzgibqerxyhnxenrmcdqaaeksbzyrcaepozqpetaurlhjuxxhwppuhgoihxdxbmxeiahyaqkbknktlzkheaarjoqqrsyeducvoygwalgarldcdlqogfvsncejssmx",
"output": "YES"
},
{
"input": "iiopulfjxoitgiusqrhgbkiyzinphjtclodbkkydetylvuimkhdkklmyoacmekdvjpuxcrvqnjhqhhbfenlpzpwijtykqziocilvtpqhxuyrphdlamawjuzgjwiebkqyrzyqgtkcrhntjxqmcgkrqcslogjegfrivzidfedeegwbbsopvxvdoididlpypjogxaodtueebbwuwilacunqpozczcgrpaxxrtogpxgfkudtxchoravrrdtimhenwmnafxaruuojduxxglefejycfcyxllfimkszmbrhcwpnwjqgwvzysmlaaifdxfjjpgjmcksiigpanappjdloiolojmcqbnpnjjzaufdpjaknylmyvolhwypygwepmqwpiglpcnpypnudhdzpdvgzosyjthzcwtytxq",
"output": "YES"
}
] | 1,621,379,054
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 58
| 109
| 0
|
string = input()
heidi = "heidi"
j = 0
t = ""
for i in range(len(string)):
if heidi[j] == string[i]:
j += 1
t += string[i]
if t == heidi:
break
b = j == len(heidi)
print("YES") if b else print("NO")
|
Title: Fake News (easy)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
Input Specification:
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
Output Specification:
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
Demo Input:
['abcheaibcdi\n', 'hiedi\n']
Demo Output:
['YES', 'NO']
Note:
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
|
```python
string = input()
heidi = "heidi"
j = 0
t = ""
for i in range(len(string)):
if heidi[j] == string[i]:
j += 1
t += string[i]
if t == heidi:
break
b = j == len(heidi)
print("YES") if b else print("NO")
```
| 3
|
|
25
|
B
|
Phone numbers
|
PROGRAMMING
| 1,100
|
[
"implementation"
] |
B. Phone numbers
|
2
|
256
|
Phone number in Berland is a sequence of *n* digits. Often, to make it easier to memorize the number, it is divided into groups of two or three digits. For example, the phone number 1198733 is easier to remember as 11-987-33. Your task is to find for a given phone number any of its divisions into groups of two or three digits.
|
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of digits in the phone number. The second line contains *n* digits — the phone number to divide into groups.
|
Output any of divisions of the given phone number into groups of two or three digits. Separate groups by single character -. If the answer is not unique, output any.
|
[
"6\n549871\n",
"7\n1198733\n"
] |
[
"54-98-71",
"11-987-33\n"
] |
none
| 0
|
[
{
"input": "6\n549871",
"output": "54-98-71"
},
{
"input": "7\n1198733",
"output": "119-87-33"
},
{
"input": "2\n74",
"output": "74"
},
{
"input": "2\n33",
"output": "33"
},
{
"input": "3\n074",
"output": "074"
},
{
"input": "3\n081",
"output": "081"
},
{
"input": "4\n3811",
"output": "38-11"
},
{
"input": "5\n21583",
"output": "215-83"
},
{
"input": "8\n33408349",
"output": "33-40-83-49"
},
{
"input": "9\n988808426",
"output": "988-80-84-26"
},
{
"input": "10\n0180990956",
"output": "01-80-99-09-56"
},
{
"input": "15\n433488906230138",
"output": "433-48-89-06-23-01-38"
},
{
"input": "22\n7135498415686025907059",
"output": "71-35-49-84-15-68-60-25-90-70-59"
},
{
"input": "49\n2429965524999668169991253653390090510755018570235",
"output": "242-99-65-52-49-99-66-81-69-99-12-53-65-33-90-09-05-10-75-50-18-57-02-35"
},
{
"input": "72\n491925337784111770500147619881727525570039735507439360627744863794794290",
"output": "49-19-25-33-77-84-11-17-70-50-01-47-61-98-81-72-75-25-57-00-39-73-55-07-43-93-60-62-77-44-86-37-94-79-42-90"
},
{
"input": "95\n32543414456047900690980198395035321172843693417425457554204776648220562494524275489599199209210",
"output": "325-43-41-44-56-04-79-00-69-09-80-19-83-95-03-53-21-17-28-43-69-34-17-42-54-57-55-42-04-77-66-48-22-05-62-49-45-24-27-54-89-59-91-99-20-92-10"
},
{
"input": "97\n9362344595153688016434451101547661156123505108492010669557671355055642365998461003851354321478898",
"output": "936-23-44-59-51-53-68-80-16-43-44-51-10-15-47-66-11-56-12-35-05-10-84-92-01-06-69-55-76-71-35-50-55-64-23-65-99-84-61-00-38-51-35-43-21-47-88-98"
},
{
"input": "98\n65521815795893886057122984634320900545031770769333931308009346017867969790810907868670369236928568",
"output": "65-52-18-15-79-58-93-88-60-57-12-29-84-63-43-20-90-05-45-03-17-70-76-93-33-93-13-08-00-93-46-01-78-67-96-97-90-81-09-07-86-86-70-36-92-36-92-85-68"
},
{
"input": "99\n455213856470326729480192345541970106407563996625458559297407682539801838244443866898560852503660390",
"output": "455-21-38-56-47-03-26-72-94-80-19-23-45-54-19-70-10-64-07-56-39-96-62-54-58-55-92-97-40-76-82-53-98-01-83-82-44-44-38-66-89-85-60-85-25-03-66-03-90"
},
{
"input": "100\n4004223124942730640235383244438257614581534320356060987241659784249551110165034719443327659510644224",
"output": "40-04-22-31-24-94-27-30-64-02-35-38-32-44-43-82-57-61-45-81-53-43-20-35-60-60-98-72-41-65-97-84-24-95-51-11-01-65-03-47-19-44-33-27-65-95-10-64-42-24"
}
] | 1,690,601,264
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 92
| 0
|
def main():
n = int(input())
number = input().strip()
if len(number) <= 3:
print(number)
else:
index = 0
if len(number) % 2 == 1:
print(number[:3], end="")
index = 3
else:
print(number[:2], end="")
index = 2
while index < len(number):
print("-", end="")
print(number[index:index + 2], end="")
index += 2
print()
if __name__ == "__main__":
main()
|
Title: Phone numbers
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Phone number in Berland is a sequence of *n* digits. Often, to make it easier to memorize the number, it is divided into groups of two or three digits. For example, the phone number 1198733 is easier to remember as 11-987-33. Your task is to find for a given phone number any of its divisions into groups of two or three digits.
Input Specification:
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of digits in the phone number. The second line contains *n* digits — the phone number to divide into groups.
Output Specification:
Output any of divisions of the given phone number into groups of two or three digits. Separate groups by single character -. If the answer is not unique, output any.
Demo Input:
['6\n549871\n', '7\n1198733\n']
Demo Output:
['54-98-71', '11-987-33\n']
Note:
none
|
```python
def main():
n = int(input())
number = input().strip()
if len(number) <= 3:
print(number)
else:
index = 0
if len(number) % 2 == 1:
print(number[:3], end="")
index = 3
else:
print(number[:2], end="")
index = 2
while index < len(number):
print("-", end="")
print(number[index:index + 2], end="")
index += 2
print()
if __name__ == "__main__":
main()
```
| 3.977
|
570
|
B
|
Simple Game
|
PROGRAMMING
| 1,300
|
[
"constructive algorithms",
"games",
"greedy",
"implementation",
"math"
] | null | null |
One day Misha and Andrew were playing a very simple game. First, each player chooses an integer in the range from 1 to *n*. Let's assume that Misha chose number *m*, and Andrew chose number *a*.
Then, by using a random generator they choose a random integer *c* in the range between 1 and *n* (any integer from 1 to *n* is chosen with the same probability), after which the winner is the player, whose number was closer to *c*. The boys agreed that if *m* and *a* are located on the same distance from *c*, Misha wins.
Andrew wants to win very much, so he asks you to help him. You know the number selected by Misha, and number *n*. You need to determine which value of *a* Andrew must choose, so that the probability of his victory is the highest possible.
More formally, you need to find such integer *a* (1<=≤<=*a*<=≤<=*n*), that the probability that is maximal, where *c* is the equiprobably chosen integer from 1 to *n* (inclusive).
|
The first line contains two integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the range of numbers in the game, and the number selected by Misha respectively.
|
Print a single number — such value *a*, that probability that Andrew wins is the highest. If there are multiple such values, print the minimum of them.
|
[
"3 1\n",
"4 3\n"
] |
[
"2",
"2"
] |
In the first sample test: Andrew wins if *c* is equal to 2 or 3. The probability that Andrew wins is 2 / 3. If Andrew chooses *a* = 3, the probability of winning will be 1 / 3. If *a* = 1, the probability of winning is 0.
In the second sample test: Andrew wins if *c* is equal to 1 and 2. The probability that Andrew wins is 1 / 2. For other choices of *a* the probability of winning is less.
| 1,000
|
[
{
"input": "3 1",
"output": "2"
},
{
"input": "4 3",
"output": "2"
},
{
"input": "5 5",
"output": "4"
},
{
"input": "10 5",
"output": "6"
},
{
"input": "20 13",
"output": "12"
},
{
"input": "51 1",
"output": "2"
},
{
"input": "100 50",
"output": "51"
},
{
"input": "100 51",
"output": "50"
},
{
"input": "100 49",
"output": "50"
},
{
"input": "1000000000 1000000000",
"output": "999999999"
},
{
"input": "1000000000 1",
"output": "2"
},
{
"input": "1000000000 100000000",
"output": "100000001"
},
{
"input": "1000000000 500000000",
"output": "500000001"
},
{
"input": "1000000000 123124",
"output": "123125"
},
{
"input": "12412523 125123",
"output": "125124"
},
{
"input": "54645723 432423",
"output": "432424"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "262833325 131416663",
"output": "131416662"
},
{
"input": "477667530 238833766",
"output": "238833765"
},
{
"input": "692501734 346250868",
"output": "346250867"
},
{
"input": "907335939 453667970",
"output": "453667969"
},
{
"input": "746085224 373042613",
"output": "373042612"
},
{
"input": "189520699 94760350",
"output": "94760349"
},
{
"input": "404354904 202177453",
"output": "202177452"
},
{
"input": "619189108 309594555",
"output": "309594554"
},
{
"input": "81813292 40906647",
"output": "40906646"
},
{
"input": "296647497 148323750",
"output": "148323749"
},
{
"input": "511481701 255740851",
"output": "255740850"
},
{
"input": "726315905 363157953",
"output": "363157952"
},
{
"input": "496110970 201868357",
"output": "201868358"
},
{
"input": "710945175 173165570",
"output": "173165571"
},
{
"input": "925779379 720443954",
"output": "720443953"
},
{
"input": "140613583 93171580",
"output": "93171579"
},
{
"input": "355447788 85890184",
"output": "85890185"
},
{
"input": "570281992 291648263",
"output": "291648262"
},
{
"input": "541904957 459371829",
"output": "459371828"
},
{
"input": "756739161 125332525",
"output": "125332526"
},
{
"input": "971573366 216791157",
"output": "216791158"
},
{
"input": "186407570 160453970",
"output": "160453969"
},
{
"input": "401241775 170032078",
"output": "170032079"
},
{
"input": "616075979 207073797",
"output": "207073798"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "2 1",
"output": "2"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "3 1",
"output": "2"
},
{
"input": "3 2",
"output": "1"
},
{
"input": "3 3",
"output": "2"
},
{
"input": "4 1",
"output": "2"
},
{
"input": "4 2",
"output": "3"
},
{
"input": "4 3",
"output": "2"
},
{
"input": "4 4",
"output": "3"
},
{
"input": "5 1",
"output": "2"
},
{
"input": "5 2",
"output": "3"
},
{
"input": "5 3",
"output": "2"
},
{
"input": "5 4",
"output": "3"
},
{
"input": "5 5",
"output": "4"
},
{
"input": "3 2",
"output": "1"
},
{
"input": "7 4",
"output": "3"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "7 3",
"output": "4"
}
] | 1,630,341,795
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 60
| 77
| 6,758,400
|
n,m = [int(i) for i in input().split()]
print(m+1 if m<=n/2.0 else max(m-1,1))
|
Title: Simple Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Misha and Andrew were playing a very simple game. First, each player chooses an integer in the range from 1 to *n*. Let's assume that Misha chose number *m*, and Andrew chose number *a*.
Then, by using a random generator they choose a random integer *c* in the range between 1 and *n* (any integer from 1 to *n* is chosen with the same probability), after which the winner is the player, whose number was closer to *c*. The boys agreed that if *m* and *a* are located on the same distance from *c*, Misha wins.
Andrew wants to win very much, so he asks you to help him. You know the number selected by Misha, and number *n*. You need to determine which value of *a* Andrew must choose, so that the probability of his victory is the highest possible.
More formally, you need to find such integer *a* (1<=≤<=*a*<=≤<=*n*), that the probability that is maximal, where *c* is the equiprobably chosen integer from 1 to *n* (inclusive).
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the range of numbers in the game, and the number selected by Misha respectively.
Output Specification:
Print a single number — such value *a*, that probability that Andrew wins is the highest. If there are multiple such values, print the minimum of them.
Demo Input:
['3 1\n', '4 3\n']
Demo Output:
['2', '2']
Note:
In the first sample test: Andrew wins if *c* is equal to 2 or 3. The probability that Andrew wins is 2 / 3. If Andrew chooses *a* = 3, the probability of winning will be 1 / 3. If *a* = 1, the probability of winning is 0.
In the second sample test: Andrew wins if *c* is equal to 1 and 2. The probability that Andrew wins is 1 / 2. For other choices of *a* the probability of winning is less.
|
```python
n,m = [int(i) for i in input().split()]
print(m+1 if m<=n/2.0 else max(m-1,1))
```
| 3
|
|
313
|
B
|
Ilya and Queries
|
PROGRAMMING
| 1,100
|
[
"dp",
"implementation"
] | null | null |
Ilya the Lion wants to help all his friends with passing exams. They need to solve the following problem to pass the IT exam.
You've got string *s*<==<=*s*1*s*2... *s**n* (*n* is the length of the string), consisting only of characters "." and "#" and *m* queries. Each query is described by a pair of integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=<<=*r**i*<=≤<=*n*). The answer to the query *l**i*,<=*r**i* is the number of such integers *i* (*l**i*<=≤<=*i*<=<<=*r**i*), that *s**i*<==<=*s**i*<=+<=1.
Ilya the Lion wants to help his friends but is there anyone to help him? Help Ilya, solve the problem.
|
The first line contains string *s* of length *n* (2<=≤<=*n*<=≤<=105). It is guaranteed that the given string only consists of characters "." and "#".
The next line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains the description of the corresponding query. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=<<=*r**i*<=≤<=*n*).
|
Print *m* integers — the answers to the queries in the order in which they are given in the input.
|
[
"......\n4\n3 4\n2 3\n1 6\n2 6\n",
"#..###\n5\n1 3\n5 6\n1 5\n3 6\n3 4\n"
] |
[
"1\n1\n5\n4\n",
"1\n1\n2\n2\n0\n"
] |
none
| 1,000
|
[
{
"input": "......\n4\n3 4\n2 3\n1 6\n2 6",
"output": "1\n1\n5\n4"
},
{
"input": "#..###\n5\n1 3\n5 6\n1 5\n3 6\n3 4",
"output": "1\n1\n2\n2\n0"
},
{
"input": ".#...#..\n6\n1 5\n2 3\n6 7\n2 4\n2 5\n1 3",
"output": "2\n0\n0\n1\n2\n0"
},
{
"input": "#.#.#..\n5\n3 4\n4 5\n5 7\n5 7\n1 3",
"output": "0\n0\n1\n1\n0"
},
{
"input": "#.##.##.\n7\n1 8\n2 6\n2 6\n6 8\n3 5\n2 4\n2 5",
"output": "2\n1\n1\n1\n1\n1\n1"
},
{
"input": "#..#\n1\n1 4",
"output": "1"
},
{
"input": "#..##...#.\n7\n5 9\n6 10\n1 7\n5 8\n3 5\n2 10\n3 4",
"output": "2\n2\n3\n2\n1\n4\n0"
},
{
"input": "#.#.#\n7\n1 2\n3 4\n3 5\n2 3\n3 5\n1 5\n1 3",
"output": "0\n0\n0\n0\n0\n0\n0"
},
{
"input": "###..#...#\n2\n2 4\n1 2",
"output": "1\n1"
},
{
"input": "..\n1\n1 2",
"output": "1"
},
{
"input": "##\n1\n1 2",
"output": "1"
},
{
"input": ".#\n1\n1 2",
"output": "0"
},
{
"input": "#.\n1\n1 2",
"output": "0"
},
{
"input": "...\n2\n1 2\n1 2",
"output": "1\n1"
}
] | 1,699,876,123
| 2,147,483,647
|
PyPy 3-64
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
s=input()
n=int(input())
a=100001*[0]
summ=0
x=len(s)
for i in range(1,x):
x=bool(s[i]=s[i-1])
summ+=x
a[i]=summ
for i in range(n):
x,y=input.split(' ')
print(a[y-1]-a[x-1])
|
Title: Ilya and Queries
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ilya the Lion wants to help all his friends with passing exams. They need to solve the following problem to pass the IT exam.
You've got string *s*<==<=*s*1*s*2... *s**n* (*n* is the length of the string), consisting only of characters "." and "#" and *m* queries. Each query is described by a pair of integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=<<=*r**i*<=≤<=*n*). The answer to the query *l**i*,<=*r**i* is the number of such integers *i* (*l**i*<=≤<=*i*<=<<=*r**i*), that *s**i*<==<=*s**i*<=+<=1.
Ilya the Lion wants to help his friends but is there anyone to help him? Help Ilya, solve the problem.
Input Specification:
The first line contains string *s* of length *n* (2<=≤<=*n*<=≤<=105). It is guaranteed that the given string only consists of characters "." and "#".
The next line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains the description of the corresponding query. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=<<=*r**i*<=≤<=*n*).
Output Specification:
Print *m* integers — the answers to the queries in the order in which they are given in the input.
Demo Input:
['......\n4\n3 4\n2 3\n1 6\n2 6\n', '#..###\n5\n1 3\n5 6\n1 5\n3 6\n3 4\n']
Demo Output:
['1\n1\n5\n4\n', '1\n1\n2\n2\n0\n']
Note:
none
|
```python
s=input()
n=int(input())
a=100001*[0]
summ=0
x=len(s)
for i in range(1,x):
x=bool(s[i]=s[i-1])
summ+=x
a[i]=summ
for i in range(n):
x,y=input.split(' ')
print(a[y-1]-a[x-1])
```
| -1
|
|
109
|
A
|
Lucky Sum of Digits
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation"
] |
A. Lucky Sum of Digits
|
2
|
256
|
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya wonders eagerly what minimum lucky number has the sum of digits equal to *n*. Help him cope with the task.
|
The single line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the sum of digits of the required lucky number.
|
Print on the single line the result — the minimum lucky number, whose sum of digits equals *n*. If such number does not exist, print -1.
|
[
"11\n",
"10\n"
] |
[
"47\n",
"-1\n"
] |
none
| 500
|
[
{
"input": "11",
"output": "47"
},
{
"input": "10",
"output": "-1"
},
{
"input": "64",
"output": "4477777777"
},
{
"input": "1",
"output": "-1"
},
{
"input": "4",
"output": "4"
},
{
"input": "7",
"output": "7"
},
{
"input": "12",
"output": "444"
},
{
"input": "1000000",
"output": "4477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "47",
"output": "44477777"
},
{
"input": "100",
"output": "4444777777777777"
},
{
"input": "700",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "485",
"output": "44447777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "111",
"output": "444447777777777777"
},
{
"input": "85",
"output": "4477777777777"
},
{
"input": "114",
"output": "444477777777777777"
},
{
"input": "474",
"output": "444777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "74",
"output": "47777777777"
},
{
"input": "1000",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "1024",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "4444",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "45784",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10000",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "9854",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "186",
"output": "477777777777777777777777777"
},
{
"input": "10416",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10417",
"output": "4477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "3840",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "100000",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "9876",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "99999",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "777777",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "854759",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "11000",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "18951",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999999",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "888887",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999998",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "40008",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10691",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "5",
"output": "-1"
},
{
"input": "6",
"output": "-1"
},
{
"input": "9",
"output": "-1"
},
{
"input": "8",
"output": "44"
},
{
"input": "2",
"output": "-1"
},
{
"input": "3",
"output": "-1"
},
{
"input": "999997",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999996",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999990",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999980",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "800000",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "980000",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
}
] | 1,587,807,500
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 2
| 280
| 0
|
n=int(input())
if(n%4==0 and n%7==0)or(n%7==0):
print("7"*(n//7))
elif(n%4==0 and n%7!=0):
print("4"*(n//4))
elif(n%7!=0 and n%4!=0):
if(n%7!=4):
print(-1)
else:
s=""
while(n!=4):
s+="7"
n-=7
s+="4"
print(''.join(sorted(s)))
|
Title: Lucky Sum of Digits
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya wonders eagerly what minimum lucky number has the sum of digits equal to *n*. Help him cope with the task.
Input Specification:
The single line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the sum of digits of the required lucky number.
Output Specification:
Print on the single line the result — the minimum lucky number, whose sum of digits equals *n*. If such number does not exist, print -1.
Demo Input:
['11\n', '10\n']
Demo Output:
['47\n', '-1\n']
Note:
none
|
```python
n=int(input())
if(n%4==0 and n%7==0)or(n%7==0):
print("7"*(n//7))
elif(n%4==0 and n%7!=0):
print("4"*(n//4))
elif(n%7!=0 and n%4!=0):
if(n%7!=4):
print(-1)
else:
s=""
while(n!=4):
s+="7"
n-=7
s+="4"
print(''.join(sorted(s)))
```
| 0
|
899
|
A
|
Splitting in Teams
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"greedy",
"math"
] | null | null |
There were *n* groups of students which came to write a training contest. A group is either one person who can write the contest with anyone else, or two people who want to write the contest in the same team.
The coach decided to form teams of exactly three people for this training. Determine the maximum number of teams of three people he can form. It is possible that he can't use all groups to form teams. For groups of two, either both students should write the contest, or both should not. If two students from a group of two will write the contest, they should be in the same team.
|
The first line contains single integer *n* (2<=≤<=*n*<=≤<=2·105) — the number of groups.
The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2), where *a**i* is the number of people in group *i*.
|
Print the maximum number of teams of three people the coach can form.
|
[
"4\n1 1 2 1\n",
"2\n2 2\n",
"7\n2 2 2 1 1 1 1\n",
"3\n1 1 1\n"
] |
[
"1\n",
"0\n",
"3\n",
"1\n"
] |
In the first example the coach can form one team. For example, he can take students from the first, second and fourth groups.
In the second example he can't make a single team.
In the third example the coach can form three teams. For example, he can do this in the following way:
- The first group (of two people) and the seventh group (of one person), - The second group (of two people) and the sixth group (of one person), - The third group (of two people) and the fourth group (of one person).
| 500
|
[
{
"input": "4\n1 1 2 1",
"output": "1"
},
{
"input": "2\n2 2",
"output": "0"
},
{
"input": "7\n2 2 2 1 1 1 1",
"output": "3"
},
{
"input": "3\n1 1 1",
"output": "1"
},
{
"input": "3\n2 2 2",
"output": "0"
},
{
"input": "3\n1 2 1",
"output": "1"
},
{
"input": "5\n2 2 1 1 1",
"output": "2"
},
{
"input": "7\n1 1 2 2 1 2 1",
"output": "3"
},
{
"input": "10\n1 2 2 1 2 2 1 2 1 1",
"output": "5"
},
{
"input": "5\n2 2 2 1 2",
"output": "1"
},
{
"input": "43\n1 2 2 2 1 1 2 2 1 1 2 2 2 2 1 2 2 2 2 2 1 2 1 2 1 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2",
"output": "10"
},
{
"input": "72\n1 2 1 2 2 1 2 1 1 1 1 2 2 1 2 1 2 1 2 2 2 2 1 2 2 2 2 1 2 1 1 2 2 1 1 2 2 2 2 2 1 1 1 1 2 2 1 1 2 1 1 1 1 2 2 1 2 2 1 2 1 1 2 1 2 2 1 1 1 2 2 2",
"output": "34"
},
{
"input": "64\n2 2 1 1 1 2 1 1 1 2 2 1 2 2 2 1 2 2 2 1 1 1 1 2 1 2 1 2 1 1 2 2 1 1 2 2 1 1 1 1 2 2 1 1 1 2 1 2 2 2 2 2 2 2 1 1 2 1 1 1 2 2 1 2",
"output": "32"
},
{
"input": "20\n1 1 1 1 2 1 2 2 2 1 2 1 2 1 2 1 1 2 1 2",
"output": "9"
},
{
"input": "23\n1 1 1 1 2 1 2 1 1 1 2 2 2 2 2 2 1 2 1 2 2 1 1",
"output": "11"
},
{
"input": "201\n1 1 2 2 2 2 1 1 1 2 2 1 2 1 2 1 2 2 2 1 1 2 1 1 1 2 1 2 1 1 1 2 1 1 2 1 2 2 1 1 1 1 2 1 1 2 1 1 1 2 2 2 2 1 2 1 2 2 2 2 2 2 1 1 1 2 2 1 1 1 1 2 2 1 2 1 1 2 2 1 1 2 2 2 1 1 1 2 1 1 2 1 2 2 1 2 2 2 2 1 1 1 2 1 2 2 2 2 2 1 2 1 1 1 2 2 2 2 2 1 2 1 1 2 2 2 1 1 2 2 1 2 2 2 1 1 1 2 1 1 1 2 1 1 2 2 2 1 2 1 1 1 2 2 1 1 2 2 2 2 2 2 1 2 2 1 2 2 2 1 1 2 2 1 1 2 1 1 1 1 2 1 1 1 2 2 1 2 1 1 2 2 1 1 2 1 2 1 1 1 2",
"output": "100"
},
{
"input": "247\n2 2 1 2 1 2 2 2 2 2 2 1 1 2 2 1 2 1 1 1 2 1 1 1 1 2 1 1 2 2 1 2 1 1 1 2 2 2 1 1 2 1 1 2 1 1 1 2 1 2 1 2 2 1 1 2 1 2 2 1 2 1 2 1 1 2 1 1 1 2 2 1 1 2 2 1 1 2 1 1 1 2 2 2 2 1 2 2 2 2 2 2 1 2 2 2 2 1 1 1 1 1 1 1 1 1 2 1 2 2 1 2 1 2 2 2 1 2 2 2 1 1 2 2 1 1 1 2 1 1 1 1 2 2 1 2 2 1 1 1 2 1 2 2 1 2 1 1 1 2 2 2 2 2 1 2 2 2 1 1 1 2 1 2 1 1 2 2 2 2 1 1 2 2 2 1 2 2 2 1 2 1 1 2 2 2 2 1 2 2 1 1 1 2 1 2 1 1 1 2 2 1 1 2 1 1 2 1 2 1 1 2 1 1 1 1 2 1 1 1 1 2 2 1 2 1 1 2 1 2 2 1 2 2 2 1 2 2 1 2 2 1 1 1 2 2 2",
"output": "123"
},
{
"input": "4\n2 2 2 2",
"output": "0"
},
{
"input": "4\n1 1 1 1",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "3\n1 1 2",
"output": "1"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n2 1 1",
"output": "1"
},
{
"input": "3\n2 1 2",
"output": "1"
},
{
"input": "3\n2 2 1",
"output": "1"
},
{
"input": "4\n1 1 1 2",
"output": "1"
},
{
"input": "4\n1 1 2 2",
"output": "2"
},
{
"input": "4\n1 2 2 2",
"output": "1"
},
{
"input": "4\n2 1 1 1",
"output": "1"
},
{
"input": "5\n1 1 1 1 2",
"output": "2"
},
{
"input": "14\n1 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "1"
},
{
"input": "38\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1",
"output": "1"
},
{
"input": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1",
"output": "1"
},
{
"input": "20\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1",
"output": "1"
},
{
"input": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2",
"output": "1"
},
{
"input": "6\n1 1 1 2 2 2",
"output": "3"
},
{
"input": "5\n2 1 1 1 1",
"output": "2"
},
{
"input": "9\n1 1 1 1 1 1 2 2 2",
"output": "4"
},
{
"input": "10\n2 2 1 1 1 1 1 1 1 1",
"output": "4"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "2"
}
] | 1,534,250,953
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 67
| 217
| 3,993,600
|
n = int(input())
a = list(map(int, input().split()))
c1 = c2 = 0
for i in a:
if i == 1:
c1 += 1
else:
c2 += 1
if c1 < c2:
print(c1)
else:
print(c2+(c1-c2)//3)
|
Title: Splitting in Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There were *n* groups of students which came to write a training contest. A group is either one person who can write the contest with anyone else, or two people who want to write the contest in the same team.
The coach decided to form teams of exactly three people for this training. Determine the maximum number of teams of three people he can form. It is possible that he can't use all groups to form teams. For groups of two, either both students should write the contest, or both should not. If two students from a group of two will write the contest, they should be in the same team.
Input Specification:
The first line contains single integer *n* (2<=≤<=*n*<=≤<=2·105) — the number of groups.
The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2), where *a**i* is the number of people in group *i*.
Output Specification:
Print the maximum number of teams of three people the coach can form.
Demo Input:
['4\n1 1 2 1\n', '2\n2 2\n', '7\n2 2 2 1 1 1 1\n', '3\n1 1 1\n']
Demo Output:
['1\n', '0\n', '3\n', '1\n']
Note:
In the first example the coach can form one team. For example, he can take students from the first, second and fourth groups.
In the second example he can't make a single team.
In the third example the coach can form three teams. For example, he can do this in the following way:
- The first group (of two people) and the seventh group (of one person), - The second group (of two people) and the sixth group (of one person), - The third group (of two people) and the fourth group (of one person).
|
```python
n = int(input())
a = list(map(int, input().split()))
c1 = c2 = 0
for i in a:
if i == 1:
c1 += 1
else:
c2 += 1
if c1 < c2:
print(c1)
else:
print(c2+(c1-c2)//3)
```
| 3
|
|
884
|
B
|
Japanese Crosswords Strike Back
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
A one-dimensional Japanese crossword can be represented as a binary string of length *x*. An encoding of this crossword is an array *a* of size *n*, where *n* is the number of segments formed completely of 1's, and *a**i* is the length of *i*-th segment. No two segments touch or intersect.
For example:
- If *x*<==<=6 and the crossword is 111011, then its encoding is an array {3,<=2}; - If *x*<==<=8 and the crossword is 01101010, then its encoding is an array {2,<=1,<=1}; - If *x*<==<=5 and the crossword is 11111, then its encoding is an array {5}; - If *x*<==<=5 and the crossword is 00000, then its encoding is an empty array.
Mishka wants to create a new one-dimensional Japanese crossword. He has already picked the length and the encoding for this crossword. And now he needs to check if there is exactly one crossword such that its length and encoding are equal to the length and encoding he picked. Help him to check it!
|
The first line contains two integer numbers *n* and *x* (1<=≤<=*n*<=≤<=100000, 1<=≤<=*x*<=≤<=109) — the number of elements in the encoding and the length of the crossword Mishka picked.
The second line contains *n* integer numbers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=10000) — the encoding.
|
Print YES if there exists exaclty one crossword with chosen length and encoding. Otherwise, print NO.
|
[
"2 4\n1 3\n",
"3 10\n3 3 2\n",
"2 10\n1 3\n"
] |
[
"NO\n",
"YES\n",
"NO\n"
] |
none
| 0
|
[
{
"input": "2 4\n1 3",
"output": "NO"
},
{
"input": "3 10\n3 3 2",
"output": "YES"
},
{
"input": "2 10\n1 3",
"output": "NO"
},
{
"input": "1 1\n1",
"output": "YES"
},
{
"input": "1 10\n10",
"output": "YES"
},
{
"input": "1 10000\n10000",
"output": "YES"
},
{
"input": "10 1\n5 78 3 87 4 9 5 8 9 1235",
"output": "NO"
},
{
"input": "3 12\n3 3 3",
"output": "NO"
},
{
"input": "3 9\n2 2 2",
"output": "NO"
},
{
"input": "2 5\n1 1",
"output": "NO"
},
{
"input": "1 2\n1",
"output": "NO"
},
{
"input": "3 13\n3 3 3",
"output": "NO"
},
{
"input": "3 6\n1 1 1",
"output": "NO"
},
{
"input": "1 6\n5",
"output": "NO"
},
{
"input": "3 11\n3 3 2",
"output": "NO"
},
{
"input": "2 6\n1 3",
"output": "NO"
},
{
"input": "3 10\n2 2 2",
"output": "NO"
},
{
"input": "3 8\n2 1 1",
"output": "NO"
},
{
"input": "1 5\n2",
"output": "NO"
},
{
"input": "1 3\n1",
"output": "NO"
},
{
"input": "5 5\n1 1 1 1 1",
"output": "NO"
},
{
"input": "2 10\n4 4",
"output": "NO"
},
{
"input": "2 8\n2 3",
"output": "NO"
},
{
"input": "2 4\n1 1",
"output": "NO"
},
{
"input": "3 10\n1 2 4",
"output": "NO"
},
{
"input": "3 10\n2 1 3",
"output": "NO"
},
{
"input": "2 6\n1 2",
"output": "NO"
},
{
"input": "3 4\n1 1 1",
"output": "NO"
},
{
"input": "3 11\n1 2 4",
"output": "NO"
},
{
"input": "3 12\n3 3 2",
"output": "NO"
},
{
"input": "4 9\n1 1 1 1",
"output": "NO"
},
{
"input": "1 10\n9",
"output": "NO"
},
{
"input": "1 7\n5",
"output": "NO"
},
{
"input": "2 5\n1 2",
"output": "NO"
},
{
"input": "3 8\n1 1 2",
"output": "NO"
},
{
"input": "3 7\n1 1 1",
"output": "NO"
},
{
"input": "1 10\n1",
"output": "NO"
},
{
"input": "3 10\n2 3 4",
"output": "NO"
},
{
"input": "3 9\n1 2 3",
"output": "NO"
},
{
"input": "3 9\n3 3 2",
"output": "NO"
},
{
"input": "3 6\n3 3 2",
"output": "NO"
},
{
"input": "1 1\n3",
"output": "NO"
},
{
"input": "1 3\n2",
"output": "NO"
},
{
"input": "3 10\n3 3 3",
"output": "NO"
},
{
"input": "3 5\n1 1 1",
"output": "YES"
},
{
"input": "2 1\n100 100",
"output": "NO"
},
{
"input": "3 3\n3 3 3",
"output": "NO"
},
{
"input": "4 17\n3 3 9 1",
"output": "NO"
},
{
"input": "4 1660\n1505 13 37 100",
"output": "NO"
},
{
"input": "3 5\n3 3 2",
"output": "NO"
},
{
"input": "4 10\n3 3 2 5",
"output": "NO"
},
{
"input": "5 5\n5 5 5 5 5",
"output": "NO"
},
{
"input": "1 1\n2",
"output": "NO"
},
{
"input": "5 10\n1 2 2 4 5",
"output": "NO"
},
{
"input": "2 1\n1 1",
"output": "NO"
}
] | 1,509,137,936
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 66
| 93
| 7,372,800
|
import math
cin = lambda : map(int, input().split())
n, x = cin()
a = list(cin())
s = sum(a)
if s + n - 1 == x:
print('YES')
else:
print('NO')
|
Title: Japanese Crosswords Strike Back
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A one-dimensional Japanese crossword can be represented as a binary string of length *x*. An encoding of this crossword is an array *a* of size *n*, where *n* is the number of segments formed completely of 1's, and *a**i* is the length of *i*-th segment. No two segments touch or intersect.
For example:
- If *x*<==<=6 and the crossword is 111011, then its encoding is an array {3,<=2}; - If *x*<==<=8 and the crossword is 01101010, then its encoding is an array {2,<=1,<=1}; - If *x*<==<=5 and the crossword is 11111, then its encoding is an array {5}; - If *x*<==<=5 and the crossword is 00000, then its encoding is an empty array.
Mishka wants to create a new one-dimensional Japanese crossword. He has already picked the length and the encoding for this crossword. And now he needs to check if there is exactly one crossword such that its length and encoding are equal to the length and encoding he picked. Help him to check it!
Input Specification:
The first line contains two integer numbers *n* and *x* (1<=≤<=*n*<=≤<=100000, 1<=≤<=*x*<=≤<=109) — the number of elements in the encoding and the length of the crossword Mishka picked.
The second line contains *n* integer numbers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=10000) — the encoding.
Output Specification:
Print YES if there exists exaclty one crossword with chosen length and encoding. Otherwise, print NO.
Demo Input:
['2 4\n1 3\n', '3 10\n3 3 2\n', '2 10\n1 3\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
none
|
```python
import math
cin = lambda : map(int, input().split())
n, x = cin()
a = list(cin())
s = sum(a)
if s + n - 1 == x:
print('YES')
else:
print('NO')
```
| 3
|
|
36
|
B
|
Fractal
|
PROGRAMMING
| 1,600
|
[
"implementation"
] |
B. Fractal
|
2
|
64
|
Ever since Kalevitch, a famous Berland abstractionist, heard of fractals, he made them the main topic of his canvases. Every morning the artist takes a piece of graph paper and starts with making a model of his future canvas. He takes a square as big as *n*<=×<=*n* squares and paints some of them black. Then he takes a clean square piece of paper and paints the fractal using the following algorithm:
Step 1. The paper is divided into *n*2 identical squares and some of them are painted black according to the model.
Step 2. Every square that remains white is divided into *n*2 smaller squares and some of them are painted black according to the model.
Every following step repeats step 2.
Unfortunately, this tiresome work demands too much time from the painting genius. Kalevitch has been dreaming of making the process automatic to move to making 3D or even 4D fractals.
|
The first line contains integers *n* and *k* (2<=≤<=*n*<=≤<=3, 1<=≤<=*k*<=≤<=5), where *k* is the amount of steps of the algorithm. Each of the following *n* lines contains *n* symbols that determine the model. Symbol «.» stands for a white square, whereas «*» stands for a black one. It is guaranteed that the model has at least one white square.
|
Output a matrix *n**k*<=×<=*n**k* which is what a picture should look like after *k* steps of the algorithm.
|
[
"2 3\n.*\n..\n",
"3 2\n.*.\n***\n.*.\n"
] |
[
".*******\n..******\n.*.*****\n....****\n.***.***\n..**..**\n.*.*.*.*\n........\n",
".*.***.*.\n*********\n.*.***.*.\n*********\n*********\n*********\n.*.***.*.\n*********\n.*.***.*.\n"
] |
none
| 1,000
|
[
{
"input": "2 3\n.*\n..",
"output": ".*******\n..******\n.*.*****\n....****\n.***.***\n..**..**\n.*.*.*.*\n........"
},
{
"input": "3 2\n.*.\n***\n.*.",
"output": ".*.***.*.\n*********\n.*.***.*.\n*********\n*********\n*********\n.*.***.*.\n*********\n.*.***.*."
},
{
"input": "2 1\n..\n..",
"output": "..\n.."
},
{
"input": "2 2\n*.\n*.",
"output": "***.\n***.\n***.\n***."
},
{
"input": "2 2\n**\n*.",
"output": "****\n****\n****\n***."
},
{
"input": "2 2\n*.\n..",
"output": "***.\n**..\n*.*.\n...."
},
{
"input": "2 3\n*.\n.*",
"output": "*******.\n******.*\n*****.**\n****.***\n***.****\n**.*****\n*.******\n.*******"
},
{
"input": "2 3\n..\n**",
"output": "........\n********\n********\n********\n********\n********\n********\n********"
},
{
"input": "2 3\n*.\n**",
"output": "*******.\n********\n********\n********\n********\n********\n********\n********"
},
{
"input": "2 4\n**\n..",
"output": "****************\n****************\n****************\n****************\n****************\n****************\n****************\n****************\n****************\n****************\n****************\n****************\n****************\n****************\n****************\n................"
},
{
"input": "2 4\n*.\n.*",
"output": "***************.\n**************.*\n*************.**\n************.***\n***********.****\n**********.*****\n*********.******\n********.*******\n*******.********\n******.*********\n*****.**********\n****.***********\n***.************\n**.*************\n*.**************\n.***************"
},
{
"input": "2 4\n.*\n.*",
"output": ".***************\n.***************\n.***************\n.***************\n.***************\n.***************\n.***************\n.***************\n.***************\n.***************\n.***************\n.***************\n.***************\n.***************\n.***************\n.***************"
},
{
"input": "2 5\n.*\n*.",
"output": ".*******************************\n*.******************************\n**.*****************************\n***.****************************\n****.***************************\n*****.**************************\n******.*************************\n*******.************************\n********.***********************\n*********.**********************\n**********.*********************\n***********.********************\n************.*******************\n*************.******************\n**************.*****************\n*..."
},
{
"input": "2 5\n*.\n..",
"output": "*******************************.\n******************************..\n*****************************.*.\n****************************....\n***************************.***.\n**************************..**..\n*************************.*.*.*.\n************************........\n***********************.*******.\n**********************..******..\n*********************.*.*****.*.\n********************....****....\n*******************.***.***.***.\n******************..**..**..**..\n*****************.*.*.*.*.*.*.*.\n*..."
},
{
"input": "2 5\n..\n*.",
"output": "................................\n*.*.*.*.*.*.*.*.*.*.*.*.*.*.*.*.\n**..**..**..**..**..**..**..**..\n***.***.***.***.***.***.***.***.\n****....****....****....****....\n*****.*.*****.*.*****.*.*****.*.\n******..******..******..******..\n*******.*******.*******.*******.\n********........********........\n*********.*.*.*.*********.*.*.*.\n**********..**..**********..**..\n***********.***.***********.***.\n************....************....\n*************.*.*************.*.\n**************..**************..\n*..."
},
{
"input": "2 5\n**\n*.",
"output": "********************************\n********************************\n********************************\n********************************\n********************************\n********************************\n********************************\n********************************\n********************************\n********************************\n********************************\n********************************\n********************************\n********************************\n********************************\n*..."
},
{
"input": "3 1\n*..\n...\n..*",
"output": "*..\n...\n..*"
},
{
"input": "3 2\n**.\n.**\n..*",
"output": "********.\n******.**\n******..*\n**.******\n.********\n..*******\n**.**.***\n.**.*****\n..*..****"
},
{
"input": "3 2\n..*\n***\n*..",
"output": "..*..****\n*********\n*..*..***\n*********\n*********\n*********\n***..*..*\n*********\n****..*.."
},
{
"input": "3 3\n**.\n..*\n*.*",
"output": "**************************.\n************************..*\n*************************.*\n********************.**.***\n******************..*..****\n*******************.**.****\n***********************.***\n*********************..****\n**********************.****\n********.********.*********\n******..*******..**********\n*******.********.**********\n**.**.*****.**.************\n..*..****..*..*************\n*.**.*****.**.*************\n*****.********.************\n***..*******..*************\n****.********.****..."
},
{
"input": "3 3\n*.*\n.*.\n..*",
"output": "*************.*************\n************.*.************\n************..*************\n**********.*****.**********\n*********.*.***.*.*********\n*********..****..**********\n**********.**.*************\n*********.*..*.************\n*********..*..*************\n****.*****************.****\n***.*.***************.*.***\n***..****************..****\n*.*****.***********.*****.*\n.*.***.*.*********.*.***.*.\n..****..**********..****..*\n*.**.**************.**.****\n.*..*.************.*..*.***\n..*..*************..."
},
{
"input": "3 3\n...\n*..\n..*",
"output": "...........................\n*..*..*..*..*..*..*..*..*..\n..*..*..*..*..*..*..*..*..*\n***......***......***......\n****..*..****..*..****..*..\n***..*..****..*..****..*..*\n......***......***......***\n*..*..****..*..****..*..***\n..*..****..*..****..*..****\n*********..................\n**********..*..*..*..*..*..\n*********..*..*..*..*..*..*\n************......***......\n*************..*..****..*..\n************..*..****..*..*\n*********......***......***\n**********..*..****..*..***\n*********..*..****..."
},
{
"input": "3 4\n***\n*.*\n***",
"output": "*********************************************************************************\n*********************************************************************************\n*********************************************************************************\n*********************************************************************************\n*********************************************************************************\n*********************************************************************************\n*************..."
},
{
"input": "3 4\n*..\n*..\n*..",
"output": "****************************************..*..****..*..*************..*..****..*..\n****************************************..*..****..*..*************..*..****..*..\n****************************************..*..****..*..*************..*..****..*..\n****************************************..*..****..*..*************..*..****..*..\n****************************************..*..****..*..*************..*..****..*..\n****************************************..*..****..*..*************..*..****..*..\n*************..."
},
{
"input": "3 4\n..*\n...\n.*.",
"output": "..*..****..*..*************..*..****..*..****************************************\n......***......************......***......***************************************\n.*..*.***.*..*.************.*..*.***.*..*.***************************************\n..*..*..*..*..*..**********..*..*..*..*..*..*************************************\n..................*********..................************************************\n.*..*..*..*..*..*.*********.*..*..*..*..*..*.************************************\n..****..*..**..."
},
{
"input": "3 5\n...\n*.*\n*..",
"output": "...................................................................................................................................................................................................................................................\n*.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.**.*\n*..*..*..*..*..*..*....."
},
{
"input": "3 5\n.*.\n*.*\n.*.",
"output": ".*.***.*.*********.*.***.*.***************************.*.***.*.*********.*.***.*.*********************************************************************************.*.***.*.*********.*.***.*.***************************.*.***.*.*********.*.***.*.\n*.*****.***********.*****.*****************************.*****.***********.*****.***********************************************************************************.*****.***********.*****.*****************************.*****.***********.*****.*\n.*.***.*.*********.*...."
},
{
"input": "3 5\n***\n**.\n***",
"output": "***************************************************************************************************************************************************************************************************************************************************\n***************************************************************************************************************************************************************************************************************************************************\n*********************..."
},
{
"input": "3 5\n.*.\n***\n**.",
"output": ".*.***.*.*********.*.***.*.***************************.*.***.*.*********.*.***.*.*********************************************************************************.*.***.*.*********.*.***.*.***************************.*.***.*.*********.*.***.*.\n***************************************************************************************************************************************************************************************************************************************************\n**.*****.***********...."
}
] | 1,644,293,089
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 0
| 156
| 3,891,200
|
import copy
n, k = map(int, input().split())
o_pattern = []
for i in range(n):
o_pattern.append(input())
o_black = []
temp = []
for i in range(n):
temp.append('*')
for i in range(n):
o_black.append(temp)
pattern = copy.deepcopy(o_pattern)
for m in range(2, k+1):
out_ = []
for p in range(n**m):
out_.append([])
for i in range(n**(m-1)):
for j in range(n**(m-1)):
if pattern[i][j] == '.':
for q in range(n):
out_[i*n+q] += o_pattern[q]
else:
for q in range(n):
out_[i*n+q] += o_black[q]
pattern = copy.deepcopy(out_)
for i in pattern:
for j in range(n**k):
print(i[j], end="")
print()
|
Title: Fractal
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Ever since Kalevitch, a famous Berland abstractionist, heard of fractals, he made them the main topic of his canvases. Every morning the artist takes a piece of graph paper and starts with making a model of his future canvas. He takes a square as big as *n*<=×<=*n* squares and paints some of them black. Then he takes a clean square piece of paper and paints the fractal using the following algorithm:
Step 1. The paper is divided into *n*2 identical squares and some of them are painted black according to the model.
Step 2. Every square that remains white is divided into *n*2 smaller squares and some of them are painted black according to the model.
Every following step repeats step 2.
Unfortunately, this tiresome work demands too much time from the painting genius. Kalevitch has been dreaming of making the process automatic to move to making 3D or even 4D fractals.
Input Specification:
The first line contains integers *n* and *k* (2<=≤<=*n*<=≤<=3, 1<=≤<=*k*<=≤<=5), where *k* is the amount of steps of the algorithm. Each of the following *n* lines contains *n* symbols that determine the model. Symbol «.» stands for a white square, whereas «*» stands for a black one. It is guaranteed that the model has at least one white square.
Output Specification:
Output a matrix *n**k*<=×<=*n**k* which is what a picture should look like after *k* steps of the algorithm.
Demo Input:
['2 3\n.*\n..\n', '3 2\n.*.\n***\n.*.\n']
Demo Output:
['.*******\n..******\n.*.*****\n....****\n.***.***\n..**..**\n.*.*.*.*\n........\n', '.*.***.*.\n*********\n.*.***.*.\n*********\n*********\n*********\n.*.***.*.\n*********\n.*.***.*.\n']
Note:
none
|
```python
import copy
n, k = map(int, input().split())
o_pattern = []
for i in range(n):
o_pattern.append(input())
o_black = []
temp = []
for i in range(n):
temp.append('*')
for i in range(n):
o_black.append(temp)
pattern = copy.deepcopy(o_pattern)
for m in range(2, k+1):
out_ = []
for p in range(n**m):
out_.append([])
for i in range(n**(m-1)):
for j in range(n**(m-1)):
if pattern[i][j] == '.':
for q in range(n):
out_[i*n+q] += o_pattern[q]
else:
for q in range(n):
out_[i*n+q] += o_black[q]
pattern = copy.deepcopy(out_)
for i in pattern:
for j in range(n**k):
print(i[j], end="")
print()
```
| -1
|
146
|
B
|
Lucky Mask
|
PROGRAMMING
| 1,300
|
[
"brute force",
"implementation"
] | null | null |
Petya loves lucky numbers very much. Everybody knows that lucky numbers are positive integers whose decimal record contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya calls a mask of a positive integer *n* the number that is obtained after successive writing of all lucky digits of number *n* from the left to the right. For example, the mask of number 72174994 is number 7744, the mask of 7 is 7, the mask of 9999047 is 47. Obviously, mask of any number is always a lucky number.
Petya has two numbers — an arbitrary integer *a* and a lucky number *b*. Help him find the minimum number *c* (*c*<=><=*a*) such that the mask of number *c* equals *b*.
|
The only line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=105). It is guaranteed that number *b* is lucky.
|
In the only line print a single number — the number *c* that is sought by Petya.
|
[
"1 7\n",
"100 47\n"
] |
[
"7\n",
"147\n"
] |
none
| 1,000
|
[
{
"input": "1 7",
"output": "7"
},
{
"input": "100 47",
"output": "147"
},
{
"input": "458 47",
"output": "467"
},
{
"input": "7 7",
"output": "17"
},
{
"input": "547 47",
"output": "647"
},
{
"input": "77 77",
"output": "177"
},
{
"input": "44 4",
"output": "45"
},
{
"input": "740 4",
"output": "804"
},
{
"input": "100000 77777",
"output": "177777"
},
{
"input": "77777 77777",
"output": "177777"
},
{
"input": "47 74",
"output": "74"
},
{
"input": "74 77",
"output": "77"
},
{
"input": "77 74",
"output": "174"
},
{
"input": "98545 7474",
"output": "107474"
},
{
"input": "99997 4",
"output": "100004"
},
{
"input": "100000 7",
"output": "100007"
},
{
"input": "99997 47",
"output": "100047"
},
{
"input": "47774 774",
"output": "50774"
},
{
"input": "47744 7",
"output": "50007"
},
{
"input": "45896 4",
"output": "45898"
},
{
"input": "45679 77777",
"output": "77777"
},
{
"input": "99979 77",
"output": "100077"
},
{
"input": "10 77777",
"output": "77777"
},
{
"input": "1 47774",
"output": "47774"
},
{
"input": "47774 47774",
"output": "147774"
},
{
"input": "47580 47774",
"output": "47774"
},
{
"input": "55557 74",
"output": "55574"
},
{
"input": "59765 4774",
"output": "64774"
},
{
"input": "76492 447",
"output": "80447"
},
{
"input": "69700 77477",
"output": "77477"
},
{
"input": "31975 74",
"output": "32074"
},
{
"input": "369 47",
"output": "407"
},
{
"input": "39999 4",
"output": "40000"
},
{
"input": "39999 4774",
"output": "40774"
},
{
"input": "474 74",
"output": "574"
},
{
"input": "40007 74444",
"output": "74444"
},
{
"input": "40007 74",
"output": "50074"
},
{
"input": "1 4",
"output": "4"
},
{
"input": "4 4",
"output": "14"
},
{
"input": "700 74",
"output": "704"
},
{
"input": "476 47",
"output": "478"
},
{
"input": "99999 77",
"output": "100077"
},
{
"input": "46 7",
"output": "57"
}
] | 1,637,496,957
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 43
| 374
| 0
|
import sys
def fx(a):
sa=str(a)
m=""
for i in range(len(sa)):
if sa[i]=='4' or sa[i]=='7':
m+=sa[i]
if len(m)>0:
n=int(m)
else:
n=0
return n
a,b=map(int,input().split())
while 1:
a+=1
x=fx(a)
if x==b:
print(a)
exit(0)
|
Title: Lucky Mask
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya loves lucky numbers very much. Everybody knows that lucky numbers are positive integers whose decimal record contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya calls a mask of a positive integer *n* the number that is obtained after successive writing of all lucky digits of number *n* from the left to the right. For example, the mask of number 72174994 is number 7744, the mask of 7 is 7, the mask of 9999047 is 47. Obviously, mask of any number is always a lucky number.
Petya has two numbers — an arbitrary integer *a* and a lucky number *b*. Help him find the minimum number *c* (*c*<=><=*a*) such that the mask of number *c* equals *b*.
Input Specification:
The only line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=105). It is guaranteed that number *b* is lucky.
Output Specification:
In the only line print a single number — the number *c* that is sought by Petya.
Demo Input:
['1 7\n', '100 47\n']
Demo Output:
['7\n', '147\n']
Note:
none
|
```python
import sys
def fx(a):
sa=str(a)
m=""
for i in range(len(sa)):
if sa[i]=='4' or sa[i]=='7':
m+=sa[i]
if len(m)>0:
n=int(m)
else:
n=0
return n
a,b=map(int,input().split())
while 1:
a+=1
x=fx(a)
if x==b:
print(a)
exit(0)
```
| 3
|
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,580,571,849
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 81
| 312
| 0
|
def main():
x = list()
y = list()
z = list()
for _ in range(int(input())):
n1, n2, n3 = map(int, input().split())
x.append(n1)
y.append(n2)
z.append(n3)
if sum(x) == 0 and sum(y) == 0 and sum(z) == 0:
print('YES')
else:
print('NO')
pass
if __name__ == '__main__':
main()
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
def main():
x = list()
y = list()
z = list()
for _ in range(int(input())):
n1, n2, n3 = map(int, input().split())
x.append(n1)
y.append(n2)
z.append(n3)
if sum(x) == 0 and sum(y) == 0 and sum(z) == 0:
print('YES')
else:
print('NO')
pass
if __name__ == '__main__':
main()
```
| 3.922
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Eighth-grader Vova is on duty today in the class. After classes, he went into the office to wash the board, and found on it the number *n*. He asked what is this number and the teacher of mathematics Inna Petrovna answered Vova that *n* is the answer to the arithmetic task for first-graders. In the textbook, a certain positive integer *x* was given. The task was to add *x* to the sum of the digits of the number *x* written in decimal numeral system.
Since the number *n* on the board was small, Vova quickly guessed which *x* could be in the textbook. Now he wants to get a program which will search for arbitrary values of the number *n* for all suitable values of *x* or determine that such *x* does not exist. Write such a program for Vova.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=109).
|
In the first line print one integer *k* — number of different values of *x* satisfying the condition.
In next *k* lines print these values in ascending order.
|
[
"21\n",
"20\n"
] |
[
"1\n15\n",
"0\n"
] |
In the first test case *x* = 15 there is only one variant: 15 + 1 + 5 = 21.
In the second test case there are no such *x*.
| 0
|
[
{
"input": "21",
"output": "1\n15"
},
{
"input": "20",
"output": "0"
},
{
"input": "1",
"output": "0"
},
{
"input": "2",
"output": "1\n1"
},
{
"input": "3",
"output": "0"
},
{
"input": "100000001",
"output": "2\n99999937\n100000000"
},
{
"input": "1000000000",
"output": "1\n999999932"
},
{
"input": "999999979",
"output": "2\n999999899\n999999908"
},
{
"input": "9",
"output": "0"
},
{
"input": "10",
"output": "1\n5"
},
{
"input": "11",
"output": "1\n10"
},
{
"input": "39",
"output": "1\n33"
},
{
"input": "66",
"output": "1\n60"
},
{
"input": "75",
"output": "0"
},
{
"input": "100",
"output": "1\n86"
},
{
"input": "101",
"output": "2\n91\n100"
},
{
"input": "2014",
"output": "2\n1988\n2006"
},
{
"input": "999999994",
"output": "0"
}
] | 1,520,967,108
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 18
| 61
| 5,632,000
|
n = int(input())
def sum_num(n):
return sum([int(c) for c in str(n)])
assert(sum_num(15) + 15 == 21)
nums = []
for i in range(max(n-100,0),n):
if i + sum_num(i) == n:
nums.append(i)
if len(nums) > 0:
print(len(nums))
print(" ".join(map(str, nums)))
else:
print(0)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Eighth-grader Vova is on duty today in the class. After classes, he went into the office to wash the board, and found on it the number *n*. He asked what is this number and the teacher of mathematics Inna Petrovna answered Vova that *n* is the answer to the arithmetic task for first-graders. In the textbook, a certain positive integer *x* was given. The task was to add *x* to the sum of the digits of the number *x* written in decimal numeral system.
Since the number *n* on the board was small, Vova quickly guessed which *x* could be in the textbook. Now he wants to get a program which will search for arbitrary values of the number *n* for all suitable values of *x* or determine that such *x* does not exist. Write such a program for Vova.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=109).
Output Specification:
In the first line print one integer *k* — number of different values of *x* satisfying the condition.
In next *k* lines print these values in ascending order.
Demo Input:
['21\n', '20\n']
Demo Output:
['1\n15\n', '0\n']
Note:
In the first test case *x* = 15 there is only one variant: 15 + 1 + 5 = 21.
In the second test case there are no such *x*.
|
```python
n = int(input())
def sum_num(n):
return sum([int(c) for c in str(n)])
assert(sum_num(15) + 15 == 21)
nums = []
for i in range(max(n-100,0),n):
if i + sum_num(i) == n:
nums.append(i)
if len(nums) > 0:
print(len(nums))
print(" ".join(map(str, nums)))
else:
print(0)
```
| 3
|
|
625
|
B
|
War of the Corporations
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms",
"greedy",
"strings"
] | null | null |
A long time ago, in a galaxy far far away two giant IT-corporations Pineapple and Gogol continue their fierce competition. Crucial moment is just around the corner: Gogol is ready to release it's new tablet Lastus 3000.
This new device is equipped with specially designed artificial intelligence (AI). Employees of Pineapple did their best to postpone the release of Lastus 3000 as long as possible. Finally, they found out, that the name of the new artificial intelligence is similar to the name of the phone, that Pineapple released 200 years ago. As all rights on its name belong to Pineapple, they stand on changing the name of Gogol's artificial intelligence.
Pineapple insists, that the name of their phone occurs in the name of AI as a substring. Because the name of technology was already printed on all devices, the Gogol's director decided to replace some characters in AI name with "#". As this operation is pretty expensive, you should find the minimum number of characters to replace with "#", such that the name of AI doesn't contain the name of the phone as a substring.
Substring is a continuous subsequence of a string.
|
The first line of the input contains the name of AI designed by Gogol, its length doesn't exceed 100<=000 characters. Second line contains the name of the phone released by Pineapple 200 years ago, its length doesn't exceed 30. Both string are non-empty and consist of only small English letters.
|
Print the minimum number of characters that must be replaced with "#" in order to obtain that the name of the phone doesn't occur in the name of AI as a substring.
|
[
"intellect\ntell\n",
"google\napple\n",
"sirisiri\nsir\n"
] |
[
"1",
"0",
"2"
] |
In the first sample AI's name may be replaced with "int#llect".
In the second sample Gogol can just keep things as they are.
In the third sample one of the new possible names of AI may be "s#ris#ri".
| 750
|
[
{
"input": "intellect\ntell",
"output": "1"
},
{
"input": "google\napple",
"output": "0"
},
{
"input": "sirisiri\nsir",
"output": "2"
},
{
"input": "sirisiri\nsiri",
"output": "2"
},
{
"input": "aaaaaaa\naaaa",
"output": "1"
},
{
"input": "bbbbbb\nbb",
"output": "3"
},
{
"input": "abc\nabcabc",
"output": "0"
},
{
"input": "kek\nkekekek",
"output": "0"
},
{
"input": "aaaaa\naaa",
"output": "1"
},
{
"input": "abcdabcv\nabcd",
"output": "1"
},
{
"input": "abcabcabczabcabcabcz\ncab",
"output": "4"
},
{
"input": "aatopotopotopotaa\ntopot",
"output": "2"
},
{
"input": "abcabcabcabcabcabcabcabcabcabc\nabcabcabcabcabcabcabcabcabcabc",
"output": "1"
},
{
"input": "sosossosos\nsos",
"output": "2"
},
{
"input": "sosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosos\nsos",
"output": "20"
},
{
"input": "tatatx\ntatx",
"output": "1"
},
{
"input": "sxxsxxsxxd\nsxxsxxd",
"output": "1"
}
] | 1,571,013,337
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 4
| 124
| 0
|
a = input()
b = input()
cont = 0
resp = 0
t1 = len(a)
t2 = len(b)
for i in range(t1-t2+1):
cont = 0
for j in range(t2):
if a[i+j]==b[j]:
cont+=1
if cont ==t2:
resp+=1
i+=cont
else:
i+=1
print(resp)
|
Title: War of the Corporations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A long time ago, in a galaxy far far away two giant IT-corporations Pineapple and Gogol continue their fierce competition. Crucial moment is just around the corner: Gogol is ready to release it's new tablet Lastus 3000.
This new device is equipped with specially designed artificial intelligence (AI). Employees of Pineapple did their best to postpone the release of Lastus 3000 as long as possible. Finally, they found out, that the name of the new artificial intelligence is similar to the name of the phone, that Pineapple released 200 years ago. As all rights on its name belong to Pineapple, they stand on changing the name of Gogol's artificial intelligence.
Pineapple insists, that the name of their phone occurs in the name of AI as a substring. Because the name of technology was already printed on all devices, the Gogol's director decided to replace some characters in AI name with "#". As this operation is pretty expensive, you should find the minimum number of characters to replace with "#", such that the name of AI doesn't contain the name of the phone as a substring.
Substring is a continuous subsequence of a string.
Input Specification:
The first line of the input contains the name of AI designed by Gogol, its length doesn't exceed 100<=000 characters. Second line contains the name of the phone released by Pineapple 200 years ago, its length doesn't exceed 30. Both string are non-empty and consist of only small English letters.
Output Specification:
Print the minimum number of characters that must be replaced with "#" in order to obtain that the name of the phone doesn't occur in the name of AI as a substring.
Demo Input:
['intellect\ntell\n', 'google\napple\n', 'sirisiri\nsir\n']
Demo Output:
['1', '0', '2']
Note:
In the first sample AI's name may be replaced with "int#llect".
In the second sample Gogol can just keep things as they are.
In the third sample one of the new possible names of AI may be "s#ris#ri".
|
```python
a = input()
b = input()
cont = 0
resp = 0
t1 = len(a)
t2 = len(b)
for i in range(t1-t2+1):
cont = 0
for j in range(t2):
if a[i+j]==b[j]:
cont+=1
if cont ==t2:
resp+=1
i+=cont
else:
i+=1
print(resp)
```
| 0
|
|
839
|
A
|
Arya and Bran
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Bran and his older sister Arya are from the same house. Bran like candies so much, so Arya is going to give him some Candies.
At first, Arya and Bran have 0 Candies. There are *n* days, at the *i*-th day, Arya finds *a**i* candies in a box, that is given by the Many-Faced God. Every day she can give Bran at most 8 of her candies. If she don't give him the candies at the same day, they are saved for her and she can give them to him later.
Your task is to find the minimum number of days Arya needs to give Bran *k* candies before the end of the *n*-th day. Formally, you need to output the minimum day index to the end of which *k* candies will be given out (the days are indexed from 1 to *n*).
Print -1 if she can't give him *k* candies during *n* given days.
|
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=10000).
The second line contains *n* integers *a*1,<=*a*2,<=*a*3,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100).
|
If it is impossible for Arya to give Bran *k* candies within *n* days, print -1.
Otherwise print a single integer — the minimum number of days Arya needs to give Bran *k* candies before the end of the *n*-th day.
|
[
"2 3\n1 2\n",
"3 17\n10 10 10\n",
"1 9\n10\n"
] |
[
"2",
"3",
"-1"
] |
In the first sample, Arya can give Bran 3 candies in 2 days.
In the second sample, Arya can give Bran 17 candies in 3 days, because she can give him at most 8 candies per day.
In the third sample, Arya can't give Bran 9 candies, because she can give him at most 8 candies per day and she must give him the candies within 1 day.
| 500
|
[
{
"input": "2 3\n1 2",
"output": "2"
},
{
"input": "3 17\n10 10 10",
"output": "3"
},
{
"input": "1 9\n10",
"output": "-1"
},
{
"input": "10 70\n6 5 2 3 3 2 1 4 3 2",
"output": "-1"
},
{
"input": "20 140\n40 4 81 40 10 54 34 50 84 60 16 1 90 78 38 93 99 60 81 99",
"output": "18"
},
{
"input": "30 133\n3 2 3 4 3 7 4 5 5 6 7 2 1 3 4 6 7 4 6 4 7 5 7 1 3 4 1 6 8 5",
"output": "30"
},
{
"input": "40 320\n70 79 21 64 95 36 63 29 66 89 30 34 100 76 42 12 4 56 80 78 83 1 39 9 34 45 6 71 27 31 55 52 72 71 38 21 43 83 48 47",
"output": "40"
},
{
"input": "50 300\n5 3 11 8 7 4 9 5 5 1 6 3 5 7 4 2 2 10 8 1 7 10 4 4 11 5 2 4 9 1 5 4 11 9 11 2 7 4 4 8 10 9 1 11 10 2 4 11 6 9",
"output": "-1"
},
{
"input": "37 30\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "30"
},
{
"input": "100 456\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "57"
},
{
"input": "90 298\n94 90 98 94 93 90 99 98 90 96 93 96 92 92 97 98 94 94 96 100 93 96 95 98 94 91 95 95 94 90 93 96 93 100 99 98 94 95 98 91 91 98 97 100 98 93 92 93 91 100 92 97 95 95 97 94 98 97 99 100 90 96 93 100 95 99 92 100 99 91 97 99 98 93 90 93 97 95 94 96 90 100 94 93 91 92 97 97 97 100",
"output": "38"
},
{
"input": "7 43\n4 3 7 9 3 8 10",
"output": "-1"
},
{
"input": "99 585\n8 2 3 3 10 7 9 4 7 4 6 8 7 11 5 8 7 4 7 7 6 7 11 8 1 7 3 2 10 1 6 10 10 5 10 2 5 5 11 6 4 1 5 10 5 8 1 3 7 10 6 1 1 3 8 11 5 8 2 2 5 4 7 6 7 5 8 7 10 9 6 11 4 8 2 7 1 7 1 4 11 1 9 6 1 10 6 10 1 5 6 5 2 5 11 5 1 10 8",
"output": "-1"
},
{
"input": "30 177\n8 7 5 8 3 7 2 4 3 8 11 3 9 11 2 4 1 4 5 6 11 5 8 3 6 3 11 2 11 8",
"output": "-1"
},
{
"input": "19 129\n3 3 10 11 4 7 3 8 10 2 11 6 11 9 4 2 11 10 5",
"output": "-1"
},
{
"input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "13 104\n94 55 20 96 86 76 13 71 13 1 32 76 69",
"output": "13"
},
{
"input": "85 680\n61 44 55 6 30 74 27 26 17 45 73 1 67 71 39 32 13 25 79 66 4 59 49 28 29 22 10 17 98 80 36 99 52 24 59 44 27 79 29 46 29 12 47 72 82 25 6 30 81 72 95 65 30 71 72 45 39 16 16 89 48 42 59 71 50 58 31 65 91 70 48 56 28 34 53 89 94 98 49 55 94 65 91 11 53",
"output": "85"
},
{
"input": "100 458\n3 6 4 1 8 4 1 5 4 4 5 8 4 4 6 6 5 1 2 2 2 1 7 1 1 2 6 5 7 8 3 3 8 3 7 5 7 6 6 2 4 2 2 1 1 8 6 1 5 3 3 4 1 4 6 8 5 4 8 5 4 5 5 1 3 1 6 7 6 2 7 3 4 8 1 8 6 7 1 2 4 6 7 4 8 8 8 4 8 7 5 2 8 4 2 5 6 8 8 5",
"output": "100"
},
{
"input": "98 430\n4 7 6 3 4 1 7 1 1 6 6 1 5 4 6 1 5 4 6 6 1 5 1 1 8 1 6 6 2 6 8 4 4 6 6 8 8 7 4 1 2 4 1 5 4 3 7 3 2 5 7 7 7 2 2 2 7 2 8 7 3 4 5 7 8 3 7 6 7 3 2 4 7 1 4 4 7 1 1 8 4 5 8 3 1 5 3 5 2 1 3 3 8 1 3 5 8 6",
"output": "98"
},
{
"input": "90 80\n6 1 7 1 1 8 6 6 6 1 5 4 2 2 8 4 8 7 7 2 5 7 7 8 5 5 6 3 3 8 3 5 6 3 4 2 6 5 5 3 3 3 8 6 6 1 8 3 6 5 4 8 5 4 3 7 1 3 2 3 3 7 7 7 3 5 2 6 2 3 6 4 6 5 5 3 2 1 1 7 3 3 4 3 4 2 1 2 3 1",
"output": "18"
},
{
"input": "89 99\n7 7 3 5 2 7 8 8 1 1 5 7 7 4 1 5 3 4 4 8 8 3 3 2 6 3 8 2 7 5 8 1 3 5 3 6 4 3 6 2 3 3 4 5 1 6 1 7 7 7 6 7 7 7 8 8 8 2 1 7 5 8 6 7 7 4 7 5 7 8 1 3 5 8 7 1 4 2 5 8 3 4 4 5 5 6 2 4 2",
"output": "21"
},
{
"input": "50 700\n4 3 2 8 8 5 5 3 3 4 7 2 6 6 3 3 8 4 2 4 8 6 5 4 5 4 5 8 6 5 4 7 2 4 1 6 2 6 8 6 2 5 8 1 3 8 3 8 4 1",
"output": "-1"
},
{
"input": "82 359\n95 98 95 90 90 96 91 94 93 99 100 100 92 99 96 94 99 90 94 96 91 91 90 93 97 96 90 94 97 99 93 90 99 98 96 100 93 97 100 91 100 92 93 100 92 90 90 94 99 95 100 98 99 96 94 96 96 99 99 91 97 100 95 100 99 91 94 91 98 98 100 97 93 93 96 97 94 94 92 100 91 91",
"output": "45"
},
{
"input": "60 500\n93 93 100 99 91 92 95 93 95 99 93 91 97 98 90 91 98 100 95 100 94 93 92 91 91 98 98 90 93 91 90 96 92 93 92 94 94 91 96 94 98 100 97 96 96 97 91 99 97 95 96 94 91 92 99 95 97 92 98 90",
"output": "-1"
},
{
"input": "98 776\n48 63 26 3 88 81 27 33 37 10 2 89 41 84 98 93 25 44 42 90 41 65 97 1 28 69 42 14 86 18 96 28 28 94 78 8 44 31 96 45 26 52 93 25 48 39 3 75 94 93 63 59 67 86 18 74 27 38 68 7 31 60 69 67 20 11 19 34 47 43 86 96 3 49 56 60 35 49 89 28 92 69 48 15 17 73 99 69 2 73 27 35 28 53 11 1 96 50",
"output": "97"
},
{
"input": "100 189\n15 14 32 65 28 96 33 93 48 28 57 20 32 20 90 42 57 53 18 58 94 21 27 29 37 22 94 45 67 60 83 23 20 23 35 93 3 42 6 46 68 46 34 25 17 16 50 5 49 91 23 76 69 100 58 68 81 32 88 41 64 29 37 13 95 25 6 59 74 58 31 35 16 80 13 80 10 59 85 18 16 70 51 40 44 28 8 76 8 87 53 86 28 100 2 73 14 100 52 9",
"output": "24"
},
{
"input": "99 167\n72 4 79 73 49 58 15 13 92 92 42 36 35 21 13 10 51 94 64 35 86 50 6 80 93 77 59 71 2 88 22 10 27 30 87 12 77 6 34 56 31 67 78 84 36 27 15 15 12 56 80 7 56 14 10 9 14 59 15 20 34 81 8 49 51 72 4 58 38 77 31 86 18 61 27 86 95 36 46 36 39 18 78 39 48 37 71 12 51 92 65 48 39 22 16 87 4 5 42",
"output": "21"
},
{
"input": "90 4\n48 4 4 78 39 3 85 29 69 52 70 39 11 98 42 56 65 98 77 24 61 31 6 59 60 62 84 46 67 59 15 44 99 23 12 74 2 48 84 60 51 28 17 90 10 82 3 43 50 100 45 57 57 95 53 71 20 74 52 46 64 59 72 33 74 16 44 44 80 71 83 1 70 59 61 6 82 69 81 45 88 28 17 24 22 25 53 97 1 100",
"output": "1"
},
{
"input": "30 102\n55 94 3 96 3 47 92 85 25 78 27 70 97 83 40 2 55 12 74 84 91 37 31 85 7 40 33 54 72 5",
"output": "13"
},
{
"input": "81 108\n61 59 40 100 8 75 5 74 87 12 6 23 98 26 59 68 27 4 98 79 14 44 4 11 89 77 29 90 33 3 43 1 87 91 28 24 4 84 75 7 37 46 15 46 8 87 68 66 5 21 36 62 77 74 91 95 88 28 12 48 18 93 14 51 33 5 99 62 99 38 49 15 56 87 52 64 69 46 41 12 92",
"output": "14"
},
{
"input": "2 16\n10 6",
"output": "2"
},
{
"input": "2 8\n7 8",
"output": "2"
},
{
"input": "2 9\n4 8",
"output": "2"
},
{
"input": "3 19\n9 9 1",
"output": "3"
},
{
"input": "4 32\n9 9 9 5",
"output": "4"
},
{
"input": "2 15\n14 1",
"output": "2"
},
{
"input": "2 3\n3 3",
"output": "1"
},
{
"input": "3 10\n10 1 1",
"output": "2"
},
{
"input": "12 20\n3 16 19 10 1 6 17 8 6 20 1 4",
"output": "4"
},
{
"input": "4 15\n14 3 3 3",
"output": "2"
},
{
"input": "5 40\n10 10 10 10 1",
"output": "5"
},
{
"input": "4 31\n9 9 8 5",
"output": "4"
},
{
"input": "4 31\n20 7 1 1",
"output": "-1"
},
{
"input": "2 10\n9 1",
"output": "2"
},
{
"input": "10 50\n100 10 1 1 1 1 1 1 1 1",
"output": "7"
},
{
"input": "2 11\n10 2",
"output": "2"
},
{
"input": "3 21\n10 10 1",
"output": "3"
},
{
"input": "2 2\n1 2",
"output": "2"
},
{
"input": "3 2\n1 8 8",
"output": "2"
},
{
"input": "2 11\n10 1",
"output": "2"
},
{
"input": "2 16\n12 4",
"output": "2"
},
{
"input": "3 11\n9 2 2",
"output": "2"
},
{
"input": "3 11\n4 3 4",
"output": "3"
},
{
"input": "2 13\n7 6",
"output": "2"
},
{
"input": "3 24\n14 3 4",
"output": "-1"
},
{
"input": "2 13\n10 3",
"output": "2"
},
{
"input": "3 11\n9 2 1",
"output": "2"
},
{
"input": "2 15\n12 3",
"output": "2"
},
{
"input": "2 14\n11 4",
"output": "2"
}
] | 1,644,524,253
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 60
| 46
| 0
|
n,k = map(int,input().split())
l = list(map(int,input().split()))
t,f = 0,0
for i in range(0,n):
t += l[i]
k = k-min(8,t)
t-=min(8,t)
if k<=0:
f=1
break
print([-1,i+1][f==1])
|
Title: Arya and Bran
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bran and his older sister Arya are from the same house. Bran like candies so much, so Arya is going to give him some Candies.
At first, Arya and Bran have 0 Candies. There are *n* days, at the *i*-th day, Arya finds *a**i* candies in a box, that is given by the Many-Faced God. Every day she can give Bran at most 8 of her candies. If she don't give him the candies at the same day, they are saved for her and she can give them to him later.
Your task is to find the minimum number of days Arya needs to give Bran *k* candies before the end of the *n*-th day. Formally, you need to output the minimum day index to the end of which *k* candies will be given out (the days are indexed from 1 to *n*).
Print -1 if she can't give him *k* candies during *n* given days.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=10000).
The second line contains *n* integers *a*1,<=*a*2,<=*a*3,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100).
Output Specification:
If it is impossible for Arya to give Bran *k* candies within *n* days, print -1.
Otherwise print a single integer — the minimum number of days Arya needs to give Bran *k* candies before the end of the *n*-th day.
Demo Input:
['2 3\n1 2\n', '3 17\n10 10 10\n', '1 9\n10\n']
Demo Output:
['2', '3', '-1']
Note:
In the first sample, Arya can give Bran 3 candies in 2 days.
In the second sample, Arya can give Bran 17 candies in 3 days, because she can give him at most 8 candies per day.
In the third sample, Arya can't give Bran 9 candies, because she can give him at most 8 candies per day and she must give him the candies within 1 day.
|
```python
n,k = map(int,input().split())
l = list(map(int,input().split()))
t,f = 0,0
for i in range(0,n):
t += l[i]
k = k-min(8,t)
t-=min(8,t)
if k<=0:
f=1
break
print([-1,i+1][f==1])
```
| 3
|
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,606,568,864
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 80
| 218
| 0
|
a=[]
res=0
for i in range(int(input())):
a.append(list(map(int,input().split())))
res+=sum(a[i])
if(res==0):
print("YES")
else:
print("NO")
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
a=[]
res=0
for i in range(int(input())):
a.append(list(map(int,input().split())))
res+=sum(a[i])
if(res==0):
print("YES")
else:
print("NO")
```
| 0
|
467
|
A
|
George and Accommodation
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory.
George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≤<=*q**i*). Your task is to count how many rooms has free place for both George and Alex.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of rooms.
The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≤<=*p**i*<=≤<=*q**i*<=≤<=100) — the number of people who already live in the *i*-th room and the room's capacity.
|
Print a single integer — the number of rooms where George and Alex can move in.
|
[
"3\n1 1\n2 2\n3 3\n",
"3\n1 10\n0 10\n10 10\n"
] |
[
"0\n",
"2\n"
] |
none
| 500
|
[
{
"input": "3\n1 1\n2 2\n3 3",
"output": "0"
},
{
"input": "3\n1 10\n0 10\n10 10",
"output": "2"
},
{
"input": "2\n36 67\n61 69",
"output": "2"
},
{
"input": "3\n21 71\n10 88\n43 62",
"output": "3"
},
{
"input": "3\n1 2\n2 3\n3 4",
"output": "0"
},
{
"input": "10\n0 10\n0 20\n0 30\n0 40\n0 50\n0 60\n0 70\n0 80\n0 90\n0 100",
"output": "10"
},
{
"input": "13\n14 16\n30 31\n45 46\n19 20\n15 17\n66 67\n75 76\n95 97\n29 30\n37 38\n0 2\n36 37\n8 9",
"output": "4"
},
{
"input": "19\n66 67\n97 98\n89 91\n67 69\n67 68\n18 20\n72 74\n28 30\n91 92\n27 28\n75 77\n17 18\n74 75\n28 30\n16 18\n90 92\n9 11\n22 24\n52 54",
"output": "12"
},
{
"input": "15\n55 57\n95 97\n57 59\n34 36\n50 52\n96 98\n39 40\n13 15\n13 14\n74 76\n47 48\n56 58\n24 25\n11 13\n67 68",
"output": "10"
},
{
"input": "17\n68 69\n47 48\n30 31\n52 54\n41 43\n33 35\n38 40\n56 58\n45 46\n92 93\n73 74\n61 63\n65 66\n37 39\n67 68\n77 78\n28 30",
"output": "8"
},
{
"input": "14\n64 66\n43 44\n10 12\n76 77\n11 12\n25 27\n87 88\n62 64\n39 41\n58 60\n10 11\n28 29\n57 58\n12 14",
"output": "7"
},
{
"input": "38\n74 76\n52 54\n78 80\n48 49\n40 41\n64 65\n28 30\n6 8\n49 51\n68 70\n44 45\n57 59\n24 25\n46 48\n49 51\n4 6\n63 64\n76 78\n57 59\n18 20\n63 64\n71 73\n88 90\n21 22\n89 90\n65 66\n89 91\n96 98\n42 44\n1 1\n74 76\n72 74\n39 40\n75 76\n29 30\n48 49\n87 89\n27 28",
"output": "22"
},
{
"input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "26\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2",
"output": "0"
},
{
"input": "68\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2",
"output": "68"
},
{
"input": "7\n0 1\n1 5\n2 4\n3 5\n4 6\n5 6\n6 8",
"output": "5"
},
{
"input": "1\n0 0",
"output": "0"
},
{
"input": "1\n100 100",
"output": "0"
},
{
"input": "44\n0 8\n1 11\n2 19\n3 5\n4 29\n5 45\n6 6\n7 40\n8 19\n9 22\n10 18\n11 26\n12 46\n13 13\n14 27\n15 48\n16 25\n17 20\n18 29\n19 27\n20 45\n21 39\n22 29\n23 39\n24 42\n25 37\n26 52\n27 36\n28 43\n29 35\n30 38\n31 70\n32 47\n33 38\n34 61\n35 71\n36 51\n37 71\n38 59\n39 77\n40 70\n41 80\n42 77\n43 73",
"output": "42"
},
{
"input": "3\n1 3\n2 7\n8 9",
"output": "2"
},
{
"input": "53\n0 1\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n18 19\n19 20\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53",
"output": "0"
},
{
"input": "55\n0 0\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54",
"output": "0"
},
{
"input": "51\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 62\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 82\n55 68\n55 70\n55 63\n55 55\n55 55\n55 55\n55 75\n55 75\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 82\n55 99\n55 60",
"output": "12"
},
{
"input": "14\n1 1\n1 1\n1 55\n1 16\n1 1\n1 1\n1 55\n1 62\n1 53\n1 26\n1 1\n1 36\n1 2\n1 3",
"output": "8"
}
] | 1,688,426,443
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 27
| 46
| 0
|
n = int(input())
counter = 0
for p_q in range(n):
l = [int(x) for x in input().split()]
counter += ((l[1] - l[0]) >= 2)
print(counter)
|
Title: George and Accommodation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory.
George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≤<=*q**i*). Your task is to count how many rooms has free place for both George and Alex.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of rooms.
The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≤<=*p**i*<=≤<=*q**i*<=≤<=100) — the number of people who already live in the *i*-th room and the room's capacity.
Output Specification:
Print a single integer — the number of rooms where George and Alex can move in.
Demo Input:
['3\n1 1\n2 2\n3 3\n', '3\n1 10\n0 10\n10 10\n']
Demo Output:
['0\n', '2\n']
Note:
none
|
```python
n = int(input())
counter = 0
for p_q in range(n):
l = [int(x) for x in input().split()]
counter += ((l[1] - l[0]) >= 2)
print(counter)
```
| 3
|
|
802
|
G
|
Fake News (easy)
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
|
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
|
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
|
[
"abcheaibcdi\n",
"hiedi\n"
] |
[
"YES",
"NO"
] |
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
| 0
|
[
{
"input": "abcheaibcdi",
"output": "YES"
},
{
"input": "hiedi",
"output": "NO"
},
{
"input": "ihied",
"output": "NO"
},
{
"input": "diehi",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "iheid",
"output": "NO"
},
{
"input": "eihdi",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "edhii",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "eufyajkssayhjhqcwxmctecaeepjwmfoscqprpcxsqfwnlgzsmmuwuoruantipholrauvxydfvftwfzhnckxswussvlidcojiciflpvkcxkkcmmvtfvxrkwcpeelwsuzqgamamdtdgzscmikvojfvqehblmjczkvtdeymgertgkwfwfukafqlfdhtedcctixhyetdypswgagrpyto",
"output": "YES"
},
{
"input": "arfbvxgdvqzuloojjrwoyqqbxamxybaqltfimofulusfebodjkwwrgwcppkwiodtpjaraglyplgerrpqjkpoggjmfxhwtqrijpijrcyxnoodvwpyjfpvqaoazllbrpzananbrvvybboedidtuvqquklkpeflfaltukjhzjgiofombhbmqbihgtapswykfvlgdoapjqntvqsaohmbvnphvyyhvhavslamczuqifxnwknkaenqmlvetrqogqxmlptgrmqvxzdxdmwobjesmgxckpmawtioavwdngyiwkzypfnxcovwzdohshwlavwsthdssiadhiwmhpvgkrbezm",
"output": "YES"
},
{
"input": "zcectngbqnejjjtsfrluummmqabzqbyccshjqbrjthzhlbmzjfxugvjouwhumsgrnopiyakfadjnbsesamhynsbfbfunupwbxvohfmpwlcpxhovwpfpciclatgmiufwdvtsqrsdcymvkldpnhfeisrzhyhhlkwdzthgprvkpyldeysvbmcibqkpudyrraqdlxpjecvwcvuiklcrsbgvqasmxmtxqzmawcjtozioqlfflinnxpeexbzloaeqjvglbdeufultpjqexvjjjkzemtzuzmxvawilcqdrcjzpqyhtwfphuonzwkotthsaxrmwtnlmcdylxqcfffyndqeouztluqwlhnkkvzwcfiscikv",
"output": "YES"
},
{
"input": "plqaykgovxkvsiahdbglktdlhcqwelxxmtlyymrsyubxdskvyjkrowvcbpdofpjqspsrgpakdczletxujzlsegepzleipiyycpinzxgwjsgslnxsotouddgfcybozfpjhhocpybfjbaywsehbcfrayvancbrumdfngqytnhihyxnlvilrqyhnxeckprqafofelospffhtwguzjbbjlzbqrtiielbvzutzgpqxosiaqznndgobcluuqlhmffiowkjdlkokehtjdyjvmxsiyxureflmdomerfekxdvtitvwzmdsdzplkpbtafxqfpudnhfqpoiwvjnylanunmagoweobdvfjgepbsymfutrjarlxclhgavpytiiqwvojrptofuvlohzeguxdsrihsbucelhhuedltnnjgzxwyblbqvnoliiydfinzlogbvucwykryzcyibnniggbkdkdcdgcsbvvnavtyhtkanrblpvomvjs",
"output": "YES"
},
{
"input": "fbldqzggeunkpwcfirxanmntbfrudijltoertsdvcvcmbwodbibsrxendzebvxwydpasaqnisrijctsuatihxxygbeovhxjdptdcppkvfytdpjspvrannxavmkmisqtygntxkdlousdypyfkrpzapysfpdbyprufwzhunlsfugojddkmxzinatiwfxdqmgyrnjnxvrclhxyuwxtshoqdjptmeecvgmrlvuwqtmnfnfeeiwcavwnqmyustawbjodzwsqmnjxhpqmgpysierlwbbdzcwprpsexyvreewcmlbvaiytjlxdqdaqftefdlmtmmjcwvfejshymhnouoshdzqcwzxpzupkbcievodzqkqvyjuuxxwepxjalvkzufnveji",
"output": "YES"
},
{
"input": "htsyljgoelbbuipivuzrhmfpkgderqpoprlxdpasxhpmxvaztccldtmujjzjmcpdvsdghzpretlsyyiljhjznseaacruriufswuvizwwuvdioazophhyytvbiogttnnouauxllbdn",
"output": "YES"
},
{
"input": "ikmxzqdzxqlvgeojsnhqzciujslwjyzzexnregabdqztpplosdakimjxmuqccbnwvzbajoiqgdobccwnrwmixohrbdarhoeeelzbpigiybtesybwefpcfx",
"output": "YES"
},
{
"input": "bpvbpjvbdfiodsmahxpcubjxdykesubnypalhypantshkjffmxjmelblqnjdmtaltneuyudyevkgedkqrdmrfeemgpghwrifcwincfixokfgurhqbcfzeajrgkgpwqwsepudxulywowwxzdxkumsicsvnzfxspmjpaixgejeaoyoibegosqoyoydmphfpbutrrewyjecowjckvpcceoamtfbitdneuwqfvnagswlskmsmkhmxyfsrpqwhxzocyffiumcy",
"output": "YES"
},
{
"input": "vllsexwrazvlfvhvrtqeohvzzresjdiuhomfpgqcxpqdevplecuaepixhlijatxzegciizpvyvxuembiplwklahlqibykfideysjygagjbgqkbhdhkatddcwlxboinfuomnpc",
"output": "YES"
},
{
"input": "pnjdwpxmvfoqkjtbhquqcuredrkwqzzfjmdvpnbqtypzdovemhhclkvigjvtprrpzbrbcbatkucaqteuciuozytsptvsskkeplaxdaqmjkmef",
"output": "NO"
},
{
"input": "jpwfhvlxvsdhtuozvlmnfiotrgapgjxtcsgcjnodcztupysvvvmjpzqkpommadppdrykuqkcpzojcwvlogvkddedwbggkrhuvtsvdiokehlkdlnukcufjvqxnikcdawvexxwffxtriqbdmkahxdtygodzohwtdmmuvmatdkvweqvaehaxiefpevkvqpyxsrhtmgjsdfcwzqobibeduooldrmglbinrepmunizheqzvgqvpdskhxfidxfnbisyizhepwyrcykcmjxnkyfjgrqlkixcvysa",
"output": "YES"
},
{
"input": "aftcrvuumeqbfvaqlltscnuhkpcifrrhnutjinxdhhdbzvizlrapzjdatuaynoplgjketupgaejciosofuhcgcjdcucarfvtsofgubtphijciswsvidnvpztlaarydkeqxzwdhfbmullkimerukusbrdnnujviydldrwhdfllsjtziwfeaiqotbiprespmxjulnyunkdtcghrzvhtcychkwatqqmladxpvmvlkzscthylbzkpgwlzfjqwarqvdeyngekqvrhrftpxnkfcibbowvnqdkulcdydspcubwlgoyinpnzgidbgunparnueddzwtzdiavbprbbg",
"output": "YES"
},
{
"input": "oagjghsidigeh",
"output": "NO"
},
{
"input": "chdhzpfzabupskiusjoefrwmjmqkbmdgboicnszkhdrlegeqjsldurmbshijadlwsycselhlnudndpdhcnhruhhvsgbthpruiqfirxkhpqhzhqdfpyozolbionodypfcqfeqbkcgmqkizgeyyelzeoothexcoaahedgrvoemqcwccbvoeqawqeuusyjxmgjkpfwcdttfmwunzuwvsihliexlzygqcgpbdiawfvqukikhbjerjkyhpcknlndaystrgsinghlmekbvhntcpypmchcwoglsmwwdulqneuabuuuvtyrnjxfcgoothalwkzzfxakneusezgnnepkpipzromqubraiggqndliz",
"output": "YES"
},
{
"input": "lgirxqkrkgjcutpqitmffvbujcljkqardlalyigxorscczuzikoylcxenryhskoavymexysvmhbsvhtycjlmzhijpuvcjshyfeycvvcfyzytzoyvxajpqdjtfiatnvxnyeqtfcagfftafllhhjhplbdsrfpctkqpinpdfrtlzyjllfbeffputywcckupyslkbbzpgcnxgbmhtqeqqehpdaokkjtatrhyiuusjhwgiiiikxpzdueasemosmmccoakafgvxduwiuflovhhfhffgnnjhoperhhjtvocpqytjxkmrknnknqeglffhfuplopmktykxuvcmbwpoeisrlyyhdpxfvzseucofyhziuiikihpqheqdyzwigeaqzhxzvporgisxgvhyicqyejovqloibhbunsvsunpvmdckkbuokitdzleilfwutcvuuytpupizinfjrzhxudsmjcjyfcpfgthujjowdwtgbvi",
"output": "YES"
},
{
"input": "uuehrvufgerqbzyzksmqnewacotuimawhlbycdbsmhshrsbqwybbkwjwsrkwptvlbbwjiivqugzrxxwgidrcrhrwsmwgeoleptfamzefgaeyxouxocrpvomjrazmxrnffdwrrmblgdiabdncvfougtmjgvvazasnygdrigbsrieoonirlivfyodvulouslxosswgpdexuldmkdbpdlgutiotvxjyecbrsvbmqxrlcpcipjjncduyqtohlzybvlemmfdeubihwlwqglkgjvnwrbgydcpwklmjeewqklmqdbajqgrpnynaxfvxjzgibqerxyhnxenrmcdqaaeksbzyrcaepozqpetaurlhjuxxhwppuhgoihxdxbmxeiahyaqkbknktlzkheaarjoqqrsyeducvoygwalgarldcdlqogfvsncejssmx",
"output": "YES"
},
{
"input": "iiopulfjxoitgiusqrhgbkiyzinphjtclodbkkydetylvuimkhdkklmyoacmekdvjpuxcrvqnjhqhhbfenlpzpwijtykqziocilvtpqhxuyrphdlamawjuzgjwiebkqyrzyqgtkcrhntjxqmcgkrqcslogjegfrivzidfedeegwbbsopvxvdoididlpypjogxaodtueebbwuwilacunqpozczcgrpaxxrtogpxgfkudtxchoravrrdtimhenwmnafxaruuojduxxglefejycfcyxllfimkszmbrhcwpnwjqgwvzysmlaaifdxfjjpgjmcksiigpanappjdloiolojmcqbnpnjjzaufdpjaknylmyvolhwypygwepmqwpiglpcnpypnudhdzpdvgzosyjthzcwtytxq",
"output": "YES"
}
] | 1,619,586,192
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 31
| 0
|
x = input("Enter the string: ")
y =" "
x=x.lower()
z = 0
u = 0
a = 0
q = 0
p = 0
for i in range(len(x)):
if(x[i]=="h"):
y=y+x[i]
z = i
break
for i in range(z+1, len(x)):
if(x[i]=="e"):
y=y+x[j]
u= j
break
for i in range(a+1, len(x)):
if(x[i]=="i"):
y=y+x[k]
a= k
break
for i in range(q+1, len(x)):
if(x[i]=="d"):
y=y+x[l]
q= l
break
for i in range(q+1, len(x)):
if(x[i]=="d"):
y=y+x[l]
if (y == "heidi"):
print("YES")
else:
print("NO")
|
Title: Fake News (easy)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
Input Specification:
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
Output Specification:
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
Demo Input:
['abcheaibcdi\n', 'hiedi\n']
Demo Output:
['YES', 'NO']
Note:
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
|
```python
x = input("Enter the string: ")
y =" "
x=x.lower()
z = 0
u = 0
a = 0
q = 0
p = 0
for i in range(len(x)):
if(x[i]=="h"):
y=y+x[i]
z = i
break
for i in range(z+1, len(x)):
if(x[i]=="e"):
y=y+x[j]
u= j
break
for i in range(a+1, len(x)):
if(x[i]=="i"):
y=y+x[k]
a= k
break
for i in range(q+1, len(x)):
if(x[i]=="d"):
y=y+x[l]
q= l
break
for i in range(q+1, len(x)):
if(x[i]=="d"):
y=y+x[l]
if (y == "heidi"):
print("YES")
else:
print("NO")
```
| -1
|
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,658,932,863
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 2
| 124
| 2,764,800
|
n=int(input())
arr=[]
for i in range(n):
arr.append(list(map(int, input().split())))
sumi=0
ele=[]
for i in range(n):
for j in range(3):
sumi+=arr[j][i]
ele.append(sumi)
sumi=0
# print(ele)
c=0
for i in range(len(ele)):
if(ele[i]==0):
c+=1
# print(c)
if(c==3):
print("YES")
else:
print("NO")
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
n=int(input())
arr=[]
for i in range(n):
arr.append(list(map(int, input().split())))
sumi=0
ele=[]
for i in range(n):
for j in range(3):
sumi+=arr[j][i]
ele.append(sumi)
sumi=0
# print(ele)
c=0
for i in range(len(ele)):
if(ele[i]==0):
c+=1
# print(c)
if(c==3):
print("YES")
else:
print("NO")
```
| -1
|
304
|
A
|
Pythagorean Theorem II
|
PROGRAMMING
| 1,200
|
[
"brute force",
"math"
] | null | null |
In mathematics, the Pythagorean theorem — is a relation in Euclidean geometry among the three sides of a right-angled triangle. In terms of areas, it states:
In any right-angled triangle, the area of the square whose side is the hypotenuse (the side opposite the right angle) is equal to the sum of the areas of the squares whose sides are the two legs (the two sides that meet at a right angle).
The theorem can be written as an equation relating the lengths of the sides *a*, *b* and *c*, often called the Pythagorean equation:
where *c* represents the length of the hypotenuse, and *a* and *b* represent the lengths of the other two sides.
Given *n*, your task is to count how many right-angled triangles with side-lengths *a*, *b* and *c* that satisfied an inequality 1<=≤<=*a*<=≤<=*b*<=≤<=*c*<=≤<=*n*.
|
The only line contains one integer *n* (1<=≤<=*n*<=≤<=104) as we mentioned above.
|
Print a single integer — the answer to the problem.
|
[
"5\n",
"74\n"
] |
[
"1\n",
"35\n"
] |
none
| 500
|
[
{
"input": "5",
"output": "1"
},
{
"input": "74",
"output": "35"
},
{
"input": "1000",
"output": "881"
},
{
"input": "586",
"output": "472"
},
{
"input": "2",
"output": "0"
},
{
"input": "362",
"output": "258"
},
{
"input": "778",
"output": "653"
},
{
"input": "194",
"output": "120"
},
{
"input": "906",
"output": "786"
},
{
"input": "659",
"output": "535"
},
{
"input": "75",
"output": "37"
},
{
"input": "787",
"output": "664"
},
{
"input": "851",
"output": "730"
},
{
"input": "563",
"output": "446"
},
{
"input": "979",
"output": "862"
},
{
"input": "395",
"output": "291"
},
{
"input": "755",
"output": "634"
},
{
"input": "171",
"output": "103"
},
{
"input": "883",
"output": "759"
},
{
"input": "400",
"output": "294"
},
{
"input": "817",
"output": "693"
},
{
"input": "177",
"output": "107"
},
{
"input": "593",
"output": "476"
},
{
"input": "305",
"output": "214"
},
{
"input": "721",
"output": "595"
},
{
"input": "785",
"output": "664"
},
{
"input": "497",
"output": "383"
},
{
"input": "913",
"output": "791"
},
{
"input": "625",
"output": "507"
},
{
"input": "334",
"output": "236"
},
{
"input": "10000",
"output": "12471"
},
{
"input": "9999",
"output": "12467"
}
] | 1,637,406,154
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 30
| 3,000
| 2,048,000
|
n=int(input())
ans=0
for a in range(1,n+1):
for b in range(a,n+1):
c=int(pow(a*a+b*b,0.5))
if c<=n and c>=b and c*c==a*a+b*b:
ans+=1
print(ans)
|
Title: Pythagorean Theorem II
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In mathematics, the Pythagorean theorem — is a relation in Euclidean geometry among the three sides of a right-angled triangle. In terms of areas, it states:
In any right-angled triangle, the area of the square whose side is the hypotenuse (the side opposite the right angle) is equal to the sum of the areas of the squares whose sides are the two legs (the two sides that meet at a right angle).
The theorem can be written as an equation relating the lengths of the sides *a*, *b* and *c*, often called the Pythagorean equation:
where *c* represents the length of the hypotenuse, and *a* and *b* represent the lengths of the other two sides.
Given *n*, your task is to count how many right-angled triangles with side-lengths *a*, *b* and *c* that satisfied an inequality 1<=≤<=*a*<=≤<=*b*<=≤<=*c*<=≤<=*n*.
Input Specification:
The only line contains one integer *n* (1<=≤<=*n*<=≤<=104) as we mentioned above.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['5\n', '74\n']
Demo Output:
['1\n', '35\n']
Note:
none
|
```python
n=int(input())
ans=0
for a in range(1,n+1):
for b in range(a,n+1):
c=int(pow(a*a+b*b,0.5))
if c<=n and c>=b and c*c==a*a+b*b:
ans+=1
print(ans)
```
| 0
|
|
236
|
A
|
Boy or Girl
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"strings"
] | null | null |
Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network.
But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names.
This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method.
|
The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters.
|
If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes).
|
[
"wjmzbmr\n",
"xiaodao\n",
"sevenkplus\n"
] |
[
"CHAT WITH HER!\n",
"IGNORE HIM!\n",
"CHAT WITH HER!\n"
] |
For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
| 500
|
[
{
"input": "wjmzbmr",
"output": "CHAT WITH HER!"
},
{
"input": "xiaodao",
"output": "IGNORE HIM!"
},
{
"input": "sevenkplus",
"output": "CHAT WITH HER!"
},
{
"input": "pezu",
"output": "CHAT WITH HER!"
},
{
"input": "wnemlgppy",
"output": "CHAT WITH HER!"
},
{
"input": "zcinitufxoldnokacdvtmdohsfdjepyfioyvclhmujiqwvmudbfjzxjfqqxjmoiyxrfsbvseawwoyynn",
"output": "IGNORE HIM!"
},
{
"input": "qsxxuoynwtebujwpxwpajitiwxaxwgbcylxneqiebzfphugwkftpaikixmumkhfbjiswmvzbtiyifbx",
"output": "CHAT WITH HER!"
},
{
"input": "qwbdfzfylckctudyjlyrtmvbidfatdoqfmrfshsqqmhzohhsczscvwzpwyoyswhktjlykumhvaounpzwpxcspxwlgt",
"output": "IGNORE HIM!"
},
{
"input": "nuezoadauueermoeaabjrkxttkatspjsjegjcjcdmcxgodowzbwuqncfbeqlhkk",
"output": "IGNORE HIM!"
},
{
"input": "lggvdmulrsvtuagoavstuyufhypdxfomjlzpnduulukszqnnwfvxbvxyzmleocmofwclmzz",
"output": "IGNORE HIM!"
},
{
"input": "tgcdptnkc",
"output": "IGNORE HIM!"
},
{
"input": "wvfgnfrzabgibzxhzsojskmnlmrokydjoexnvi",
"output": "IGNORE HIM!"
},
{
"input": "sxtburpzskucowowebgrbovhadrrayamuwypmmxhscrujkmcgvyinp",
"output": "IGNORE HIM!"
},
{
"input": "pjqxhvxkyeqqvyuujxhmbspatvrckhhkfloottuybjivkkhpyivcighxumavrxzxslfpggnwbtalmhysyfllznphzia",
"output": "IGNORE HIM!"
},
{
"input": "fpellxwskyekoyvrfnuf",
"output": "CHAT WITH HER!"
},
{
"input": "xninyvkuvakfbs",
"output": "IGNORE HIM!"
},
{
"input": "vnxhrweyvhqufpfywdwftoyrfgrhxuamqhblkvdpxmgvphcbeeqbqssresjifwyzgfhurmamhkwupymuomak",
"output": "CHAT WITH HER!"
},
{
"input": "kmsk",
"output": "IGNORE HIM!"
},
{
"input": "lqonogasrkzhryjxppjyriyfxmdfubieglthyswz",
"output": "CHAT WITH HER!"
},
{
"input": "ndormkufcrkxlihdhmcehzoimcfhqsmombnfjrlcalffq",
"output": "CHAT WITH HER!"
},
{
"input": "zqzlnnuwcfufwujygtczfakhcpqbtxtejrbgoodychepzdphdahtxyfpmlrycyicqthsgm",
"output": "IGNORE HIM!"
},
{
"input": "ppcpbnhwoizajrl",
"output": "IGNORE HIM!"
},
{
"input": "sgubujztzwkzvztitssxxxwzanfmddfqvv",
"output": "CHAT WITH HER!"
},
{
"input": "ptkyaxycecpbrjnvxcjtbqiocqcswnmicxbvhdsptbxyxswbw",
"output": "IGNORE HIM!"
},
{
"input": "yhbtzfppwcycxqjpqdfmjnhwaogyuaxamwxpnrdrnqsgdyfvxu",
"output": "CHAT WITH HER!"
},
{
"input": "ojjvpnkrxibyevxk",
"output": "CHAT WITH HER!"
},
{
"input": "wjweqcrqfuollfvfbiyriijovweg",
"output": "IGNORE HIM!"
},
{
"input": "hkdbykboclchfdsuovvpknwqr",
"output": "IGNORE HIM!"
},
{
"input": "stjvyfrfowopwfjdveduedqylerqugykyu",
"output": "IGNORE HIM!"
},
{
"input": "rafcaanqytfclvfdegak",
"output": "CHAT WITH HER!"
},
{
"input": "xczn",
"output": "CHAT WITH HER!"
},
{
"input": "arcoaeozyeawbveoxpmafxxzdjldsielp",
"output": "IGNORE HIM!"
},
{
"input": "smdfafbyehdylhaleevhoggiurdgeleaxkeqdixyfztkuqsculgslheqfafxyghyuibdgiuwrdxfcitojxika",
"output": "CHAT WITH HER!"
},
{
"input": "vbpfgjqnhfazmvtkpjrdasfhsuxnpiepxfrzvoh",
"output": "CHAT WITH HER!"
},
{
"input": "dbdokywnpqnotfrhdbrzmuyoxfdtrgrzcccninbtmoqvxfatcqg",
"output": "CHAT WITH HER!"
},
{
"input": "udlpagtpq",
"output": "CHAT WITH HER!"
},
{
"input": "zjurevbytijifnpfuyswfchdzelxheboruwjqijxcucylysmwtiqsqqhktexcynquvcwhbjsipy",
"output": "CHAT WITH HER!"
},
{
"input": "qagzrqjomdwhagkhrjahhxkieijyten",
"output": "CHAT WITH HER!"
},
{
"input": "achhcfjnnfwgoufxamcqrsontgjjhgyfzuhklkmiwybnrlsvblnsrjqdytglipxsulpnphpjpoewvlusalsgovwnsngb",
"output": "CHAT WITH HER!"
},
{
"input": "qbkjsdwpahdbbohggbclfcufqelnojoehsxxkr",
"output": "CHAT WITH HER!"
},
{
"input": "cpvftiwgyvnlmbkadiafddpgfpvhqqvuehkypqjsoibpiudfvpkhzlfrykc",
"output": "IGNORE HIM!"
},
{
"input": "lnpdosnceumubvk",
"output": "IGNORE HIM!"
},
{
"input": "efrk",
"output": "CHAT WITH HER!"
},
{
"input": "temnownneghnrujforif",
"output": "IGNORE HIM!"
},
{
"input": "ottnneymszwbumgobazfjyxewkjakglbfflsajuzescplpcxqta",
"output": "IGNORE HIM!"
},
{
"input": "eswpaclodzcwhgixhpyzvhdwsgneqidanbzdzszquefh",
"output": "IGNORE HIM!"
},
{
"input": "gwntwbpj",
"output": "IGNORE HIM!"
},
{
"input": "wuqvlbblkddeindiiswsinkfrnkxghhwunzmmvyovpqapdfbolyim",
"output": "IGNORE HIM!"
},
{
"input": "swdqsnzmzmsyvktukaoyqsqzgfmbzhezbfaqeywgwizrwjyzquaahucjchegknqaioliqd",
"output": "CHAT WITH HER!"
},
{
"input": "vlhrpzezawyolhbmvxbwhtjustdbqggexmzxyieihjlelvwjosmkwesfjmramsikhkupzvfgezmrqzudjcalpjacmhykhgfhrjx",
"output": "IGNORE HIM!"
},
{
"input": "lxxwbkrjgnqjwsnflfnsdyxihmlspgivirazsbveztnkuzpaxtygidniflyjheejelnjyjvgkgvdqks",
"output": "CHAT WITH HER!"
},
{
"input": "wpxbxzfhtdecetpljcrvpjjnllosdqirnkzesiqeukbedkayqx",
"output": "CHAT WITH HER!"
},
{
"input": "vmzxgacicvweclaodrunmjnfwtimceetsaoickarqyrkdghcmyjgmtgsqastcktyrjgvjqimdc",
"output": "CHAT WITH HER!"
},
{
"input": "yzlzmesxdttfcztooypjztlgxwcr",
"output": "IGNORE HIM!"
},
{
"input": "qpbjwzwgdzmeluheirjrvzrhbmagfsjdgvzgwumjtjzecsfkrfqjasssrhhtgdqqfydlmrktlgfc",
"output": "IGNORE HIM!"
},
{
"input": "aqzftsvezdgouyrirsxpbuvdjupnzvbhguyayeqozfzymfnepvwgblqzvmxxkxcilmsjvcgyqykpoaktjvsxbygfgsalbjoq",
"output": "CHAT WITH HER!"
},
{
"input": "znicjjgijhrbdlnwmtjgtdgziollrfxroabfhadygnomodaembllreorlyhnehijfyjbfxucazellblegyfrzuraogadj",
"output": "IGNORE HIM!"
},
{
"input": "qordzrdiknsympdrkgapjxokbldorpnmnpucmwakklmqenpmkom",
"output": "CHAT WITH HER!"
},
{
"input": "wqfldgihuxfktzanyycluzhtewmwvnawqlfoavuguhygqrrxtstxwouuzzsryjqtfqo",
"output": "CHAT WITH HER!"
},
{
"input": "vujtrrpshinkskgyknlcfckmqdrwtklkzlyipmetjvaqxdsslkskschbalmdhzsdrrjmxdltbtnxbh",
"output": "IGNORE HIM!"
},
{
"input": "zioixjibuhrzyrbzqcdjbbhhdmpgmqykixcxoqupggaqajuzonrpzihbsogjfsrrypbiphehonyhohsbybnnukqebopppa",
"output": "CHAT WITH HER!"
},
{
"input": "oh",
"output": "CHAT WITH HER!"
},
{
"input": "kxqthadqesbpgpsvpbcbznxpecqrzjoilpauttzlnxvaczcqwuri",
"output": "IGNORE HIM!"
},
{
"input": "zwlunigqnhrwirkvufqwrnwcnkqqonebrwzcshcbqqwkjxhymjjeakuzjettebciadjlkbfp",
"output": "CHAT WITH HER!"
},
{
"input": "fjuldpuejgmggvvigkwdyzytfxzwdlofrpifqpdnhfyroginqaufwgjcbgshyyruwhofctsdaisqpjxqjmtpp",
"output": "CHAT WITH HER!"
},
{
"input": "xiwntnheuitbtqxrmzvxmieldudakogealwrpygbxsbluhsqhtwmdlpjwzyafckrqrdduonkgo",
"output": "CHAT WITH HER!"
},
{
"input": "mnmbupgo",
"output": "IGNORE HIM!"
},
{
"input": "mcjehdiygkbmrbfjqwpwxidbdfelifwhstaxdapigbymmsgrhnzsdjhsqchl",
"output": "IGNORE HIM!"
},
{
"input": "yocxrzspinchmhtmqo",
"output": "CHAT WITH HER!"
},
{
"input": "vasvvnpymtgjirnzuynluluvmgpquskuaafwogeztfnvybblajvuuvfomtifeuzpikjrolzeeoftv",
"output": "CHAT WITH HER!"
},
{
"input": "ecsdicrznvglwggrdbrvehwzaenzjutjydhvimtqegweurpxtjkmpcznshtrvotkvrghxhacjkedidqqzrduzad",
"output": "IGNORE HIM!"
},
{
"input": "ubvhyaebyxoghakajqrpqpctwbrfqzli",
"output": "CHAT WITH HER!"
},
{
"input": "gogbxfeqylxoummvgxpkoqzsmobasesxbqjjktqbwqxeiaagnnhbvepbpy",
"output": "IGNORE HIM!"
},
{
"input": "nheihhxkbbrmlpxpxbhnpofcjmxemyvqqdbanwd",
"output": "IGNORE HIM!"
},
{
"input": "acrzbavz",
"output": "CHAT WITH HER!"
},
{
"input": "drvzznznvrzskftnrhvvzxcalwutxmdza",
"output": "IGNORE HIM!"
},
{
"input": "oacwxipdfcoabhkwxqdbtowiekpnflnqhlrkustgzryvws",
"output": "CHAT WITH HER!"
},
{
"input": "tpnwfmfsibnccvdwjvzviyvjfljupinfigfunyff",
"output": "CHAT WITH HER!"
},
{
"input": "gavaihhamfolcndgytcsgucqdqngxkrlovpthvteacmmthoglxu",
"output": "CHAT WITH HER!"
},
{
"input": "hsfcfvameeupldgvchmogrvwxrvsmnwxxkxoawwodtsahqvehlcw",
"output": "IGNORE HIM!"
},
{
"input": "sbkydrscoojychxchqsuciperfroumenelgiyiwlqfwximrgdbyvkmacy",
"output": "CHAT WITH HER!"
},
{
"input": "rhh",
"output": "CHAT WITH HER!"
},
{
"input": "zhdouqfmlkenjzdijxdfxnlegxeuvhelo",
"output": "IGNORE HIM!"
},
{
"input": "yufkkfwyhhvcjntsgsvpzbhqtmtgyxifqoewmuplphykmptfdebjxuaxigomjtwgtljwdjhjernkitifbomifbhysnmadtnyn",
"output": "CHAT WITH HER!"
},
{
"input": "urigreuzpxnej",
"output": "CHAT WITH HER!"
}
] | 1,698,255,741
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
usern = set(input())
if len(set)%2==0:
print ("CHAT WITH HER!")
else
print ("IGNORE HIM")
|
Title: Boy or Girl
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network.
But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names.
This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method.
Input Specification:
The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters.
Output Specification:
If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes).
Demo Input:
['wjmzbmr\n', 'xiaodao\n', 'sevenkplus\n']
Demo Output:
['CHAT WITH HER!\n', 'IGNORE HIM!\n', 'CHAT WITH HER!\n']
Note:
For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
|
```python
usern = set(input())
if len(set)%2==0:
print ("CHAT WITH HER!")
else
print ("IGNORE HIM")
```
| -1
|
|
908
|
A
|
New Year and Counting Cards
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
Your friend has *n* cards.
You know that each card has a lowercase English letter on one side and a digit on the other.
Currently, your friend has laid out the cards on a table so only one side of each card is visible.
You would like to know if the following statement is true for cards that your friend owns: "If a card has a vowel on one side, then it has an even digit on the other side." More specifically, a vowel is one of 'a', 'e', 'i', 'o' or 'u', and even digit is one of '0', '2', '4', '6' or '8'.
For example, if a card has 'a' on one side, and '6' on the other side, then this statement is true for it. Also, the statement is true, for example, for a card with 'b' and '4', and for a card with 'b' and '3' (since the letter is not a vowel). The statement is false, for example, for card with 'e' and '5'. You are interested if the statement is true for all cards. In particular, if no card has a vowel, the statement is true.
To determine this, you can flip over some cards to reveal the other side. You would like to know what is the minimum number of cards you need to flip in the worst case in order to verify that the statement is true.
|
The first and only line of input will contain a string *s* (1<=≤<=|*s*|<=≤<=50), denoting the sides of the cards that you can see on the table currently. Each character of *s* is either a lowercase English letter or a digit.
|
Print a single integer, the minimum number of cards you must turn over to verify your claim.
|
[
"ee\n",
"z\n",
"0ay1\n"
] |
[
"2\n",
"0\n",
"2\n"
] |
In the first sample, we must turn over both cards. Note that even though both cards have the same letter, they could possibly have different numbers on the other side.
In the second sample, we don't need to turn over any cards. The statement is vacuously true, since you know your friend has no cards with a vowel on them.
In the third sample, we need to flip the second and fourth cards.
| 500
|
[
{
"input": "ee",
"output": "2"
},
{
"input": "z",
"output": "0"
},
{
"input": "0ay1",
"output": "2"
},
{
"input": "0abcdefghijklmnopqrstuvwxyz1234567896",
"output": "10"
},
{
"input": "0a0a9e9e2i2i9o9o6u6u9z9z4x4x9b9b",
"output": "18"
},
{
"input": "01234567890123456789012345678901234567890123456789",
"output": "25"
},
{
"input": "qwertyuioplkjhgfdsazxcvbnmqwertyuioplkjhgfdsazxcvb",
"output": "10"
},
{
"input": "cjw2dwmr10pku4yxohe0wglktd",
"output": "4"
},
{
"input": "6z2tx805jie8cfybwtfqvmlveec3iak5z5u3lu62vbxyqht6",
"output": "13"
},
{
"input": "kaq7jyialrfp4ilkni90eq8v3amcbygon7py0hb8z26fbl8ss1",
"output": "13"
},
{
"input": "hpwn50zgbmct80k9rizjqg40nycgs0acwikjqt11nr6m61krfs",
"output": "8"
},
{
"input": "l3rw91a4m25l8iytxyeuixsegzcbm4h41ornf3pixkrmwznrzc",
"output": "14"
},
{
"input": "2222",
"output": "0"
},
{
"input": "13579",
"output": "5"
},
{
"input": "1",
"output": "1"
},
{
"input": "0",
"output": "0"
},
{
"input": "a",
"output": "1"
},
{
"input": "y",
"output": "0"
},
{
"input": "w",
"output": "0"
},
{
"input": "oo",
"output": "2"
},
{
"input": "oy",
"output": "1"
},
{
"input": "yo",
"output": "1"
},
{
"input": "yy",
"output": "0"
},
{
"input": "a0",
"output": "1"
},
{
"input": "a9",
"output": "2"
},
{
"input": "y0",
"output": "0"
},
{
"input": "y7",
"output": "1"
},
{
"input": "0a",
"output": "1"
},
{
"input": "3a",
"output": "2"
},
{
"input": "06",
"output": "0"
},
{
"input": "07",
"output": "1"
},
{
"input": "70",
"output": "1"
},
{
"input": "77",
"output": "2"
},
{
"input": "13570",
"output": "4"
},
{
"input": "0000000000011111",
"output": "5"
},
{
"input": "1357",
"output": "4"
},
{
"input": "uuuuuuuuuuuuuuuuuu",
"output": "18"
},
{
"input": "gabieurat",
"output": "5"
}
] | 1,624,619,842
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 38
| 62
| 0
|
cards = input()
vowels = set(["a","e","i","o","u"])
evens = set(["1","3","5","7","9"])
needed_flips = 0
for card in cards:
if card in vowels or card in evens:
needed_flips += 1
print(needed_flips)
|
Title: New Year and Counting Cards
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your friend has *n* cards.
You know that each card has a lowercase English letter on one side and a digit on the other.
Currently, your friend has laid out the cards on a table so only one side of each card is visible.
You would like to know if the following statement is true for cards that your friend owns: "If a card has a vowel on one side, then it has an even digit on the other side." More specifically, a vowel is one of 'a', 'e', 'i', 'o' or 'u', and even digit is one of '0', '2', '4', '6' or '8'.
For example, if a card has 'a' on one side, and '6' on the other side, then this statement is true for it. Also, the statement is true, for example, for a card with 'b' and '4', and for a card with 'b' and '3' (since the letter is not a vowel). The statement is false, for example, for card with 'e' and '5'. You are interested if the statement is true for all cards. In particular, if no card has a vowel, the statement is true.
To determine this, you can flip over some cards to reveal the other side. You would like to know what is the minimum number of cards you need to flip in the worst case in order to verify that the statement is true.
Input Specification:
The first and only line of input will contain a string *s* (1<=≤<=|*s*|<=≤<=50), denoting the sides of the cards that you can see on the table currently. Each character of *s* is either a lowercase English letter or a digit.
Output Specification:
Print a single integer, the minimum number of cards you must turn over to verify your claim.
Demo Input:
['ee\n', 'z\n', '0ay1\n']
Demo Output:
['2\n', '0\n', '2\n']
Note:
In the first sample, we must turn over both cards. Note that even though both cards have the same letter, they could possibly have different numbers on the other side.
In the second sample, we don't need to turn over any cards. The statement is vacuously true, since you know your friend has no cards with a vowel on them.
In the third sample, we need to flip the second and fourth cards.
|
```python
cards = input()
vowels = set(["a","e","i","o","u"])
evens = set(["1","3","5","7","9"])
needed_flips = 0
for card in cards:
if card in vowels or card in evens:
needed_flips += 1
print(needed_flips)
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,590,444,578
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 154
| 0
|
n = input()
if n == "Vip":
f = n.upper()
else:
f = n.lower()
print(f)
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
n = input()
if n == "Vip":
f = n.upper()
else:
f = n.lower()
print(f)
```
| 0
|
712
|
B
|
Memory and Trident
|
PROGRAMMING
| 1,100
|
[
"implementation",
"strings"
] | null | null |
Memory is performing a walk on the two-dimensional plane, starting at the origin. He is given a string *s* with his directions for motion:
- An 'L' indicates he should move one unit left. - An 'R' indicates he should move one unit right. - A 'U' indicates he should move one unit up. - A 'D' indicates he should move one unit down.
But now Memory wants to end at the origin. To do this, he has a special trident. This trident can replace any character in *s* with any of 'L', 'R', 'U', or 'D'. However, because he doesn't want to wear out the trident, he wants to make the minimum number of edits possible. Please tell Memory what is the minimum number of changes he needs to make to produce a string that, when walked, will end at the origin, or if there is no such string.
|
The first and only line contains the string *s* (1<=≤<=|*s*|<=≤<=100<=000) — the instructions Memory is given.
|
If there is a string satisfying the conditions, output a single integer — the minimum number of edits required. In case it's not possible to change the sequence in such a way that it will bring Memory to to the origin, output -1.
|
[
"RRU\n",
"UDUR\n",
"RUUR\n"
] |
[
"-1\n",
"1\n",
"2\n"
] |
In the first sample test, Memory is told to walk right, then right, then up. It is easy to see that it is impossible to edit these instructions to form a valid walk.
In the second sample test, Memory is told to walk up, then down, then up, then right. One possible solution is to change *s* to "LDUR". This string uses 1 edit, which is the minimum possible. It also ends at the origin.
| 1,000
|
[
{
"input": "RRU",
"output": "-1"
},
{
"input": "UDUR",
"output": "1"
},
{
"input": "RUUR",
"output": "2"
},
{
"input": "DDDD",
"output": "2"
},
{
"input": "RRRR",
"output": "2"
},
{
"input": "RRRUUD",
"output": "2"
},
{
"input": "UDURLRDURLRD",
"output": "1"
},
{
"input": "RLRU",
"output": "1"
},
{
"input": "RDDLLDLUUUDDRDRURLUUURLLDDLRLUURRLLRRLDRLLUDRLRULLDLRRLRLRLRUDUUDLULURLLDUURULURLLRRRURRRDRUUDLDRLRDRLRRDDLDLDLLUDRUDRLLLLDRDUULRUURRDLULLULDUDULRURRDDDLLUDRLUDDLDDDRRDDDULLLLDLDRLRRLRRDDRLULURRUDRDUUUULDURUDRDLDDUDUDRRURDULRRUDRLRRDLUURURDLDRLRDUDDDLDDDURURLUULRDUUULRURUDUDRRUDULLLUUUDRLLDRRDDLRUDRDRDLLRURURRRULURURRRLUUULRRRUURUUDURUDDLLDLDRLRDLDRLLDLDRDRRLRRRURUUUDRDLRLRUDRLULUUULUDDLULDLRLLRDUULLRLRURLRURULLLUDUDDLRULRDUURURLDLUURRRDURRLLDRUUDRDLLDUUDLURUDDUUUULRLLURLUDDRLRRDRURLRUDRLDDRLLL",
"output": "-1"
},
{
"input": "LDLDLDLDLDRULD",
"output": "5"
},
{
"input": "LULULURULLLU",
"output": "5"
},
{
"input": "DRDRDDRR",
"output": "4"
},
{
"input": "LR",
"output": "0"
},
{
"input": "UL",
"output": "1"
},
{
"input": "UD",
"output": "0"
},
{
"input": "R",
"output": "-1"
},
{
"input": "LU",
"output": "1"
},
{
"input": "RR",
"output": "1"
},
{
"input": "UDLR",
"output": "0"
},
{
"input": "RRRRRLLUUUUDD",
"output": "-1"
},
{
"input": "UUUUDLLLLR",
"output": "3"
},
{
"input": "LLRUD",
"output": "-1"
},
{
"input": "LLRDDU",
"output": "1"
}
] | 1,615,299,950
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 75
| 93
| 512,000
|
s = input()
if len(s) % 2 == 1:
print(-1)
else:
print((abs(s.count('L') - s.count('R')) + abs(s.count('U') - s.count('D'))) // 2)
|
Title: Memory and Trident
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Memory is performing a walk on the two-dimensional plane, starting at the origin. He is given a string *s* with his directions for motion:
- An 'L' indicates he should move one unit left. - An 'R' indicates he should move one unit right. - A 'U' indicates he should move one unit up. - A 'D' indicates he should move one unit down.
But now Memory wants to end at the origin. To do this, he has a special trident. This trident can replace any character in *s* with any of 'L', 'R', 'U', or 'D'. However, because he doesn't want to wear out the trident, he wants to make the minimum number of edits possible. Please tell Memory what is the minimum number of changes he needs to make to produce a string that, when walked, will end at the origin, or if there is no such string.
Input Specification:
The first and only line contains the string *s* (1<=≤<=|*s*|<=≤<=100<=000) — the instructions Memory is given.
Output Specification:
If there is a string satisfying the conditions, output a single integer — the minimum number of edits required. In case it's not possible to change the sequence in such a way that it will bring Memory to to the origin, output -1.
Demo Input:
['RRU\n', 'UDUR\n', 'RUUR\n']
Demo Output:
['-1\n', '1\n', '2\n']
Note:
In the first sample test, Memory is told to walk right, then right, then up. It is easy to see that it is impossible to edit these instructions to form a valid walk.
In the second sample test, Memory is told to walk up, then down, then up, then right. One possible solution is to change *s* to "LDUR". This string uses 1 edit, which is the minimum possible. It also ends at the origin.
|
```python
s = input()
if len(s) % 2 == 1:
print(-1)
else:
print((abs(s.count('L') - s.count('R')) + abs(s.count('U') - s.count('D'))) // 2)
```
| 3
|
|
315
|
B
|
Sereja and Array
|
PROGRAMMING
| 1,200
|
[
"implementation"
] | null | null |
Sereja has got an array, consisting of *n* integers, *a*1,<=*a*2,<=...,<=*a**n*. Sereja is an active boy, so he is now going to complete *m* operations. Each operation will have one of the three forms:
1. Make *v**i*-th array element equal to *x**i*. In other words, perform the assignment *a**v**i*<==<=*x**i*. 1. Increase each array element by *y**i*. In other words, perform *n* assignments *a**i*<==<=*a**i*<=+<=*y**i* (1<=≤<=*i*<=≤<=*n*). 1. Take a piece of paper and write out the *q**i*-th array element. That is, the element *a**q**i*.
Help Sereja, complete all his operations.
|
The first line contains integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=105). The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the original array.
Next *m* lines describe operations, the *i*-th line describes the *i*-th operation. The first number in the *i*-th line is integer *t**i* (1<=≤<=*t**i*<=≤<=3) that represents the operation type. If *t**i*<==<=1, then it is followed by two integers *v**i* and *x**i*, (1<=≤<=*v**i*<=≤<=*n*,<=1<=≤<=*x**i*<=≤<=109). If *t**i*<==<=2, then it is followed by integer *y**i* (1<=≤<=*y**i*<=≤<=104). And if *t**i*<==<=3, then it is followed by integer *q**i* (1<=≤<=*q**i*<=≤<=*n*).
|
For each third type operation print value *a**q**i*. Print the values in the order, in which the corresponding queries follow in the input.
|
[
"10 11\n1 2 3 4 5 6 7 8 9 10\n3 2\n3 9\n2 10\n3 1\n3 10\n1 1 10\n2 10\n2 10\n3 1\n3 10\n3 9\n"
] |
[
"2\n9\n11\n20\n30\n40\n39\n"
] |
none
| 1,000
|
[
{
"input": "10 11\n1 2 3 4 5 6 7 8 9 10\n3 2\n3 9\n2 10\n3 1\n3 10\n1 1 10\n2 10\n2 10\n3 1\n3 10\n3 9",
"output": "2\n9\n11\n20\n30\n40\n39"
},
{
"input": "1 3\n1\n1 1 2\n2 1\n3 1",
"output": "3"
},
{
"input": "1 1\n1\n3 1",
"output": "1"
},
{
"input": "6 6\n202714501 613423725 367325359 862808465 182588146 745008828\n2 492\n2 1943\n1 3 173984392\n1 3 9356383\n3 4\n1 5 472683539",
"output": "862810900"
},
{
"input": "6 5\n545129895 918519812 2334334 565540665 484519712 904102869\n3 3\n1 2 641196860\n2 779\n2 3036\n3 1",
"output": "2334334\n545133710"
},
{
"input": "5 5\n286163265 724763447 761775891 215352371 491215007\n1 4 780579549\n1 2 638546757\n3 4\n1 3 38072627\n2 6119",
"output": "780579549"
},
{
"input": "4 4\n529316834 995684640 949078705 317773978\n3 3\n3 1\n2 6271\n1 1 856879574",
"output": "949078705\n529316834"
},
{
"input": "5 4\n293170637 715384768 756975575 129004053 875201151\n1 3 695181967\n3 3\n2 2288\n1 5 332270946",
"output": "695181967"
}
] | 1,614,077,807
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 34
| 498
| 16,691,200
|
# https://codeforces.com/contest/315/problem/B
import sys
reader = (s.rstrip() for s in sys.stdin)
input = reader.__next__
# do magic here
t = 1
for _ in range(t):
n, q = map(int, input().split())
arr = list(map(int, input().split()))
sums = [0]
lastAssign = [[x, 1] for x in arr]
while q:
ops = list(map(int, input().split()))
if ops[0] == 1:
ind = ops[1] - 1
val = ops[2]
lastAssign[ind] = [val, len(sums)]
elif ops[0] == 2:
sums.append(sums[-1]+ops[1])
else:
ind = ops[1] - 1
till = lastAssign[ind][1]
init = lastAssign[ind][0]
print(init + sums[-1] - sums[till-1])
q -= 1
|
Title: Sereja and Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja has got an array, consisting of *n* integers, *a*1,<=*a*2,<=...,<=*a**n*. Sereja is an active boy, so he is now going to complete *m* operations. Each operation will have one of the three forms:
1. Make *v**i*-th array element equal to *x**i*. In other words, perform the assignment *a**v**i*<==<=*x**i*. 1. Increase each array element by *y**i*. In other words, perform *n* assignments *a**i*<==<=*a**i*<=+<=*y**i* (1<=≤<=*i*<=≤<=*n*). 1. Take a piece of paper and write out the *q**i*-th array element. That is, the element *a**q**i*.
Help Sereja, complete all his operations.
Input Specification:
The first line contains integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=105). The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the original array.
Next *m* lines describe operations, the *i*-th line describes the *i*-th operation. The first number in the *i*-th line is integer *t**i* (1<=≤<=*t**i*<=≤<=3) that represents the operation type. If *t**i*<==<=1, then it is followed by two integers *v**i* and *x**i*, (1<=≤<=*v**i*<=≤<=*n*,<=1<=≤<=*x**i*<=≤<=109). If *t**i*<==<=2, then it is followed by integer *y**i* (1<=≤<=*y**i*<=≤<=104). And if *t**i*<==<=3, then it is followed by integer *q**i* (1<=≤<=*q**i*<=≤<=*n*).
Output Specification:
For each third type operation print value *a**q**i*. Print the values in the order, in which the corresponding queries follow in the input.
Demo Input:
['10 11\n1 2 3 4 5 6 7 8 9 10\n3 2\n3 9\n2 10\n3 1\n3 10\n1 1 10\n2 10\n2 10\n3 1\n3 10\n3 9\n']
Demo Output:
['2\n9\n11\n20\n30\n40\n39\n']
Note:
none
|
```python
# https://codeforces.com/contest/315/problem/B
import sys
reader = (s.rstrip() for s in sys.stdin)
input = reader.__next__
# do magic here
t = 1
for _ in range(t):
n, q = map(int, input().split())
arr = list(map(int, input().split()))
sums = [0]
lastAssign = [[x, 1] for x in arr]
while q:
ops = list(map(int, input().split()))
if ops[0] == 1:
ind = ops[1] - 1
val = ops[2]
lastAssign[ind] = [val, len(sums)]
elif ops[0] == 2:
sums.append(sums[-1]+ops[1])
else:
ind = ops[1] - 1
till = lastAssign[ind][1]
init = lastAssign[ind][0]
print(init + sums[-1] - sums[till-1])
q -= 1
```
| 3
|
|
54
|
A
|
Presents
|
PROGRAMMING
| 1,300
|
[
"implementation"
] |
A. Presents
|
2
|
256
|
The Hedgehog likes to give presents to his friend, but no less he likes to receive them.
Having received another present today, the Hedgehog suddenly understood that he has no place to put it as there was no room left on the special shelf in the cupboard. He will have to choose another shelf, but which one should he choose, how large should it be?
In order to get to know this, the Hedgehog asks you to write him a program that will count the estimated number of presents that he will receive during the following *N* days. Besides, he is guided by the principle:
- on each holiday day the Hedgehog will necessarily receive a present, - he receives presents at least every *K* days (i.e., if he received a present on the *i*-th day, he will receive the next present no later than on the *i*<=+<=*K*-th day).
For the given *N* and *K*, as well as the list of holidays among the following *N* days count the minimal number of presents that could be given to the Hedgehog. The number of today's day is zero, and you should regard today's present as already given (i.e., you shouldn't count it in the answer).
|
The first line contains integers *N* and *K* (1<=≤<=*N*<=≤<=365, 1<=≤<=*K*<=≤<=*N*).
The second line contains a number *C* which represents the number of holidays (0<=≤<=*C*<=≤<=*N*). Then in the same line follow *C* numbers ranging from 1 to *N* which are the numbers of holiday days. The numbers are given in the increasing order, without repeating numbers among them.
|
Print a single number — the minimal number of presents the Hedgehog will receive over the following *N* days.
|
[
"5 2\n1 3\n",
"10 1\n3 6 7 8\n"
] |
[
"3",
"10"
] |
none
| 500
|
[
{
"input": "5 2\n1 3",
"output": "3"
},
{
"input": "10 1\n3 6 7 8",
"output": "10"
},
{
"input": "5 5\n1 3",
"output": "1"
},
{
"input": "10 3\n3 3 6 9",
"output": "3"
},
{
"input": "5 2\n0",
"output": "2"
},
{
"input": "1 1\n0",
"output": "1"
},
{
"input": "5 1\n0",
"output": "5"
},
{
"input": "5 1\n1 2",
"output": "5"
},
{
"input": "5 2\n0",
"output": "2"
},
{
"input": "10 3\n2 4 8",
"output": "4"
},
{
"input": "10 1\n0",
"output": "10"
},
{
"input": "10 2\n1 5",
"output": "5"
},
{
"input": "10 1\n0",
"output": "10"
},
{
"input": "10 1\n0",
"output": "10"
},
{
"input": "15 5\n0",
"output": "3"
},
{
"input": "15 1\n1 3",
"output": "15"
},
{
"input": "15 2\n1 10",
"output": "7"
},
{
"input": "15 1\n0",
"output": "15"
},
{
"input": "15 3\n1 11",
"output": "5"
},
{
"input": "20 1\n3 7 9 20",
"output": "20"
},
{
"input": "20 3\n1 11",
"output": "7"
},
{
"input": "20 2\n6 6 9 10 15 19 20",
"output": "12"
},
{
"input": "20 1\n0",
"output": "20"
},
{
"input": "20 1\n1 13",
"output": "20"
},
{
"input": "25 1\n9 2 6 8 10 14 15 17 18 23",
"output": "25"
},
{
"input": "25 1\n0",
"output": "25"
},
{
"input": "25 1\n4 8 10 13 24",
"output": "25"
},
{
"input": "25 1\n1 14",
"output": "25"
},
{
"input": "25 1\n0",
"output": "25"
},
{
"input": "100 3\n0",
"output": "33"
},
{
"input": "100 10\n0",
"output": "10"
},
{
"input": "100 23\n22 2 9 18 22 23 30 44 50 55 58 61 70 71 73 76 79 82 85 88 94 95 99",
"output": "22"
},
{
"input": "100 5\n10 2 17 21 34 52 58 60 64 68 95",
"output": "24"
},
{
"input": "100 4\n2 29 63",
"output": "26"
},
{
"input": "150 16\n9 19 31 47 53 57 96 105 108 120",
"output": "13"
},
{
"input": "150 52\n5 11 37 60 67 86",
"output": "6"
},
{
"input": "150 4\n7 21 54 106 108 109 119 123",
"output": "40"
},
{
"input": "150 3\n0",
"output": "50"
},
{
"input": "150 21\n21 22 26 30 36 39 52 59 62 66 68 78 86 92 96 103 108 113 118 119 125 139",
"output": "22"
},
{
"input": "300 15\n14 3 38 52 57 142 157 175 201 209 238 258 288 294 299",
"output": "26"
},
{
"input": "300 2\n14 29 94 122 123 158 160 164 191 200 202 208 246 272 286",
"output": "153"
},
{
"input": "300 5\n16 22 38 72 78 108 116 140 147 160 189 209 214 227 252 294 300",
"output": "66"
},
{
"input": "300 8\n4 27 76 155 260",
"output": "40"
},
{
"input": "300 24\n20 18 76 80 81 85 103 110 112 129 145 151 172 180 184 201 205 241 257 268 276",
"output": "24"
},
{
"input": "350 22\n11 38 111 115 176 194 204 207 231 274 307 348",
"output": "21"
},
{
"input": "350 22\n73 1 4 8 10 14 16 19 28 37 41 42 43 55 56 64 66 67 79 80 84 87 96 99 101 103 119 120 121 122 127 128 135 141 142 143 148 156 159 160 161 166 167 169 173 189 201 202 205 219 223 227 233 242 243 244 250 257 260 262 263 264 273 291 301 302 305 306 307 314 326 336 342 345",
"output": "73"
},
{
"input": "350 26\n10 13 16 81 99 144 191 223 258 316 329",
"output": "18"
},
{
"input": "350 16\n12 31 76 103 116 191 201 241 256 260 291 306 336",
"output": "24"
},
{
"input": "350 28\n5 23 104 135 305 331",
"output": "14"
},
{
"input": "365 34\n6 80 94 208 256 325 349",
"output": "14"
},
{
"input": "365 19\n7 47 114 139 210 226 266 279",
"output": "22"
},
{
"input": "365 8\n32 1 13 22 25 33 72 80 86 96 117 132 145 146 156 176 177 179 188 198 203 218 225 235 253 256 267 279 286 294 303 333 363",
"output": "61"
},
{
"input": "365 8\n55 3 12 26 28 36 45 47 59 61 65 82 90 103 109 114 117 121 123 126 134 142 144 146 151 154 168 175 189 193 195 197 199 210 212 214 230 232 241 248 254 267 271 291 304 306 308 311 315 317 318 334 335 346 354 365",
"output": "74"
},
{
"input": "365 2\n2 96 241",
"output": "183"
},
{
"input": "365 42\n10 8 66 77 148 161 183 231 301 340 350",
"output": "14"
},
{
"input": "365 40\n30 1 14 21 31 32 36 56 59 68 96 119 131 137 166 179 181 202 235 248 272 294 309 315 322 327 334 341 347 362 365",
"output": "30"
},
{
"input": "365 31\n19 13 18 27 33 46 58 86 114 178 187 198 228 233 240 255 277 332 348 351",
"output": "22"
},
{
"input": "365 54\n21 28 42 56 65 66 67 76 81 85 89 123 132 136 153 195 215 249 294 296 300 355",
"output": "22"
},
{
"input": "365 5\n5 10 31 121 235 322",
"output": "74"
},
{
"input": "365 81\n2 1 75",
"output": "5"
},
{
"input": "365 21\n4 1 17 344 345",
"output": "19"
},
{
"input": "11 2\n5 3 6 7 9 10",
"output": "7"
},
{
"input": "5 3\n2 2 4",
"output": "2"
},
{
"input": "362 360\n0",
"output": "1"
},
{
"input": "18 4\n4 1 9 10 18",
"output": "6"
}
] | 1,580,906,351
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 9
| 218
| 307,200
|
n, k = list(map(int, input().split()))
a = list(map(int, input().split()))
c, *a = a
if c == 0:
print(n // k)
else:
a.append(n)
res = 1
for i in range(1, len(a)):
if a[i] - a[i-1] >= k:
res += (a[i] - a[i-1]) // k
if a[0] - 1 >= k:
res += (a[0] - 1) // k
print(res)
|
Title: Presents
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The Hedgehog likes to give presents to his friend, but no less he likes to receive them.
Having received another present today, the Hedgehog suddenly understood that he has no place to put it as there was no room left on the special shelf in the cupboard. He will have to choose another shelf, but which one should he choose, how large should it be?
In order to get to know this, the Hedgehog asks you to write him a program that will count the estimated number of presents that he will receive during the following *N* days. Besides, he is guided by the principle:
- on each holiday day the Hedgehog will necessarily receive a present, - he receives presents at least every *K* days (i.e., if he received a present on the *i*-th day, he will receive the next present no later than on the *i*<=+<=*K*-th day).
For the given *N* and *K*, as well as the list of holidays among the following *N* days count the minimal number of presents that could be given to the Hedgehog. The number of today's day is zero, and you should regard today's present as already given (i.e., you shouldn't count it in the answer).
Input Specification:
The first line contains integers *N* and *K* (1<=≤<=*N*<=≤<=365, 1<=≤<=*K*<=≤<=*N*).
The second line contains a number *C* which represents the number of holidays (0<=≤<=*C*<=≤<=*N*). Then in the same line follow *C* numbers ranging from 1 to *N* which are the numbers of holiday days. The numbers are given in the increasing order, without repeating numbers among them.
Output Specification:
Print a single number — the minimal number of presents the Hedgehog will receive over the following *N* days.
Demo Input:
['5 2\n1 3\n', '10 1\n3 6 7 8\n']
Demo Output:
['3', '10']
Note:
none
|
```python
n, k = list(map(int, input().split()))
a = list(map(int, input().split()))
c, *a = a
if c == 0:
print(n // k)
else:
a.append(n)
res = 1
for i in range(1, len(a)):
if a[i] - a[i-1] >= k:
res += (a[i] - a[i-1]) // k
if a[0] - 1 >= k:
res += (a[0] - 1) // k
print(res)
```
| 0
|
621
|
A
|
Wet Shark and Odd and Even
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Today, Wet Shark is given *n* integers. Using any of these integers no more than once, Wet Shark wants to get maximum possible even (divisible by 2) sum. Please, calculate this value for Wet Shark.
Note, that if Wet Shark uses no integers from the *n* integers, the sum is an even integer 0.
|
The first line of the input contains one integer, *n* (1<=≤<=*n*<=≤<=100<=000). The next line contains *n* space separated integers given to Wet Shark. Each of these integers is in range from 1 to 109, inclusive.
|
Print the maximum possible even sum that can be obtained if we use some of the given integers.
|
[
"3\n1 2 3\n",
"5\n999999999 999999999 999999999 999999999 999999999\n"
] |
[
"6",
"3999999996"
] |
In the first sample, we can simply take all three integers for a total sum of 6.
In the second sample Wet Shark should take any four out of five integers 999 999 999.
| 500
|
[
{
"input": "3\n1 2 3",
"output": "6"
},
{
"input": "5\n999999999 999999999 999999999 999999999 999999999",
"output": "3999999996"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "15\n39 52 88 78 46 95 84 98 55 3 68 42 6 18 98",
"output": "870"
},
{
"input": "15\n59 96 34 48 8 72 67 90 15 85 7 90 97 47 25",
"output": "840"
},
{
"input": "15\n87 37 91 29 58 45 51 74 70 71 47 38 91 89 44",
"output": "922"
},
{
"input": "15\n11 81 49 7 11 14 30 67 29 50 90 81 77 18 59",
"output": "674"
},
{
"input": "15\n39 21 95 89 73 90 9 55 85 32 30 21 68 59 82",
"output": "848"
},
{
"input": "15\n59 70 48 54 26 67 84 39 40 18 77 69 70 88 93",
"output": "902"
},
{
"input": "15\n87 22 98 32 88 36 72 31 100 97 17 16 60 22 20",
"output": "798"
},
{
"input": "15\n15 63 51 13 37 9 43 19 55 79 57 60 50 59 31",
"output": "632"
},
{
"input": "1\n4",
"output": "4"
},
{
"input": "2\n1 4",
"output": "4"
},
{
"input": "3\n1 2 4",
"output": "6"
},
{
"input": "2\n9 3",
"output": "12"
},
{
"input": "2\n1000000000 1001",
"output": "1000000000"
},
{
"input": "3\n1 8 4",
"output": "12"
},
{
"input": "3\n7 4 4",
"output": "8"
},
{
"input": "5\n2 3 4 5 3",
"output": "14"
},
{
"input": "2\n4 5",
"output": "4"
},
{
"input": "3\n2 4 5",
"output": "6"
},
{
"input": "3\n2 2 3",
"output": "4"
},
{
"input": "2\n2 3",
"output": "2"
},
{
"input": "4\n2 3 7 7",
"output": "16"
},
{
"input": "2\n999999999 2",
"output": "2"
},
{
"input": "2\n2 5",
"output": "2"
},
{
"input": "3\n5 3 1",
"output": "8"
},
{
"input": "4\n3 2 5 7",
"output": "14"
}
] | 1,587,586,216
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 8
| 2,000
| 10,547,200
|
import sys
import math
input = sys.stdin.readline
def int_array():
return list(map(int, input().strip().split()))
def str_array():
return input().strip().split()
######################## TEMPLATE ENDS HERE ########################
n = int(input())
arr = int_array()
if sum(arr) % 2 == 0:
print(sum(arr))
else:
sumi = 0
for i in range(n):
if sumi+ arr[i] % 2 != 0:
the_no = arr[i]
arr.pop(i)
arr.append(the_no)
else:
sumi += arr[i]
while sum(arr) % 2 != 0:
arr.pop(-1)
print(sum(arr))
|
Title: Wet Shark and Odd and Even
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today, Wet Shark is given *n* integers. Using any of these integers no more than once, Wet Shark wants to get maximum possible even (divisible by 2) sum. Please, calculate this value for Wet Shark.
Note, that if Wet Shark uses no integers from the *n* integers, the sum is an even integer 0.
Input Specification:
The first line of the input contains one integer, *n* (1<=≤<=*n*<=≤<=100<=000). The next line contains *n* space separated integers given to Wet Shark. Each of these integers is in range from 1 to 109, inclusive.
Output Specification:
Print the maximum possible even sum that can be obtained if we use some of the given integers.
Demo Input:
['3\n1 2 3\n', '5\n999999999 999999999 999999999 999999999 999999999\n']
Demo Output:
['6', '3999999996']
Note:
In the first sample, we can simply take all three integers for a total sum of 6.
In the second sample Wet Shark should take any four out of five integers 999 999 999.
|
```python
import sys
import math
input = sys.stdin.readline
def int_array():
return list(map(int, input().strip().split()))
def str_array():
return input().strip().split()
######################## TEMPLATE ENDS HERE ########################
n = int(input())
arr = int_array()
if sum(arr) % 2 == 0:
print(sum(arr))
else:
sumi = 0
for i in range(n):
if sumi+ arr[i] % 2 != 0:
the_no = arr[i]
arr.pop(i)
arr.append(the_no)
else:
sumi += arr[i]
while sum(arr) % 2 != 0:
arr.pop(-1)
print(sum(arr))
```
| 0
|
|
814
|
B
|
An express train to reveries
|
PROGRAMMING
| 1,300
|
[
"constructive algorithms"
] | null | null |
Sengoku still remembers the mysterious "colourful meteoroids" she discovered with Lala-chan when they were little. In particular, one of the nights impressed her deeply, giving her the illusion that all her fancies would be realized.
On that night, Sengoku constructed a permutation *p*1,<=*p*2,<=...,<=*p**n* of integers from 1 to *n* inclusive, with each integer representing a colour, wishing for the colours to see in the coming meteor outburst. Two incredible outbursts then arrived, each with *n* meteorids, colours of which being integer sequences *a*1,<=*a*2,<=...,<=*a**n* and *b*1,<=*b*2,<=...,<=*b**n* respectively. Meteoroids' colours were also between 1 and *n* inclusive, and the two sequences were not identical, that is, at least one *i* (1<=≤<=*i*<=≤<=*n*) exists, such that *a**i*<=≠<=*b**i* holds.
Well, she almost had it all — each of the sequences *a* and *b* matched exactly *n*<=-<=1 elements in Sengoku's permutation. In other words, there is exactly one *i* (1<=≤<=*i*<=≤<=*n*) such that *a**i*<=≠<=*p**i*, and exactly one *j* (1<=≤<=*j*<=≤<=*n*) such that *b**j*<=≠<=*p**j*.
For now, Sengoku is able to recover the actual colour sequences *a* and *b* through astronomical records, but her wishes have been long forgotten. You are to reconstruct any possible permutation Sengoku could have had on that night.
|
The first line of input contains a positive integer *n* (2<=≤<=*n*<=≤<=1<=000) — the length of Sengoku's permutation, being the length of both meteor outbursts at the same time.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the sequence of colours in the first meteor outburst.
The third line contains *n* space-separated integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=*n*) — the sequence of colours in the second meteor outburst. At least one *i* (1<=≤<=*i*<=≤<=*n*) exists, such that *a**i*<=≠<=*b**i* holds.
|
Output *n* space-separated integers *p*1,<=*p*2,<=...,<=*p**n*, denoting a possible permutation Sengoku could have had. If there are more than one possible answer, output any one of them.
Input guarantees that such permutation exists.
|
[
"5\n1 2 3 4 3\n1 2 5 4 5\n",
"5\n4 4 2 3 1\n5 4 5 3 1\n",
"4\n1 1 3 4\n1 4 3 4\n"
] |
[
"1 2 5 4 3\n",
"5 4 2 3 1\n",
"1 2 3 4\n"
] |
In the first sample, both 1, 2, 5, 4, 3 and 1, 2, 3, 4, 5 are acceptable outputs.
In the second sample, 5, 4, 2, 3, 1 is the only permutation to satisfy the constraints.
| 1,000
|
[
{
"input": "5\n1 2 3 4 3\n1 2 5 4 5",
"output": "1 2 5 4 3"
},
{
"input": "5\n4 4 2 3 1\n5 4 5 3 1",
"output": "5 4 2 3 1"
},
{
"input": "4\n1 1 3 4\n1 4 3 4",
"output": "1 2 3 4"
},
{
"input": "10\n1 2 3 4 7 6 7 8 9 10\n1 2 3 4 5 6 5 8 9 10",
"output": "1 2 3 4 5 6 7 8 9 10"
},
{
"input": "10\n1 2 3 4 5 6 7 8 7 10\n1 2 3 4 5 6 7 8 9 9",
"output": "1 2 3 4 5 6 7 8 9 10"
},
{
"input": "10\n1 2 3 4 5 6 7 8 4 10\n1 2 3 4 5 6 7 6 9 10",
"output": "1 2 3 4 5 6 7 8 9 10"
},
{
"input": "10\n8 6 1 7 9 3 5 2 10 9\n8 6 1 7 4 3 5 2 10 4",
"output": "8 6 1 7 4 3 5 2 10 9"
},
{
"input": "10\n2 9 7 7 8 5 4 10 6 1\n2 8 7 3 8 5 4 10 6 1",
"output": "2 9 7 3 8 5 4 10 6 1"
},
{
"input": "2\n2 2\n1 1",
"output": "1 2"
},
{
"input": "3\n1 2 2\n1 3 3",
"output": "1 3 2"
},
{
"input": "3\n2 2 3\n1 2 1",
"output": "1 2 3"
},
{
"input": "3\n1 3 3\n1 1 3",
"output": "1 2 3"
},
{
"input": "3\n2 1 1\n2 3 3",
"output": "2 3 1"
},
{
"input": "3\n3 3 2\n1 1 2",
"output": "1 3 2"
},
{
"input": "3\n1 3 3\n3 3 2",
"output": "1 3 2"
},
{
"input": "4\n3 2 3 4\n1 2 1 4",
"output": "1 2 3 4"
},
{
"input": "4\n2 2 3 4\n1 2 3 2",
"output": "1 2 3 4"
},
{
"input": "4\n1 2 4 4\n2 2 3 4",
"output": "1 2 3 4"
},
{
"input": "4\n4 1 3 4\n2 1 3 2",
"output": "2 1 3 4"
},
{
"input": "4\n3 2 1 3\n4 2 1 2",
"output": "4 2 1 3"
},
{
"input": "4\n1 4 1 3\n2 4 1 4",
"output": "2 4 1 3"
},
{
"input": "4\n1 3 4 4\n3 3 2 4",
"output": "1 3 2 4"
},
{
"input": "5\n5 4 5 3 1\n4 4 2 3 1",
"output": "5 4 2 3 1"
},
{
"input": "5\n4 1 2 4 5\n3 1 2 5 5",
"output": "3 1 2 4 5"
},
{
"input": "3\n2 2 3\n1 3 3",
"output": "1 2 3"
},
{
"input": "3\n1 1 3\n2 3 3",
"output": "2 1 3"
},
{
"input": "5\n5 4 5 3 1\n2 4 4 3 1",
"output": "2 4 5 3 1"
},
{
"input": "3\n3 3 1\n2 1 1",
"output": "2 3 1"
},
{
"input": "5\n5 4 3 5 2\n5 4 1 1 2",
"output": "5 4 3 1 2"
},
{
"input": "6\n1 2 3 4 2 5\n1 6 3 4 4 5",
"output": "1 6 3 4 2 5"
},
{
"input": "4\n1 3 2 1\n2 3 2 1",
"output": "4 3 2 1"
},
{
"input": "4\n1 3 3 4\n1 4 3 4",
"output": "1 2 3 4"
},
{
"input": "11\n1 2 3 4 5 6 7 8 9 10 10\n1 2 3 4 5 6 7 8 9 10 3",
"output": "1 2 3 4 5 6 7 8 9 10 11"
},
{
"input": "5\n1 2 3 2 5\n1 4 3 3 5",
"output": "1 4 3 2 5"
},
{
"input": "5\n1 2 3 4 3\n1 2 5 4 2",
"output": "1 2 5 4 3"
},
{
"input": "5\n1 2 3 4 4\n1 2 3 4 3",
"output": "1 2 3 4 5"
},
{
"input": "4\n1 3 1 4\n1 3 4 4",
"output": "1 3 2 4"
},
{
"input": "5\n2 5 3 2 1\n4 5 3 3 1",
"output": "4 5 3 2 1"
},
{
"input": "5\n1 2 3 2 5\n1 3 3 4 5",
"output": "1 2 3 4 5"
},
{
"input": "5\n5 2 3 4 5\n2 2 3 4 5",
"output": "1 2 3 4 5"
},
{
"input": "5\n5 4 1 1 2\n5 4 3 5 2",
"output": "5 4 3 1 2"
},
{
"input": "4\n1 4 3 4\n1 3 3 4",
"output": "1 2 3 4"
},
{
"input": "4\n1 2 3 1\n1 2 3 2",
"output": "1 2 3 4"
},
{
"input": "5\n4 5 3 3 1\n2 5 3 2 1",
"output": "4 5 3 2 1"
},
{
"input": "5\n1 2 3 5 5\n1 2 3 4 3",
"output": "1 2 3 4 5"
},
{
"input": "4\n2 3 3 4\n2 4 3 4",
"output": "2 1 3 4"
}
] | 1,497,013,660
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 2
| 46
| 0
|
n=int(input())
a=list(map(int,input().split()))
b=list(map(int,input().split()))
c=[]
for i in range(n):
if(a[i] != b[i]):
c.append(i)
d=set()
s1=set(a)
s2=set(b)
s3=set(range(1,n+1))
d=s3-s1
d.update(s3-s2)
d=list(d)
if(a[c[0]] == d[0]):
a[c[1]] = d[1]
elif a[c[0]] == d[1]:
a[c[1]] = d[0]
elif a[c[1]] == d[0]:
a[c[0]] = d[1]
else:
a[c[0]] = d[0]
print(*a)
|
Title: An express train to reveries
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sengoku still remembers the mysterious "colourful meteoroids" she discovered with Lala-chan when they were little. In particular, one of the nights impressed her deeply, giving her the illusion that all her fancies would be realized.
On that night, Sengoku constructed a permutation *p*1,<=*p*2,<=...,<=*p**n* of integers from 1 to *n* inclusive, with each integer representing a colour, wishing for the colours to see in the coming meteor outburst. Two incredible outbursts then arrived, each with *n* meteorids, colours of which being integer sequences *a*1,<=*a*2,<=...,<=*a**n* and *b*1,<=*b*2,<=...,<=*b**n* respectively. Meteoroids' colours were also between 1 and *n* inclusive, and the two sequences were not identical, that is, at least one *i* (1<=≤<=*i*<=≤<=*n*) exists, such that *a**i*<=≠<=*b**i* holds.
Well, she almost had it all — each of the sequences *a* and *b* matched exactly *n*<=-<=1 elements in Sengoku's permutation. In other words, there is exactly one *i* (1<=≤<=*i*<=≤<=*n*) such that *a**i*<=≠<=*p**i*, and exactly one *j* (1<=≤<=*j*<=≤<=*n*) such that *b**j*<=≠<=*p**j*.
For now, Sengoku is able to recover the actual colour sequences *a* and *b* through astronomical records, but her wishes have been long forgotten. You are to reconstruct any possible permutation Sengoku could have had on that night.
Input Specification:
The first line of input contains a positive integer *n* (2<=≤<=*n*<=≤<=1<=000) — the length of Sengoku's permutation, being the length of both meteor outbursts at the same time.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the sequence of colours in the first meteor outburst.
The third line contains *n* space-separated integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=*n*) — the sequence of colours in the second meteor outburst. At least one *i* (1<=≤<=*i*<=≤<=*n*) exists, such that *a**i*<=≠<=*b**i* holds.
Output Specification:
Output *n* space-separated integers *p*1,<=*p*2,<=...,<=*p**n*, denoting a possible permutation Sengoku could have had. If there are more than one possible answer, output any one of them.
Input guarantees that such permutation exists.
Demo Input:
['5\n1 2 3 4 3\n1 2 5 4 5\n', '5\n4 4 2 3 1\n5 4 5 3 1\n', '4\n1 1 3 4\n1 4 3 4\n']
Demo Output:
['1 2 5 4 3\n', '5 4 2 3 1\n', '1 2 3 4\n']
Note:
In the first sample, both 1, 2, 5, 4, 3 and 1, 2, 3, 4, 5 are acceptable outputs.
In the second sample, 5, 4, 2, 3, 1 is the only permutation to satisfy the constraints.
|
```python
n=int(input())
a=list(map(int,input().split()))
b=list(map(int,input().split()))
c=[]
for i in range(n):
if(a[i] != b[i]):
c.append(i)
d=set()
s1=set(a)
s2=set(b)
s3=set(range(1,n+1))
d=s3-s1
d.update(s3-s2)
d=list(d)
if(a[c[0]] == d[0]):
a[c[1]] = d[1]
elif a[c[0]] == d[1]:
a[c[1]] = d[0]
elif a[c[1]] == d[0]:
a[c[0]] = d[1]
else:
a[c[0]] = d[0]
print(*a)
```
| -1
|
|
758
|
A
|
Holiday Of Equality
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
In Berland it is the holiday of equality. In honor of the holiday the king decided to equalize the welfare of all citizens in Berland by the expense of the state treasury.
Totally in Berland there are *n* citizens, the welfare of each of them is estimated as the integer in *a**i* burles (burle is the currency in Berland).
You are the royal treasurer, which needs to count the minimum charges of the kingdom on the king's present. The king can only give money, he hasn't a power to take away them.
|
The first line contains the integer *n* (1<=≤<=*n*<=≤<=100) — the number of citizens in the kingdom.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (0<=≤<=*a**i*<=≤<=106) — the welfare of the *i*-th citizen.
|
In the only line print the integer *S* — the minimum number of burles which are had to spend.
|
[
"5\n0 1 2 3 4\n",
"5\n1 1 0 1 1\n",
"3\n1 3 1\n",
"1\n12\n"
] |
[
"10",
"1",
"4",
"0"
] |
In the first example if we add to the first citizen 4 burles, to the second 3, to the third 2 and to the fourth 1, then the welfare of all citizens will equal 4.
In the second example it is enough to give one burle to the third citizen.
In the third example it is necessary to give two burles to the first and the third citizens to make the welfare of citizens equal 3.
In the fourth example it is possible to give nothing to everyone because all citizens have 12 burles.
| 500
|
[
{
"input": "5\n0 1 2 3 4",
"output": "10"
},
{
"input": "5\n1 1 0 1 1",
"output": "1"
},
{
"input": "3\n1 3 1",
"output": "4"
},
{
"input": "1\n12",
"output": "0"
},
{
"input": "3\n1 2 3",
"output": "3"
},
{
"input": "14\n52518 718438 358883 462189 853171 592966 225788 46977 814826 295697 676256 561479 56545 764281",
"output": "5464380"
},
{
"input": "21\n842556 216391 427181 626688 775504 168309 851038 448402 880826 73697 593338 519033 135115 20128 424606 939484 846242 756907 377058 241543 29353",
"output": "9535765"
},
{
"input": "3\n1 3 2",
"output": "3"
},
{
"input": "3\n2 1 3",
"output": "3"
},
{
"input": "3\n2 3 1",
"output": "3"
},
{
"input": "3\n3 1 2",
"output": "3"
},
{
"input": "3\n3 2 1",
"output": "3"
},
{
"input": "1\n228503",
"output": "0"
},
{
"input": "2\n32576 550340",
"output": "517764"
},
{
"input": "3\n910648 542843 537125",
"output": "741328"
},
{
"input": "4\n751720 572344 569387 893618",
"output": "787403"
},
{
"input": "6\n433864 631347 597596 794426 713555 231193",
"output": "1364575"
},
{
"input": "9\n31078 645168 695751 126111 375934 150495 838412 434477 993107",
"output": "4647430"
},
{
"input": "30\n315421 772664 560686 654312 151528 356749 351486 707462 820089 226682 546700 136028 824236 842130 578079 337807 665903 764100 617900 822937 992759 591749 651310 742085 767695 695442 17967 515106 81059 186025",
"output": "13488674"
},
{
"input": "45\n908719 394261 815134 419990 926993 383792 772842 277695 527137 655356 684956 695716 273062 550324 106247 399133 442382 33076 462920 294674 846052 817752 421365 474141 290471 358990 109812 74492 543281 169434 919692 786809 24028 197184 310029 801476 699355 429672 51343 374128 776726 850380 293868 981569 550763",
"output": "21993384"
},
{
"input": "56\n100728 972537 13846 385421 756708 184642 259487 319707 376662 221694 675284 972837 499419 13846 38267 289898 901299 831197 954715 197515 514102 910423 127555 883934 362472 870788 538802 741008 973434 448124 391526 363321 947321 544618 68006 782313 955075 741981 815027 723297 585059 718114 700739 413489 454091 736144 308999 98065 3716 347323 9635 289003 986510 607065 60236 273351",
"output": "26984185"
},
{
"input": "70\n644488 5444 150441 714420 602059 335330 510670 196555 546346 740011 509449 850947 692874 524857 750434 952985 223744 374727 896124 753037 367352 679050 560202 172728 569291 778616 332116 286927 843598 372698 244906 498046 900681 709791 420904 724593 864493 813094 791377 39998 296710 625656 403891 579231 706693 984045 16901 574259 562265 761104 930361 256045 124461 538980 573508 372148 988722 108592 784354 55302 232524 277205 782251 299943 436488 743389 324618 742543 266915 99642",
"output": "32816391"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n1000000",
"output": "0"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100\n1000000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "99000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1000000",
"output": "99000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1000000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "99000000"
},
{
"input": "3\n0 0 0",
"output": "0"
},
{
"input": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "3\n5 0 0",
"output": "10"
},
{
"input": "5\n2 10 0 0 0",
"output": "38"
}
] | 1,683,130,058
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 41
| 46
| 0
|
people_count = int(input())
people = [int(x) for x in input().split()]
i = 0
costs = 0
max_wealth = max(people)
while i < people_count:
costs += max_wealth - people[i]
i += 1
print(costs)
|
Title: Holiday Of Equality
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In Berland it is the holiday of equality. In honor of the holiday the king decided to equalize the welfare of all citizens in Berland by the expense of the state treasury.
Totally in Berland there are *n* citizens, the welfare of each of them is estimated as the integer in *a**i* burles (burle is the currency in Berland).
You are the royal treasurer, which needs to count the minimum charges of the kingdom on the king's present. The king can only give money, he hasn't a power to take away them.
Input Specification:
The first line contains the integer *n* (1<=≤<=*n*<=≤<=100) — the number of citizens in the kingdom.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (0<=≤<=*a**i*<=≤<=106) — the welfare of the *i*-th citizen.
Output Specification:
In the only line print the integer *S* — the minimum number of burles which are had to spend.
Demo Input:
['5\n0 1 2 3 4\n', '5\n1 1 0 1 1\n', '3\n1 3 1\n', '1\n12\n']
Demo Output:
['10', '1', '4', '0']
Note:
In the first example if we add to the first citizen 4 burles, to the second 3, to the third 2 and to the fourth 1, then the welfare of all citizens will equal 4.
In the second example it is enough to give one burle to the third citizen.
In the third example it is necessary to give two burles to the first and the third citizens to make the welfare of citizens equal 3.
In the fourth example it is possible to give nothing to everyone because all citizens have 12 burles.
|
```python
people_count = int(input())
people = [int(x) for x in input().split()]
i = 0
costs = 0
max_wealth = max(people)
while i < people_count:
costs += max_wealth - people[i]
i += 1
print(costs)
```
| 3
|
|
902
|
B
|
Coloring a Tree
|
PROGRAMMING
| 1,200
|
[
"dfs and similar",
"dsu",
"greedy"
] | null | null |
You are given a rooted tree with *n* vertices. The vertices are numbered from 1 to *n*, the root is the vertex number 1.
Each vertex has a color, let's denote the color of vertex *v* by *c**v*. Initially *c**v*<==<=0.
You have to color the tree into the given colors using the smallest possible number of steps. On each step you can choose a vertex *v* and a color *x*, and then color all vectices in the subtree of *v* (including *v* itself) in color *x*. In other words, for every vertex *u*, such that the path from root to *u* passes through *v*, set *c**u*<==<=*x*.
It is guaranteed that you have to color each vertex in a color different from 0.
You can learn what a rooted tree is using the link: [https://en.wikipedia.org/wiki/Tree_(graph_theory)](https://en.wikipedia.org/wiki/Tree_(graph_theory)).
|
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=104) — the number of vertices in the tree.
The second line contains *n*<=-<=1 integers *p*2,<=*p*3,<=...,<=*p**n* (1<=≤<=*p**i*<=<<=*i*), where *p**i* means that there is an edge between vertices *i* and *p**i*.
The third line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=*n*), where *c**i* is the color you should color the *i*-th vertex into.
It is guaranteed that the given graph is a tree.
|
Print a single integer — the minimum number of steps you have to perform to color the tree into given colors.
|
[
"6\n1 2 2 1 5\n2 1 1 1 1 1\n",
"7\n1 1 2 3 1 4\n3 3 1 1 1 2 3\n"
] |
[
"3\n",
"5\n"
] |
The tree from the first sample is shown on the picture (numbers are vetices' indices):
<img class="tex-graphics" src="https://espresso.codeforces.com/10324ccdc37f95343acc4f3c6050d8c334334ffa.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On first step we color all vertices in the subtree of vertex 1 into color 2 (numbers are colors):
<img class="tex-graphics" src="https://espresso.codeforces.com/1c7bb267e2c1a006132248a43121400189309e2f.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On seond step we color all vertices in the subtree of vertex 5 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/2201a6d49b89ba850ff0d0bdcbb3f8e9dd3871a8.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On third step we color all vertices in the subtree of vertex 2 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/6fa977fcdebdde94c47695151e0427b33d0102c5.png" style="max-width: 100.0%;max-height: 100.0%;"/>
The tree from the second sample is shown on the picture (numbers are vetices' indices):
<img class="tex-graphics" src="https://espresso.codeforces.com/d70f9ae72a2ed429dd6531cac757e375dd3c953d.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On first step we color all vertices in the subtree of vertex 1 into color 3 (numbers are colors):
<img class="tex-graphics" src="https://espresso.codeforces.com/7289e8895d0dd56c47b6b17969b9cf77b36786b5.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On second step we color all vertices in the subtree of vertex 3 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/819001df7229138db3a407713744d1e3be88b64e.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On third step we color all vertices in the subtree of vertex 6 into color 2:
<img class="tex-graphics" src="https://espresso.codeforces.com/80ebbd870a0a339636a21b9acdaf9de046458b43.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On fourth step we color all vertices in the subtree of vertex 4 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/ed836aa723ac0176abde4e32988e3ac205014e93.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On fith step we color all vertices in the subtree of vertex 7 into color 3:
<img class="tex-graphics" src="https://espresso.codeforces.com/8132909e11b41c27b8df2f0b0c10bc841f35e58a.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 1,000
|
[
{
"input": "6\n1 2 2 1 5\n2 1 1 1 1 1",
"output": "3"
},
{
"input": "7\n1 1 2 3 1 4\n3 3 1 1 1 2 3",
"output": "5"
},
{
"input": "2\n1\n2 2",
"output": "1"
},
{
"input": "3\n1 1\n2 2 2",
"output": "1"
},
{
"input": "4\n1 2 1\n1 2 3 4",
"output": "4"
},
{
"input": "4\n1 2 3\n4 1 2 4",
"output": "4"
},
{
"input": "5\n1 2 1 4\n1 1 1 2 2",
"output": "2"
},
{
"input": "3\n1 2\n2 1 1",
"output": "2"
},
{
"input": "4\n1 1 1\n3 1 3 1",
"output": "3"
},
{
"input": "4\n1 1 2\n4 1 4 1",
"output": "2"
},
{
"input": "4\n1 2 2\n3 1 2 3",
"output": "4"
},
{
"input": "3\n1 1\n1 2 2",
"output": "3"
}
] | 1,558,183,023
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 17
| 171
| 2,252,800
|
N = int(input())
peaks = list(map(int, input().split()))
peaks = [p-1 for p in peaks]
target = list(map(int, input().split()))
colors = [0 for _ in range(N)]
tree = [[]]
i = 1
# building up tree
for peak in peaks:
tree.append([])
tree[peak].append(i)
i += 1
def paint(peak, color):
colors[peak] = color
for j in tree[peak]:
paint(j, color)
i = 0
ans = 0
while target != colors:
if colors[i] == target[i]:
i += 1
continue
paint(i, target[i])
i += 1
ans += 1
print(ans)
|
Title: Coloring a Tree
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a rooted tree with *n* vertices. The vertices are numbered from 1 to *n*, the root is the vertex number 1.
Each vertex has a color, let's denote the color of vertex *v* by *c**v*. Initially *c**v*<==<=0.
You have to color the tree into the given colors using the smallest possible number of steps. On each step you can choose a vertex *v* and a color *x*, and then color all vectices in the subtree of *v* (including *v* itself) in color *x*. In other words, for every vertex *u*, such that the path from root to *u* passes through *v*, set *c**u*<==<=*x*.
It is guaranteed that you have to color each vertex in a color different from 0.
You can learn what a rooted tree is using the link: [https://en.wikipedia.org/wiki/Tree_(graph_theory)](https://en.wikipedia.org/wiki/Tree_(graph_theory)).
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=104) — the number of vertices in the tree.
The second line contains *n*<=-<=1 integers *p*2,<=*p*3,<=...,<=*p**n* (1<=≤<=*p**i*<=<<=*i*), where *p**i* means that there is an edge between vertices *i* and *p**i*.
The third line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=*n*), where *c**i* is the color you should color the *i*-th vertex into.
It is guaranteed that the given graph is a tree.
Output Specification:
Print a single integer — the minimum number of steps you have to perform to color the tree into given colors.
Demo Input:
['6\n1 2 2 1 5\n2 1 1 1 1 1\n', '7\n1 1 2 3 1 4\n3 3 1 1 1 2 3\n']
Demo Output:
['3\n', '5\n']
Note:
The tree from the first sample is shown on the picture (numbers are vetices' indices):
<img class="tex-graphics" src="https://espresso.codeforces.com/10324ccdc37f95343acc4f3c6050d8c334334ffa.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On first step we color all vertices in the subtree of vertex 1 into color 2 (numbers are colors):
<img class="tex-graphics" src="https://espresso.codeforces.com/1c7bb267e2c1a006132248a43121400189309e2f.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On seond step we color all vertices in the subtree of vertex 5 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/2201a6d49b89ba850ff0d0bdcbb3f8e9dd3871a8.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On third step we color all vertices in the subtree of vertex 2 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/6fa977fcdebdde94c47695151e0427b33d0102c5.png" style="max-width: 100.0%;max-height: 100.0%;"/>
The tree from the second sample is shown on the picture (numbers are vetices' indices):
<img class="tex-graphics" src="https://espresso.codeforces.com/d70f9ae72a2ed429dd6531cac757e375dd3c953d.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On first step we color all vertices in the subtree of vertex 1 into color 3 (numbers are colors):
<img class="tex-graphics" src="https://espresso.codeforces.com/7289e8895d0dd56c47b6b17969b9cf77b36786b5.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On second step we color all vertices in the subtree of vertex 3 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/819001df7229138db3a407713744d1e3be88b64e.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On third step we color all vertices in the subtree of vertex 6 into color 2:
<img class="tex-graphics" src="https://espresso.codeforces.com/80ebbd870a0a339636a21b9acdaf9de046458b43.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On fourth step we color all vertices in the subtree of vertex 4 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/ed836aa723ac0176abde4e32988e3ac205014e93.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On fith step we color all vertices in the subtree of vertex 7 into color 3:
<img class="tex-graphics" src="https://espresso.codeforces.com/8132909e11b41c27b8df2f0b0c10bc841f35e58a.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
N = int(input())
peaks = list(map(int, input().split()))
peaks = [p-1 for p in peaks]
target = list(map(int, input().split()))
colors = [0 for _ in range(N)]
tree = [[]]
i = 1
# building up tree
for peak in peaks:
tree.append([])
tree[peak].append(i)
i += 1
def paint(peak, color):
colors[peak] = color
for j in tree[peak]:
paint(j, color)
i = 0
ans = 0
while target != colors:
if colors[i] == target[i]:
i += 1
continue
paint(i, target[i])
i += 1
ans += 1
print(ans)
```
| -1
|
Subsets and Splits
Successful Python Submissions
Retrieves all records from the train dataset where the verdict is 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Retrieves records of users with a rating of 1600 or higher and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a rating above 2000 and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a 'OK' verdict, providing a basic overview of a specific category within the dataset.